Symbol:
Hprt1
Name:
hypoxanthine phosphoribosyltransferase 1
RGD ID:
2826
Description:
Enables hypoxanthine phosphoribosyltransferase activity. Involved in cellular response to insulin stimulus; hypoxanthine metabolic process; and spermatogenesis. Predicted to be located in cytoplasm. Predicted to be active in cytosol. Biomarker of hepatocellular carcinoma. Human ortholog(s) of this gene implicated in HRPT-related hyperuricemia and Lesch-Nyhan syndrome. Orthologous to human HPRT1 (hypoxanthine phosphoribosyltransferase 1); PARTICIPATES IN adenine phoshoribosyltransferase deficiency pathway; adenosine monophosphate deaminase deficiency pathway; adenylosuccinate lyase deficiency pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-Chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
HGPRT; Hgprtase; Hprt; hypoxanthine guanine phosphoribosyl transferase; hypoxanthine guanine phosphoribosyl transferase 1; Hypoxanthine phosphoribosyl transferase; hypoxanthine-guanine phosphoribosyltransferase; LOC103689983; MGC112554
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 137,655,744 - 137,687,718 (+) NCBI GRCr8 mRatBN7.2 X 132,736,175 - 132,768,149 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 132,736,096 - 132,768,154 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 134,896,246 - 134,928,216 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 138,479,092 - 138,511,062 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 136,044,802 - 136,076,774 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 158,196,640 - 158,228,815 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 158,623,240 - 158,655,198 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 158,197,149 - 158,228,749 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 152,821,947 - 152,854,198 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 X 153,249,874 - 153,281,841 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 139,929,647 - 139,961,616 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 140,003,079 - 140,035,048 (+) NCBI Cytogenetic Map X q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hprt1 Rat (1->4)-beta-D-glucan multiple interactions ISO Hprt1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HPRT1 mRNA CTD PMID:36331819 Hprt1 Rat 1,1,1-trichloroethane increases expression ISO Hprt1 (Mus musculus) 6480464 1 more ... CTD PMID:25270620 Hprt1 Rat 1,2-dimethylhydrazine decreases expression ISO Hprt1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of HPRT1 mRNA CTD PMID:22206623 Hprt1 Rat 1,2-dimethylhydrazine multiple interactions ISO Hprt1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HPRT1 mRNA CTD PMID:22206623 Hprt1 Rat 1-aminobenzotriazole multiple interactions ISO HPRT1 (Homo sapiens) 6480464 1-aminobenzotriazole inhibits the reaction [[[SULT1A1 protein co-treated with CYP2E1 protein] results in increased susceptibility to 1-methylpyrene] which results in increased mutagenesis of HPRT1 gene] CTD PMID:25243916 Hprt1 Rat 1-Methylpyrene multiple interactions ISO HPRT1 (Homo sapiens) 6480464 1-aminobenzotriazole inhibits the reaction [[[SULT1A1 protein co-treated with CYP2E1 protein] results in increased susceptibility to 1-methylpyrene] which results in increased mutagenesis of HPRT1 gene] more ... CTD PMID:25243916 Hprt1 Rat 1-nitropyrene multiple interactions ISO HPRT1 (Homo sapiens) 6480464 CYP1A2 affects the reaction [1-nitropyrene results in increased mutagenesis of HPRT1 gene] CTD PMID:10727902 Hprt1 Rat 17alpha-ethynylestradiol multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HPRT1 mRNA CTD PMID:17942748 Hprt1 Rat 17alpha-ethynylestradiol increases expression ISO Hprt1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of HPRT1 mRNA CTD PMID:17555576 and PMID:17942748 Hprt1 Rat 17beta-estradiol increases expression ISO Hprt1 (Mus musculus) 6480464 Estradiol results in increased expression of HPRT1 mRNA CTD PMID:22467019 and PMID:39298647 Hprt1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of HPRT1 mRNA CTD PMID:26496021 Hprt1 Rat 2,2',4,5-tetrachlorobiphenyl multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [[SULT1A1 protein co-treated with CYP2E1 protein] results in increased susceptibility to 2 more ... CTD PMID:27913846 Hprt1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [[SULT1A1 protein co-treated with CYP2E1 protein] results in increased susceptibility to 2 more ... CTD PMID:27913846 Hprt1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HPRT1 mRNA and Tetrachlorodibenzodioxin affects the reaction [AHR protein binds to HPRT1 promoter] CTD PMID:17942748 and PMID:19654925 Hprt1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HPRT1 mRNA CTD PMID:34747641 Hprt1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO HPRT1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of HPRT1 mRNA CTD PMID:22574217 Hprt1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hprt1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HPRT1 mRNA CTD PMID:21570461 Hprt1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HPRT1 mRNA CTD PMID:21215274 Hprt1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hprt1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HPRT1 mRNA CTD PMID:17942748 Hprt1 Rat 2-Amino-9H-pyrido[2,3-b]indole multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [CYP1A2 protein co-treated with NAT2 gene polymorphism] promotes the reaction [2-amino-9H-pyrido(2 and 3-b)indole binds to and results in increased mutagenesis of HPRT1 gene] CTD PMID:19243127 Hprt1 Rat 2-hydroxypropanoic acid decreases expression ISO HPRT1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of HPRT1 mRNA CTD PMID:30851411 Hprt1 Rat 2-naphthylamine multiple interactions ISO HPRT1 (Homo sapiens) 6480464 NAT2 polymorphism affects the reaction [2-Naphthylamine results in increased mutagenesis of HPRT1 gene] CTD PMID:36040704 Hprt1 Rat 3-Amino-1-methyl-5H-pyrido[4,3-b]indole increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 3-amino-1-methyl-5H-pyrido(4 and 3-b)indole results in increased mutagenesis of HPRT1 gene CTD PMID:2335011 Hprt1 Rat 3-Chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone increases mutagenesis EXP 6480464 3-chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone results in increased mutagenesis of HPRT1 gene CTD PMID:17993254 Hprt1 Rat 3-chloropropane-1,2-diol affects expression EXP 6480464 alpha-Chlorohydrin affects the expression of HPRT1 mRNA CTD PMID:28522335 Hprt1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of HPRT1 protein CTD PMID:34915118 Hprt1 Rat 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine increases mutagenesis EXP 6480464 2-amino-3-methylimidazo(4 and 5-f)quinoline results in