Cpa1 (carboxypeptidase A1) - Rat Genome Database

Name: Cpa1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Cpa1 (carboxypeptidase A1) Rattus norvegicus

Analyze

Symbol:

Cpa1

Name:

carboxypeptidase A1

RGD ID:

2388

Description:

Enables exopeptidase activity. Involved in proteolysis involved in protein catabolic process and response to cadmium ion. Predicted to be active in extracellular space. Orthologous to human CPA1 (carboxypeptidase A1); INTERACTS WITH 17alpha-ethynylestradiol; 2,2',4,4',5,5'-hexachlorobiphenyl; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

carboxypeptidase A1 (pancreatic)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CPA1 (carboxypeptidase A1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cpa1 (carboxypeptidase A1, pancreatic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cpa1 (carboxypeptidase A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CPA1 (carboxypeptidase A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CPA1 (carboxypeptidase A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cpa1 (carboxypeptidase A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CPA1 (carboxypeptidase A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CPA1 (carboxypeptidase A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cpa1 (carboxypeptidase A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	C4orf51 (chromosome 4 open reading frame 51)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CPA1 (carboxypeptidase A1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cpa1 (carboxypeptidase A1, pancreatic)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cpa1 (carboxypeptidase A1 (pancreatic))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cpa5 (carboxypeptidase A5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG12374	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4408	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG7025	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ECM14	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T06A4.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18585	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4017	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14820	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17633	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG2915	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG18417	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA)
Drosophila melanogaster (fruit fly):	CG32379	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA)
Caenorhabditis elegans (roundworm):	Y18H1A.9	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T06A4.3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZC434.9	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	suro-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cpa1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	60,224,801 - 60,230,928 (+)	NCBI		GRCr8
mRatBN7.2	4	59,257,417 - 59,263,544 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	59,257,417 - 59,263,544 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	64,235,436 - 64,241,565 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	60,151,623 - 60,157,752 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	58,553,549 - 58,559,678 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	57,952,982 - 57,959,109 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	57,952,982 - 57,959,109 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	57,713,899 - 57,720,026 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	57,549,260 - 57,555,361 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	57,825,389 - 57,831,491 (+)	NCBI
Celera	4	54,356,336 - 54,362,463 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cadmium Poisoning (IEP)

Chronic Pancreatitis (ISO)

cystic fibrosis (ISO)

Hereditary Pancreatitis (ISO)

pancreatitis (ISS)

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP)

Aflatoxin B2 alpha (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (EXP)

carbon nanotube (ISO)

dexamethasone (EXP)

dextran sulfate (ISO)

dibutyl phthalate (EXP)

dichloroacetic acid (ISO)

ethanol (EXP)

fenvalerate (EXP)

flavonoids (EXP)

furan (EXP)

genistein (EXP,ISO)

lead diacetate (ISO)

N-nitrosodiethylamine (EXP)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

senecionine (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

tamoxifen (EXP)

testosterone (EXP)

tetrachloromethane (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

leukotriene metabolic process (ISS)

proteolysis (IBA)

proteolysis involved in protein catabolic process (IDA)

response to cadmium ion (IDA)

Cellular Component

extracellular space (IBA,ISO)

Molecular Function

exopeptidase activity (IDA)

metallocarboxypeptidase activity (IBA,ISO,ISS)

protein binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Structural characterization of the rat carboxypeptidase A1 and B genes. Comparative analysis of the rat carboxypeptidase gene family.	Clauser E, etal., J Biol Chem 1988 Nov 25;263(33):17837-45.
2.	Changes in carboxypeptidase A, dipeptidase and Na+/K+ ATPase activities in the intestine of rats orally exposed to different doses of cadmium.	Eriyamremu GE, etal., Biometals. 2005 Feb;18(1):1-6.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Rat preprocarboxypeptidase A: cDNA sequence and preliminary characterization of the gene.	Quinto C, etal., Proc Natl Acad Sci U S A 1982 Jan;79(1):31-5.
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:2920728	PMID:15682487	PMID:21572518	PMID:22178042

Genomics

Comparative Map Data

Cpa1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	60,224,801 - 60,230,928 (+)	NCBI		GRCr8
mRatBN7.2	4	59,257,417 - 59,263,544 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	59,257,417 - 59,263,544 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	64,235,436 - 64,241,565 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	60,151,623 - 60,157,752 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	58,553,549 - 58,559,678 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	57,952,982 - 57,959,109 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	57,952,982 - 57,959,109 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	57,713,899 - 57,720,026 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	57,549,260 - 57,555,361 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	57,825,389 - 57,831,491 (+)	NCBI
Celera	4	54,356,336 - 54,362,463 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

CPA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	130,380,494 - 130,388,108 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	130,380,339 - 130,388,114 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	130,020,335 - 130,027,949 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	129,807,591 - 129,815,185 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	129,614,305 - 129,621,899	NCBI
Celera	7	124,816,055 - 124,823,715 (+)	NCBI		Celera
Cytogenetic Map	7	q32.2	NCBI
HuRef	7	124,382,393 - 124,390,053 (+)	NCBI		HuRef
CHM1_1	7	129,953,707 - 129,961,367 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	131,694,217 - 131,701,830 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	129,405,674 - 129,413,334 (+)	NCBI

Cpa1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	30,639,217 - 30,645,360 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	30,639,217 - 30,645,362 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	30,639,218 - 30,645,361 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	30,639,218 - 30,645,363 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	30,589,221 - 30,595,361 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	30,589,231 - 30,595,371 (+)	NCBI		MGSCv36	mm8
Celera	6	30,649,082 - 30,655,216 (+)	NCBI		Celera
Cytogenetic Map	6	A3.3	NCBI
cM Map	6	12.52	NCBI

Cpa1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	11,011,928 - 11,017,908 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955479	11,011,928 - 11,017,908 (+)	NCBI	ChiLan1.0	ChiLan1.0

CPA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	167,198,027 - 167,208,098 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	19,208,271 - 19,218,342 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	122,335,250 - 122,353,369 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	134,862,141 - 134,871,834 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	134,861,920 - 134,871,834 (+)	Ensembl	panpan1.1		panPan2

CPA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	6,562,729 - 6,569,298 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	6,562,768 - 6,665,659 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	6,252,648 - 6,259,263 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	6,326,968 - 6,333,583 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	6,327,013 - 6,333,529 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	6,531,950 - 6,538,560 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	6,277,162 - 6,283,772 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	6,420,781 - 6,427,394 (-)	NCBI		UU_Cfam_GSD_1.0

Cpa1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	24,764,639 - 24,771,398 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936579	4,897,225 - 4,903,409 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936579	4,897,225 - 4,903,409 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CPA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	18,469,921 - 18,476,327 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	18,466,564 - 18,482,099 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	19,472,686 - 19,484,824 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CPA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	99,011,941 - 99,021