increased mutagenesis of HPRT1 gene CTD PMID:12467141 Hprt1 Rat 3-Nitrobenzanthrone multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [NAT2 protein co-treated with 3-nitrobenzanthrone] results in increased mutagenesis of HPRT1 gene and [SULT1A1 protein co-treated with 3-nitrobenzanthrone] results in increased mutagenesis of HPRT1 gene CTD PMID:17483118 Hprt1 Rat 3-phenylprop-2-enal decreases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 cinnamaldehyde results in decreased mutagenesis of HPRT1 gene CTD PMID:17178418 Hprt1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of HPRT1 mRNA CTD PMID:19162173 Hprt1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Hprt1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of HPRT1 mRNA CTD PMID:18648102 Hprt1 Rat 4,4'-sulfonyldiphenol increases expression ISO Hprt1 (Mus musculus) 6480464 bisphenol S results in increased expression of HPRT1 mRNA CTD PMID:39298647 Hprt1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HPRT1 mRNA CTD PMID:36041667 Hprt1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Ozone co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased mutagenesis of HPRT1 gene and Dibutyl Phthalate promotes the reaction [[Ozone co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased mutagenesis of HPRT1 gene] CTD PMID:15613823 Hprt1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased mutagenesis of HPRT1 gene CTD PMID:15613823 Hprt1 Rat 4-hydroxynon-2-enal increases expression ISO Hprt1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of HPRT1 mRNA CTD PMID:19191707 Hprt1 Rat 4-nitroquinoline N-oxide increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 4-Nitroquinoline-1-oxide results in increased mutagenesis of HPRT1 gene CTD PMID:26362870 and PMID:28454271 Hprt1 Rat 5-aza-2'-deoxycytidine increases expression ISO Hprt1 (Mus musculus) 6480464 Decitabine results in increased expression of HPRT1 mRNA CTD PMID:27915011 Hprt1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of HPRT1 mRNA CTD PMID:19483382 Hprt1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of HPRT1 mRNA CTD PMID:19483382 Hprt1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of HPRT1 mRNA CTD PMID:30047161 Hprt1 Rat acrylamide increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Acrylamide results in increased mutagenesis of HPRT1 gene CTD PMID:15957192 Hprt1 Rat acrylamide increases expression ISO HPRT1 (Homo sapiens) 6480464 Acrylamide results in increased expression of HPRT1 mRNA CTD PMID:32763439 Hprt1 Rat acrylamide increases mutagenesis EXP 6480464 Acrylamide results in increased mutagenesis of HPRT1 gene CTD PMID:20200216 Hprt1 Rat acrylamide increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 Acrylamide results in increased mutagenesis of HPRT1 gene CTD PMID:18407966 Hprt1 Rat acrylonitrile increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Acrylonitrile results in increased mutagenesis of HPRT1 gene CTD PMID:32529832 Hprt1 Rat acrylonitrile increases mutagenesis EXP 6480464 Acrylonitrile results in increased mutagenesis of HPRT1 gene CTD PMID:32529823 Hprt1 Rat acrylonitrile multiple interactions ISO Hprt1 (Mus musculus) 6480464 CYP2E1 gene mutant form inhibits the reaction [Acrylonitrile results in increased mutagenesis of HPRT1 gene] CTD PMID:32529832 Hprt1 Rat aldehydo-D-glucose decreases expression ISO HPRT1 (Homo sapiens) 6480464 Glucose results in decreased expression of HPRT1 mRNA CTD PMID:31655124 Hprt1 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of HPRT1 mRNA CTD PMID:24977338 Hprt1 Rat all-trans-retinoic acid decreases expression ISO HPRT1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of HPRT1 mRNA CTD PMID:21934132 more ... Hprt1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of HPRT1 mRNA CTD PMID:19483382 Hprt1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of HPRT1 mRNA CTD PMID:30047161 Hprt1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HPRT1 mRNA CTD PMID:16483693 Hprt1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of HPRT1 mRNA CTD PMID:30779732 Hprt1 Rat aristolochic acid A decreases expression ISO HPRT1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of HPRT1 mRNA CTD PMID:33212167 Hprt1 Rat aristolochic acid A increases expression ISO HPRT1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of HPRT1 protein CTD PMID:33212167 Hprt1 Rat Aroclor 1254 decreases expression ISO Hprt1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of HPRT1 mRNA CTD PMID:23650126 Hprt1 Rat arsane decreases expression ISO HPRT1 (Homo sapiens) 6480464 Arsenic results in decreased expression of HPRT1 mRNA CTD PMID:36178927 Hprt1 Rat arsenic atom decreases expression ISO HPRT1 (Homo sapiens) 6480464 Arsenic results in decreased expression of HPRT1 mRNA CTD PMID:36178927 Hprt1 Rat arsenite(3-) multiple interactions ISO HPRT1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to HPRT1 protein] CTD PMID:32406909 Hprt1 Rat atrazine decreases expression ISO HPRT1 (Homo sapiens) 6480464 Atrazine results in decreased expression of HPRT1 mRNA CTD PMID:22378314 Hprt1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of HPRT1 mRNA CTD PMID:36841081 Hprt1 Rat azathioprine increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Azathioprine results in increased mutagenesis of HPRT1 gene CTD PMID:16107271 Hprt1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of HPRT1 mRNA CTD PMID:19483382 Hprt1 Rat benzene increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Benzene results in increased mutagenesis of HPRT1 gene CTD PMID:20035728 Hprt1 Rat benzidine multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [NAT1 polymorphism affects the susceptibility to benzidine] which affects the mutagenesis of HPRT1 CTD PMID:37097310 Hprt1 Rat benzo[a]pyrene multiple interactions ISO Hprt1 (Mus musculus) 6480464 Benzo(a)pyrene affects the reaction [AHR protein binds to HPRT1 promoter] and POLB protein promotes the reaction [Benzo(a)pyrene results in increased mutagenesis of HPRT1 gene] CTD PMID:19654925 and PMID:23652152 Hprt1 Rat benzo[a]pyrene increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased mutagenesis of HPRT1 gene CTD PMID:23652152 Hprt1 Rat benzo[a]pyrene affects methylation ISO HPRT1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HPRT1 promoter CTD PMID:27901495 Hprt1 Rat benzo[a]pyrene increases methylation ISO HPRT1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of HPRT1 5' UTR CTD PMID:27901495 Hprt1 Rat benzo[a]pyrene increases expression ISO HPRT1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HPRT1 mRNA CTD PMID:16269432 Hprt1 Rat benzo[a]pyrene multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [[POR protein co-treated with CYP3A4 protein] results in increased susceptibility to Benzo(a)pyrene] which results in increased mutagenesis of HPRT1 gene more ... CTD PMID:17525473 and PMID:27913846 Hprt1 Rat benzo[a]pyrene increases expression ISO Hprt1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of HPRT1 mRNA CTD PMID:22228805 Hprt1 Rat benzo[a]pyrene diol epoxide I multiple interactions ISO Hprt1 (Mus musculus) 6480464 POLH mutant form inhibits the reaction [7 more ... CTD PMID:22745795 Hprt1 Rat benzo[a]pyrene diol epoxide I multiple interactions ISO HPRT1 (Homo sapiens) 6480464 POLH mutant form inhibits the reaction [7 more ... CTD PMID:22745795 Hprt1 Rat benzo[a]pyrene diol epoxide I increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 7 more ... CTD PMID:22745795 Hprt1 Rat benzo[a]pyrene diol epoxide I increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 7 more ... CTD PMID:22745795 Hprt1 Rat Benzo[a]pyrene-7,8-diol multiple interactions ISO HPRT1 (Homo sapiens) 6480464 CYP1A1 protein promotes the reaction [benzo(a)pyrene 7 more ... CTD PMID:17525473 Hprt1 Rat beta-carotene multiple interactions EXP 6480464 beta Carotene inhibits the reaction [2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased mutagenesis of HPRT1 gene] CTD PMID:12467141 Hprt1 Rat biphenyl-4-amine multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [NAT1 polymorphism results in increased susceptibility to 4-biphenylamine] which results in increased mutagenesis of HPRT1 gene and NAT2 polymorphism affects the reaction [4-biphenylamine results in increased mutagenesis of HPRT1 gene] CTD PMID:22114069 and PMID:36040704 Hprt1 Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of HPRT1 mRNA CTD PMID:15651846 Hprt1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Hprt1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of HPRT1 mRNA CTD PMID:19850644 Hprt1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Hprt1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of HPRT1 mRNA CTD PMID:34319233 Hprt1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Hprt1 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of HPRT1 mRNA] CTD PMID:19850644 Hprt1 Rat bisphenol A increases expression ISO Hprt1 (Mus musculus) 6480464 bisphenol A results in increased expression of HPRT1 mRNA CTD PMID:25270620 Hprt1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HPRT1 mRNA CTD PMID:34947998 Hprt1 Rat bisphenol A decreases expression ISO HPRT1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HPRT1 mRNA CTD PMID:29275510 and PMID:33670352 Hprt1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HPRT1 protein CTD PMID:22649256 Hprt1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HPRT1 mRNA CTD PMID:25181051 Hprt1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HPRT1 mRNA and [bisphenol A co-treated with Estradiol] results in decreased expression of HPRT1 mRNA CTD PMID:26496021 and PMID:36041667 Hprt1 Rat Bisphenol B increases expression ISO HPRT1 (Homo sapiens) 6480464 bisphenol B results in increased expression of HPRT1 protein CTD PMID:34186270 Hprt1 Rat bisphenol F increases expression ISO HPRT1 (Homo sapiens) 6480464 bisphenol F results in increased expression of HPRT1 protein CTD PMID:34186270 Hprt1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HPRT1 mRNA CTD PMID:36041667 Hprt1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of HPRT1 protein CTD PMID:28903499 Hprt1 Rat bromuconazole increases expression EXP 6480464 bromuconazole results in increased expression of HPRT1 mRNA CTD PMID:33789219 Hprt1 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of HPRT1 mRNA CTD PMID:24136188 Hprt1 Rat buta-1,3-diene increases mutagenesis EXP 6480464 1 more ... CTD PMID:20017413 more ... Hprt1 Rat buta-1,3-diene increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 1 and 3-butadiene metabolite results in increased mutagenesis of HPRT1 gene CTD PMID:20853577 Hprt1 Rat buta-1,3-diene increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 1 more ... CTD PMID:20017413 more ... Hprt1 Rat cadmium dichloride multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of HPRT1 mRNA CTD PMID:19840844 Hprt1 Rat caffeine increases expression EXP 6480464 Caffeine results in increased expression of HPRT1 protein CTD PMID:6149265 Hprt1 Rat calcitriol multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of HPRT1 mRNA CTD PMID:21592394 Hprt1 Rat calcitriol decreases expression ISO HPRT1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of HPRT1 mRNA CTD PMID:21592394 Hprt1 Rat calyculin a increases expression ISO Hprt1 (Mus musculus) 6480464 calyculin A results in increased expression of HPRT1 mRNA CTD PMID:25270620 Hprt1 Rat carbon nanotube increases expression ISO Hprt1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Hprt1 Rat carmustine increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Carmustine results in increased mutagenesis of HPRT1 gene CTD PMID:17116724 Hprt1 Rat chromium(6+) increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 chromium hexavalent ion results in increased mutagenesis of HPRT1 gene CTD PMID:7508562 Hprt1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of HPRT1 mRNA CTD PMID:19483382 Hprt1 Rat clofibrate increases expression ISO Hprt1 (Mus musculus) 6480464 Clofibrate results in increased expression of HPRT1 mRNA CTD PMID:17585979 Hprt1 Rat clofibrate multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HPRT1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of HPRT1 mRNA] CTD PMID:17585979 Hprt1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of HPRT1 mRNA CTD PMID:17602206 Hprt1 Rat cobalt dichloride decreases expression ISO HPRT1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of HPRT1 mRNA CTD PMID:19320972 Hprt1 Rat coumarin decreases phosphorylation ISO HPRT1 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of HPRT1 protein CTD PMID:35688186 Hprt1 Rat coumestrol increases expression ISO HPRT1 (Homo sapiens) 6480464 Coumestrol results in increased expression of HPRT1 mRNA CTD PMID:19167446 Hprt1 Rat coumestrol multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Hprt1 Rat curcumin increases expression ISO HPRT1 (Homo sapiens) 6480464 Curcumin results in increased expression of HPRT1 mRNA CTD PMID:16101141 Hprt1 Rat cyclophosphamide increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Cyclophosphamide results in increased mutagenesis of HPRT1 gene CTD PMID:17116724 Hprt1 Rat cyclophosphamide increases mutagenesis EXP 6480464 Cyclophosphamide results in increased mutagenesis of HPRT1 gene CTD PMID:23677247 Hprt1 Rat cyclosporin A increases expression ISO HPRT1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of HPRT1 mRNA CTD PMID:27989131 Hprt1 Rat cyhalothrin increases expression EXP 6480464 cyhalothrin results in increased expression of HPRT1 mRNA CTD PMID:29727961 Hprt1 Rat cyproconazole increases expression ISO Hprt1 (Mus musculus) 6480464 cyproconazole results in increased expression of HPRT1 mRNA CTD PMID:22334560 Hprt1 Rat cyproconazole decreases expression ISO Hprt1 (Mus musculus) 6480464 cyproconazole results in decreased expression of HPRT1 mRNA CTD PMID:22045034 Hprt1 Rat D-glucose decreases expression ISO HPRT1 (Homo sapiens) 6480464 Glucose results in decreased expression of HPRT1 mRNA CTD PMID:31655124 Hprt1 Rat D-mannitol increases expression ISO Hprt1 (Mus musculus) 6480464 Mannitol results in increased expression of HPRT1 mRNA CTD PMID:25270620 Hprt1 Rat DDE increases expression ISO HPRT1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of HPRT1 mRNA CTD PMID:38568856 Hprt1 Rat deguelin increases expression ISO HPRT1 (Homo sapiens) 6480464 deguelin results in increased expression of HPRT1 mRNA CTD PMID:33512557 Hprt1 Rat dibutyl phthalate multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Ozone co-treated with Dibutyl Phthalate] results in increased mutagenesis of HPRT1 gene and Dibutyl Phthalate promotes the reaction [[Ozone co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased mutagenesis of HPRT1 gene] CTD PMID:15613823 Hprt1 Rat dibutyl phthalate increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased mutagenesis of HPRT1 gene CTD PMID:15613823 Hprt1 Rat dichlorine increases expression EXP 6480464 Chlorine results in increased expression of HPRT1 mRNA CTD PMID:18636392 Hprt1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of HPRT1 mRNA CTD PMID:18636392 Hprt1 Rat diepoxybutane increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 diepoxybutane results in increased mutagenesis of HPRT1 gene CTD PMID:20853577 Hprt1 Rat Diisodecyl phthalate increases expression ISO Hprt1 (Mus musculus) 6480464 diisodecyl phthalate results in increased expression of HPRT1 mRNA CTD PMID:25270620 Hprt1 Rat dimethyl sulfoxide decreases expression EXP 6480464 Dimethyl Sulfoxide results in decreased expression of HPRT1 mRNA CTD PMID:12883083 Hprt1 Rat dioxygen decreases expression ISO HPRT1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of HPRT1 mRNA CTD PMID:35883890 Hprt1 Rat dorsomorphin multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HPRT1 mRNA CTD PMID:27188386 Hprt1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of HPRT1 mRNA CTD PMID:29391264 Hprt1 Rat Enterolactone multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of HPRT1 mRNA CTD PMID:19167446 Hprt1 Rat enzyme inhibitor multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of HPRT1 protein CTD PMID:23301498 Hprt1 Rat epoxiconazole increases expression ISO Hprt1 (Mus musculus) 6480464 epoxiconazole results in increased expression of HPRT1 mRNA CTD PMID:22334560 Hprt1 Rat ethanol increases expression ISO Hprt1 (Mus musculus) 6480464 Ethanol results in increased expression of HPRT1 mRNA CTD PMID:30319688 Hprt1 Rat ethyl methanesulfonate increases mutagenesis EXP 6480464 Ethyl Methanesulfonate results in increased mutagenesis of HPRT1 gene CTD PMID:7728755 Hprt1 Rat fenthion increases expression ISO Hprt1 (Mus musculus) 6480464 Fenthion results in increased expression of HPRT1 mRNA CTD PMID:34813904 Hprt1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of HPRT1 mRNA CTD PMID:23962444 Hprt1 Rat folic acid multiple interactions ISO Hprt1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HPRT1 mRNA CTD PMID:22206623 Hprt1 Rat fructose decreases expression ISO HPRT1 (Homo sapiens) 6480464 Fructose results in decreased expression of HPRT1 mRNA CTD PMID:31655124 Hprt1 Rat fumonisin B1 increases expression ISO Hprt1 (Mus musculus) 6480464 fumonisin B1 results in increased expression of HPRT1 mRNA CTD PMID:16221962 Hprt1 Rat gamma-hexachlorocyclohexane decreases expression EXP 6480464 Hexachlorocyclohexane results in decreased expression of HPRT1 mRNA CTD PMID:17785943 Hprt1 Rat genistein decreases expression ISO HPRT1 (Homo sapiens) 6480464 Genistein results in decreased expression of HPRT1 mRNA CTD PMID:22228119 Hprt1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HPRT1 mRNA CTD PMID:33387578 Hprt1 Rat glucose decreases expression ISO HPRT1 (Homo sapiens) 6480464 Glucose results in decreased expression of HPRT1 mRNA CTD PMID:31655124 Hprt1 Rat gold atom decreases expression ISO HPRT1 (Homo sapiens) 6480464 Gold results in decreased expression of HPRT1 mRNA CTD PMID:25523186 Hprt1 Rat gold(0) decreases expression ISO HPRT1 (Homo sapiens) 6480464 Gold results in decreased expression of HPRT1 mRNA CTD PMID:25523186 Hprt1 Rat hexaconazole decreases expression ISO Hprt1 (Mus musculus) 6480464 hexaconazole results in decreased expression of HPRT1 mRNA CTD PMID:22045034 Hprt1 Rat hydrogen peroxide increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased mutagenesis of HPRT1 gene CTD PMID:22539617 and PMID:7508562 Hprt1 Rat hypochlorous acid increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 Hypochlorous Acid results in increased mutagenesis of HPRT1 gene CTD PMID:19892774 Hprt1 Rat inulin multiple interactions ISO Hprt1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of HPRT1 mRNA CTD PMID:36331819 Hprt1 Rat isoniazide increases expression EXP 6480464 Isoniazid results in increased expression of HPRT1 mRNA CTD PMID:12883083 Hprt1 Rat ivermectin decreases expression ISO HPRT1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HPRT1 protein CTD PMID:32959892 Hprt1 Rat L-ascorbic acid multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased mutagenesis of HPRT1 gene] CTD PMID:12467141 Hprt1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of HPRT1 mRNA CTD PMID:19483382 Hprt1 Rat lead diacetate decreases activity ISO HPRT1 (Homo sapiens) 6480464 lead acetate results in decreased activity of HPRT1 protein CTD PMID:19428946 Hprt1 Rat lead diacetate decreases expression ISO Hprt1 (Mus musculus) 6480464 lead acetate results in decreased expression of HPRT1 mRNA CTD PMID:21829687 Hprt1 Rat lead diacetate decreases activity EXP 6480464 lead acetate results in decreased activity of HPRT1 protein CTD PMID:19428946 Hprt1 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of HPRT1 protein CTD PMID:18296634 Hprt1 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of HPRT1 protein CTD PMID:18296634 Hprt1 Rat MeIQ increases mutagenesis EXP 6480464 2-amino-3 more ... CTD PMID:12467141 Hprt1 Rat MeIQx increases mutagenesis EXP 6480464 2-amino-3 more ... CTD PMID:12467141 Hprt1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of HPRT1 mRNA CTD PMID:28935588 Hprt1 Rat methidathion increases expression ISO Hprt1 (Mus musculus) 6480464 methidathion results in increased expression of HPRT1 mRNA CTD PMID:34813904 Hprt1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of HPRT1 mRNA CTD PMID:30047161 Hprt1 Rat methotrexate decreases expression ISO HPRT1 (Homo sapiens) 6480464 Methotrexate results in decreased expression of HPRT1 mRNA CTD PMID:17400583 Hprt1 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of HPRT1 gene CTD PMID:23303685 Hprt1 Rat microcystin-LR increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 cyanoginosin LR results in increased mutagenesis of HPRT1 gene CTD PMID:36435412 Hprt1 Rat microcystin-LR multiple interactions ISO HPRT1 (Homo sapiens) 6480464 BLK protein inhibits the reaction [cyanoginosin LR results in increased mutagenesis of HPRT1 gene] CTD PMID:36435412 Hprt1 Rat N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of HPRT1 gene CTD PMID:22167886 Hprt1 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of HPRT1 gene CTD PMID:32529823 Hprt1 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of HPRT1 mRNA more ... CTD PMID:19840844 Hprt1 Rat N-methyl-N-nitrosourea increases mutagenesis EXP 6480464 Methylnitrosourea results in increased mutagenesis of HPRT1 gene CTD PMID:18249417 Hprt1 Rat N-methyl-N-nitrosourea increases expression ISO Hprt1 (Mus musculus) 6480464 Methylnitrosourea results in increased expression of HPRT1 mRNA CTD PMID:25270620 Hprt1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of HPRT1 mRNA CTD PMID:17602206 Hprt1 Rat N-nitrosodimethylamine multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [[SULT1A1 protein co-treated with CYP2E1 protein] results in increased susceptibility to Dimethylnitrosamine] which results in increased mutagenesis of HPRT1 gene CTD PMID:27913846 Hprt1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of HPRT1 mRNA CTD PMID:24136188 Hprt1 Rat neoglucobrassicin increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 1-methoxy-3-indolylmethylglucosinolate metabolite results in increased mutagenesis of HPRT1 gene CTD PMID:20846518 Hprt1 Rat nickel sulfate affects expression ISO HPRT1 (Homo sapiens) 6480464 nickel sulfate affects the expression of HPRT1 mRNA CTD PMID:18202158 Hprt1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of HPRT1 mRNA CTD PMID:24136188 Hprt1 Rat nitric oxide increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 Nitric Oxide results in increased mutagenesis of HPRT1 gene CTD PMID:22303861 and PMID:28454271 Hprt1 Rat okadaic acid increases expression ISO Hprt1 (Mus musculus) 6480464 Okadaic Acid results in increased expression of HPRT1 mRNA CTD PMID:25270620 Hprt1 Rat okadaic acid multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in increased expression of HPRT1 mRNA CTD PMID:19840844 Hprt1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of HPRT1 mRNA CTD PMID:19483382 Hprt1 Rat oxirane increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Ethylene Oxide results in increased mutagenesis of HPRT1 gene CTD PMID:10636004 Hprt1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of HPRT1 mRNA CTD PMID:18636392 Hprt1 Rat ozone increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 Ozone results in increased mutagenesis of HPRT1 gene CTD PMID:15613823 Hprt1 Rat ozone multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Ozone co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased mutagenesis of HPRT1 gene more ... CTD PMID:15613823 Hprt1 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of HPRT1 mRNA CTD PMID:27638505 Hprt1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of HPRT1 mRNA CTD PMID:12883083 Hprt1 Rat paracetamol multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HPRT1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of HPRT1 mRNA] CTD PMID:17585979 Hprt1 Rat paraquat increases expression ISO Hprt1 (Mus musculus) 6480464 Paraquat results in increased expression of HPRT1 mRNA CTD PMID:21371552 Hprt1 Rat pent-4-enoic acid increases expression EXP 6480464 4-pentenoic acid results in increased expression of HPRT1 mRNA CTD PMID:12883083 Hprt1 Rat pentachlorophenol multiple interactions ISO HPRT1 (Homo sapiens) 6480464 Pentachlorophenol inhibits the reaction [[[SULT1A1 protein co-treated with CYP2E1 protein] results in increased susceptibility to 1-hydroxymethylpyrene] which results in increased mutagenesis of HPRT1 gene] and Pentachlorophenol inhibits the reaction [[[SULT1A1 protein co-treated with CYP2E1 protein] results in increased susceptibility to 1-methylpyrene] which results in increased mutagenesis of HPRT1 gene] CTD PMID:25243916 Hprt1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Hprt1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HPRT1 mRNA more ... CTD PMID:36331819 Hprt1 Rat perfluorooctanoic acid increases expression ISO Hprt1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of HPRT1 mRNA CTD PMID:23626681 Hprt1 Rat perfluorooctanoic acid multiple interactions ISO Hprt1 (Mus musculus) 6480464 Dietary Fats and Unsaturated inhibits the reaction [perfluorooctanoic acid results in increased expression of HPRT1 mRNA] CTD PMID:23626681 Hprt1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of HPRT1 mRNA CTD PMID:16940010 Hprt1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of HPRT1 mRNA CTD PMID:30047161 Hprt1 Rat PhIP increases mutagenesis EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased mutagenesis of HPRT1 gene CTD PMID:11289141 and PMID:12467141 Hprt1 Rat PhIP increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 2-amino-1-methyl-6-phenylimidazo(4 more ... CTD PMID:10728688 more ... Hprt1 Rat PhIP multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [2-amino-1-methyl-6-phenylimidazo(4 more ... CTD PMID:12467141 Hprt1 Rat PhIP multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [2-amino-1-methyl-6-phenylimidazo(4 more ... CTD PMID:7728948 and PMID:8625468 Hprt1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Hprt1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Tetradecanoylphorbol Acetate] results in increased expression of HPRT1 mRNA CTD PMID:19840844 Hprt1 Rat picoxystrobin increases expression ISO HPRT1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of HPRT1 mRNA CTD PMID:33512557 Hprt1 Rat pirinixic acid increases expression ISO Hprt1 (Mus musculus) 6480464 pirinixic acid results in increased expression of HPRT1 mRNA CTD PMID:16221962 more ... Hprt1 Rat pirinixic acid multiple interactions ISO Hprt1 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of HPRT1 mRNA] CTD PMID:20059764 Hprt1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of HPRT1 mRNA CTD PMID:19483382 Hprt1 Rat potassium bromate increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 potassium bromate results in increased mutagenesis of HPRT1 gene CTD PMID:22539617 Hprt1 Rat potassium bromate increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 potassium bromate results in increased mutagenesis of HPRT1 gene CTD PMID:19853637 Hprt1 Rat potassium dichromate increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 Potassium Dichromate results in increased mutagenesis of HPRT1 gene CTD PMID:7508562 Hprt1 Rat propiconazole increases expression ISO Hprt1 (Mus musculus) 6480464 propiconazole results in increased expression of HPRT1 mRNA CTD PMID:21278054 and PMID:22334560 Hprt1 Rat pyrogallol increases expression ISO Hprt1 (Mus musculus) 6480464 Pyrogallol results in increased expression of HPRT1 mRNA CTD PMID:20362636 Hprt1 Rat rac-lactic acid decreases expression ISO HPRT1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of HPRT1 mRNA CTD PMID:30851411 Hprt1 Rat resveratrol multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of HPRT1 mRNA CTD PMID:19167446 Hprt1 Rat resveratrol decreases expression ISO HPRT1 (Homo sapiens) 6480464 resveratrol results in decreased expression of HPRT1 protein CTD PMID:23724044 Hprt1 Rat retinyl acetate increases expression ISO Hprt1 (Mus musculus) 6480464 retinol acetate results in increased expression of HPRT1 mRNA CTD PMID:16772331 Hprt1 Rat rotenone increases expression ISO HPRT1 (Homo sapiens) 6480464 Rotenone results in increased expression of HPRT1 mRNA CTD PMID:33512557 Hprt1 Rat SB 431542 multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Hprt1 Rat sodium arsenite multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [ATF4 mutant form results in increased susceptibility to sodium arsenite] which results in increased mutagenesis of HPRT1 gene and APEX1 inhibits the reaction [[ATF4 mutant form results in increased susceptibility to sodium arsenite] which results in increased mutagenesis of HPRT1 gene] CTD PMID:17938202 Hprt1 Rat sodium arsenite decreases expression ISO Hprt1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of HPRT1 mRNA CTD PMID:36209798 Hprt1 Rat sodium arsenite increases expression ISO HPRT1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HPRT1 mRNA CTD PMID:34032870 Hprt1 Rat sodium arsenite increases expression ISO Hprt1 (Mus musculus) 6480464 sodium arsenite results in increased expression of HPRT1 protein CTD PMID:29044176 Hprt1 Rat styrene multiple interactions ISO HPRT1 (Homo sapiens) 6480464 GSTP1 gene polymorphism promotes the reaction [Styrene results in increased mutagenesis of HPRT1 gene] CTD PMID:12893075 Hprt1 Rat styrene increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 Styrene results in increased mutagenesis of HPRT1 gene CTD PMID:11535253 and PMID:12893075 Hprt1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of HPRT1 mRNA CTD PMID:30047161 Hprt1 Rat tamoxifen affects expression ISO Hprt1 (Mus musculus) 6480464 Tamoxifen affects the expression of HPRT1 mRNA CTD PMID:17555576 Hprt1 Rat temozolomide increases mutagenesis ISO Hprt1 (Mus musculus) 6480464 temozolomide results in increased mutagenesis of HPRT1 gene CTD PMID:17116724 Hprt1 Rat temozolomide multiple interactions ISO Hprt1 (Mus musculus) 6480464 MGMT protein inhibits the reaction [temozolomide results in increased mutagenesis of HPRT1 gene] CTD PMID:17116724 Hprt1 Rat testosterone multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of HPRT1 mRNA CTD PMID:21592394 Hprt1 Rat testosterone decreases expression ISO HPRT1 (Homo sapiens) 6480464 Testosterone results in decreased expression of HPRT1 mRNA CTD PMID:21592394 Hprt1 Rat tetrachloromethane increases expression ISO Hprt1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HPRT1 mRNA CTD PMID:31919559 Hprt1 Rat thapsigargin decreases expression ISO HPRT1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of HPRT1 mRNA CTD PMID:22378314 Hprt1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of HPRT1 mRNA CTD PMID:19483382 Hprt1 Rat Thiotepa increases mutagenesis EXP 6480464 Thiotepa results in increased mutagenesis of HPRT1 gene CTD PMID:10069464 Hprt1 Rat tioguanine decreases response to substance ISO HPRT1 (Homo sapiens) 6480464 HPRT1 gene mutant form results in decreased susceptibility to Thioguanine CTD PMID:28446605 Hprt1 Rat titanium dioxide increases methylation ISO Hprt1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of HPRT1 gene CTD PMID:35295148 Hprt1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of HPRT1 mRNA CTD PMID:33387578 Hprt1 Rat trimellitic anhydride increases expression ISO Hprt1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of HPRT1 mRNA CTD PMID:19042947 Hprt1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of HPRT1 mRNA CTD PMID:30589522 Hprt1 Rat troglitazone decreases expression ISO HPRT1 (Homo sapiens) 6480464 troglitazone results in decreased expression of HPRT1 mRNA CTD PMID:19631733 Hprt1 Rat tungsten increases expression ISO Hprt1 (Mus musculus) 6480464 Tungsten results in increased expression of HPRT1 mRNA CTD PMID:30912803 Hprt1 Rat tunicamycin decreases expression ISO HPRT1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of HPRT1 mRNA CTD PMID:22378314 Hprt1 Rat valproic acid increases expression ISO HPRT1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HPRT1 mRNA CTD PMID:23179753 more ... Hprt1 Rat valproic acid multiple interactions ISO HPRT1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HPRT1 mRNA CTD PMID:27188386 Hprt1 Rat vanillin decreases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 vanillin results in decreased mutagenesis of HPRT1 gene CTD PMID:17178418 Hprt1 Rat vitamin E multiple interactions EXP 6480464 Vitamin E inhibits the reaction [2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased mutagenesis of HPRT1 gene] CTD PMID:12467141 Hprt1 Rat zidovudine increases mutagenesis ISO HPRT1 (Homo sapiens) 6480464 Zidovudine results in increased mutagenesis of HPRT1 exon CTD PMID:10526209
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,1,1-trichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-aminobenzotriazole (ISO) 1-Methylpyrene (ISO) 1-nitropyrene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,5-tetrachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-Amino-9H-pyrido[2,3-b]indole (ISO) 2-hydroxypropanoic acid (ISO) 2-naphthylamine (ISO) 3-Amino-1-methyl-5H-pyrido[4,3-b]indole (ISO) 3-Chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone (EXP) 3-chloropropane-1,2-diol (EXP) 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine (EXP) 3-Nitrobenzanthrone (ISO) 3-phenylprop-2-enal (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 4-hydroxynon-2-enal (ISO) 4-nitroquinoline N-oxide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) acrylonitrile (EXP,ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP,ISO) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP,ISO) azathioprine (ISO) benzbromarone (EXP) benzene (ISO) benzidine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[a]pyrene-7,8-diol (ISO) beta-carotene (EXP) biphenyl-4-amine (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) bromuconazole (EXP) buspirone (EXP) buta-1,3-diene (EXP,ISO) cadmium dichloride (ISO) caffeine (EXP) calcitriol (ISO) calyculin a (ISO) carbon nanotube (ISO) carmustine (ISO) chromium(6+) (ISO) clofibrate (EXP,ISO) clofibric acid (EXP) cobalt dichloride (ISO) coumarin (ISO) coumestrol (ISO) curcumin (ISO) cyclophosphamide (EXP,ISO) cyclosporin A (ISO) cyhalothrin (EXP) cyproconazole (ISO) D-glucose (ISO) D-mannitol (ISO) DDE (ISO) deguelin (ISO) dibutyl phthalate (ISO) dichlorine (EXP) diepoxybutane (ISO) Diisodecyl phthalate (ISO) dimethyl sulfoxide (EXP) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP) Enterolactone (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (EXP) fenthion (ISO) fipronil (EXP) folic acid (ISO) fructose (ISO) fumonisin B1 (ISO) gamma-hexachlorocyclohexane (EXP) genistein (ISO) gentamycin (EXP) glucose (ISO) gold atom (ISO) gold(0) (ISO) hexaconazole (ISO) hydrogen peroxide (ISO) hypochlorous acid (ISO) inulin (ISO) isoniazide (EXP) ivermectin (ISO) L-ascorbic acid (EXP) L-ethionine (EXP) lead diacetate (EXP,ISO) lithium atom (EXP) lithium hydride (EXP) MeIQ (EXP) MeIQx (EXP) methapyrilene (EXP) methidathion (ISO) methimazole (EXP) methotrexate (ISO) methoxychlor (EXP) microcystin-LR (ISO) N-ethyl-N-nitrosourea (EXP,ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-methyl-N-nitrosourea (EXP,ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (ISO) nefazodone (EXP) neoglucobrassicin (ISO) nickel sulfate (ISO) nimesulide (EXP) nitric oxide (ISO) okadaic acid (ISO) omeprazole (EXP) oxirane (ISO) ozone (EXP,ISO) p-toluidine (EXP) paracetamol (EXP,ISO) paraquat (ISO) pent-4-enoic acid (EXP) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) PhIP (EXP,ISO) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) pirinixic acid (EXP,ISO) potassium bromate (ISO) potassium dichromate (ISO) propiconazole (ISO) pyrogallol (ISO) rac-lactic acid (ISO) resveratrol (ISO) retinyl acetate (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) styrene (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) Thiotepa (EXP) tioguanine (ISO) titanium dioxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (EXP) troglitazone (ISO) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO) vanillin (ISO) vitamin E (EXP) zidovudine (ISO)
Biological Process
adenine metabolic process (IEA,ISO) AMP salvage (IEA,ISO) cellular response to insulin stimulus (IEP) central nervous system neuron development (IEA,ISO) cerebral cortex neuron differentiation (IEA,ISO) dendrite morphogenesis (IEA,ISO) dopamine metabolic process (IEA,ISO) dopaminergic neuron differentiation (IEA,ISO) GMP catabolic process (IEA,ISO,ISS) GMP salvage (IBA,IEA,ISO) grooming behavior (IEA,ISO) guanine salvage (IBA,IEA,ISO,ISS) hypoxanthine metabolic process (IBA,IDA,IEA,ISO) hypoxanthine salvage (IEA,ISO,ISS) IMP metabolic process (IEA,ISO,ISS) IMP salvage (IBA,IEA,ISO) locomotory behavior (IEA,ISO) lymphocyte proliferation (IEA,ISO) positive regulation of dopamine metabolic process (IEA,ISO) protein homotetramerization (IEA,ISO) purine nucleotide biosynthetic process (IEA,ISO) purine ribonucleoside salvage (IEA,ISO) response to amphetamine (IEA,ISO) spermatogenesis (IEP) striatum development (IEA,ISO) T cell mediated cytotoxicity (IEA,ISO)
1.
Activities of amidophosphoribosyltransferase (EC2.4.2.14) and the purine phosphoribosyltransferases (EC2.4.2.7 and 2.4.2.8), and the phosphoribosylpyrophosphate content of rat central nervous system at different stages of development--their possible relationship to the neurological dysfunction in the Lesch-Nyhan syndrome.
Allsop J and Watts RW, J Neurol Sci. 1980 May;46(2):221-32.
2.
Pediatric neurological syndromes and inborn errors of purine metabolism.
Camici M, etal., Neurochem Int. 2010 Feb;56(3):367-78. Epub 2009 Dec 11.
3.
DNA sequence flanking the protein coding regions of the rat Hprt gene.
Chen T, etal., Mutat Res 1998 May;382(3-4):79-80.
4.
Rat hypoxanthine phosphoribosyltransferase cDNA cloning and sequence analysis.
Chiaverotti TA, etal., Adv Exp Med Biol 1991;309B:117-20.
5.
Rat hypoxanthine phosphoribosyltransferase cDNA cloning and sequence analysis.
Chiaverotti TA, etal., Genomics 1991 Dec;11(4):1158-60.
6.
Analysis of the HPRT1 gene in 35 Italian Lesch-Nyhan families: 45 patients and 77 potential female carriers.
de Gemmis P, etal., Mutat Res. 2010 Oct 13;692(1-2):1-5. doi: 10.1016/j.mrfmmm.2010.07.003. Epub 2010 Jul 16.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
9.
The gene encoding hypoxanthine-guanine phosphoribosyltransferase as target for mutational analysis: PCR cloning and sequencing of the cDNA from the rat.
Jansen JG, etal., Mutat Res 1992 Apr;266(2):105-16.
10.
The gene encoding hypoxanthine-guanine phosphoribosyltransferase as target for mutational analysis: PCR cloning and sequencing of the cDNA from the rat.
Jansen JG, etal., Mutat Res 1992 Apr;266(2):105-16.
11.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Enzymic capacities of purine de Novo and salvage pathways for nucleotide synthesis in normal and neoplastic tissues.
Natsumeda Y, etal., Cancer Res. 1984 Jun;44(6):2475-9.
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
16.
Insulin regulatory effects on purine- and pyrimidine metabolism in alloxan diabetic rat liver.
Pillwein K, etal., Padiatr Padol. 1988;23(2):135-44.
17.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
18.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
19.
GOA pipeline
RGD automated data pipeline
20.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Stage-specific expression of genes associated with rat spermatogenesis: characterization by laser-capture microdissection and real-time polymerase chain reaction.
Sluka P, etal., Biol Reprod. 2002 Sep;67(3):820-8.
23.
Increased de novo purine synthesis by insulin through selective enzyme induction in primary cultured rat hepatocytes.
Tsuchiya M, etal., Am J Physiol. 1990 May;258(5 Pt 1):C841-8.
24.
Metabolism of hypoxanthine in isolated rat hepatocytes.
Vincent MF, etal., Biochem J. 1984 Aug 15;222(1):145-55.
25.
Hypoxanthine guanine phosphoribosyltransferase (HPRT) deficiencies: HPRT1 mutations in new Japanese families and PRPP concentration.
Yamada Y, etal., Nucleosides Nucleotides Nucleic Acids. 2014;33(4-6):218-22. doi: 10.1080/15257770.2013.865743.
Hprt1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 137,655,744 - 137,687,718 (+) NCBI GRCr8 mRatBN7.2 X 132,736,175 - 132,768,149 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 132,736,096 - 132,768,154 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 134,896,246 - 134,928,216 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 138,479,092 - 138,511,062 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 136,044,802 - 136,076,774 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 158,196,640 - 158,228,815 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 158,623,240 - 158,655,198 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 158,197,149 - 158,228,749 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 152,821,947 - 152,854,198 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 X 153,249,874 - 153,281,841 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 139,929,647 - 139,961,616 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 140,003,079 - 140,035,048 (+) NCBI Cytogenetic Map X q36 NCBI
HPRT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 134,460,165 - 134,500,668 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 134,460,165 - 134,520,513 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 133,594,195 - 133,634,698 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 133,421,923 - 133,462,362 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 133,319,776 - 133,360,216 NCBI Celera X 133,981,004 - 134,021,522 (+) NCBI Celera Cytogenetic Map X q26.2-q26.3 NCBI HuRef X 122,992,617 - 123,032,595 (+) NCBI HuRef CHM1_1 X 133,505,941 - 133,546,459 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 132,785,328 - 132,825,827 (+) NCBI T2T-CHM13v2.0
Hprt1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 52,076,955 - 52,110,537 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 52,077,014 - 52,110,536 (+) Ensembl GRCm39 Ensembl GRCm38 X 52,988,078 - 53,021,660 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 52,988,137 - 53,021,659 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 50,341,255 - 50,374,837 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 49,232,764 - 49,266,286 (+) NCBI MGSCv36 mm8 Celera X 40,414,095 - 40,447,630 (+) NCBI Celera Cytogenetic Map X A5 NCBI cM Map X 29.31 NCBI
Hprt1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955473 462,940 - 510,006 (-) NCBI ChiLan1.0 ChiLan1.0
HPRT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 133,895,335 - 133,936,164 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 133,898,929 - 133,939,766 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 123,609,248 - 123,650,102 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 133,908,233 - 133,948,197 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 133,916,681 - 133,948,197 (+) Ensembl panpan1.1 panPan2
HPRT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 105,115,732 - 105,153,702 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 105,115,732 - 105,153,702 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 91,226,153 - 91,264,410 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 106,975,655 - 107,013,438 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 106,975,628 - 107,013,469 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 104,388,675 - 104,426,954 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 106,254,668 - 106,292,939 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 106,046,035 - 106,084,329 (+) NCBI UU_Cfam_GSD_1.0
Hprt1
HPRT1
HPRT1
Hprt1
.
Predicted Target Of
Count of predictions: 115 Count of miRNA genes: 98 Interacting mature miRNAs: 104 Transcripts: ENSRNOT00000045153 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 93956491 138956491 Rat 1598856 Memor1 Memory QTL 1 1.9 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) X 103312877 148312877 Rat 1598809 Memor15 Memory QTL 15 4.4 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 103312877 148312877 Rat 738025 Stresp3 Stress response QTL 3 4.61 0.0066 stress-related behavior trait (VT:0010451) defensive burying - approach X 100567703 150256146 Rat 634346 Insul4 Insulin level QTL 4 0 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) X 126975089 152453651 Rat 738029 Stresp2 Stress response QTL 2 3.4 0.0004 stress-related behavior trait (VT:0010451) defensive burying - approach X 112934952 138400867 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 113937816 152453651 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
15
11
55
144
125
121
77
31
77
12
276
121
112
55
79
44
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000045153 ⟹ ENSRNOP00000043388
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 132,736,103 - 132,768,147 (+) Ensembl Rnor_6.0 Ensembl X 158,623,240 - 158,655,198 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000065935 ⟹ ENSRNOP00000062740
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 132,736,491 - 132,768,062 (+) Ensembl Rnor_6.0 Ensembl X 158,197,149 - 158,228,749 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103150 ⟹ ENSRNOP00000083078
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 132,745,305 - 132,768,149 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103414 ⟹ ENSRNOP00000083489
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 132,745,254 - 132,768,154 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109953 ⟹ ENSRNOP00000082017
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 132,736,096 - 132,768,149 (+) Ensembl
RefSeq Acc Id:
NM_012583 ⟹ NP_036715
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 137,655,744 - 137,687,714 (+) NCBI mRatBN7.2 X 132,736,175 - 132,768,149 (+) NCBI Rnor_6.0 X 158,196,640 - 158,228,815 (-) NCBI Rnor_5.0 X 153,249,874 - 153,281,841 (-) NCBI RGSC_v3.4 X 139,929,647 - 139,961,616 (+) RGD
Sequence:
GCGGTAGCACCTCCTCCGCCAGCTTCCTCCTCAGACCGCTTTTCCCGCGAGCCGACCGGTTCTGTCATGTCGACCCTCAGTCCCAGCGTCGTGATTAGTGATGATGAACCAGGTTATGACCTAGATTT
hide sequence
RefSeq Acc Id:
XM_039099447 ⟹ XP_038955375
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 137,655,934 - 137,687,718 (+) NCBI mRatBN7.2 X 132,736,365 - 132,768,149 (+) NCBI
RefSeq Acc Id:
NP_036715 ⟸ NM_012583
- UniProtKB:
Q4KMC5 (UniProtKB/Swiss-Prot), P70469 (UniProtKB/Swiss-Prot), Q62926 (UniProtKB/Swiss-Prot), P27605 (UniProtKB/Swiss-Prot), A6KUK4 (UniProtKB/TrEMBL), A0A8L2QNC2 (UniProtKB/TrEMBL), A6KUK3 (UniProtKB/TrEMBL)
- Sequence:
MSTLSPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGK
hide sequence
Ensembl Acc Id:
ENSRNOP00000062740 ⟸ ENSRNOT00000065935
RefSeq Acc Id:
XP_038955375 ⟸ XM_039099447
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QU26 (UniProtKB/TrEMBL), A0A8I5ZZ79 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000043388 ⟸ ENSRNOT00000045153
Ensembl Acc Id:
ENSRNOP00000083078 ⟸ ENSRNOT00000103150
Ensembl Acc Id:
ENSRNOP00000083489 ⟸ ENSRNOT00000103414
Ensembl Acc Id:
ENSRNOP00000082017 ⟸ ENSRNOT00000109953
RGD ID: 13702063 Promoter ID: EPDNEW_R12587 Type: initiation region Name: Hprt1_1 Description: hypoxanthine phosphoribosyltransferase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 158,228,839 - 158,228,899 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Hprt1
hypoxanthine phosphoribosyltransferase 1
LOC103689983
hypoxanthine-guanine phosphoribosyltransferase
Data merged from RGD:9163824
737654 PROVISIONAL
2014-08-25
LOC103689983
hypoxanthine-guanine phosphoribosyltransferase
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-09-24
Hprt1
hypoxanthine phosphoribosyltransferase 1
Hprt1
hypoxanthine guanine phosphoribosyl transferase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-15
Hprt1
hypoxanthine guanine phosphoribosyl transferase 1
Hprt
hypoxanthine guanine phosphoribosyl transferase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-06-23
Hprt
HpRt
hypoxanthine guanine phosphoribosyl transferase
Symbol updated
629549 APPROVED
2003-04-09
HpRt
hypoxanthine guanine phosphoribosyl transferase
Hprt
Symbol and Name updated
629477 APPROVED
2003-03-14
Hprt
hypoxanthine guanine phosphoribosyl transferase
Hprt1
Data merged from RGD:619901
628472 PROVISIONAL
2002-08-07
Hprt1
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Hprt
Hypoxanthine phosphoribosyl transferase
Symbol and Name status set to approved
70586 APPROVED
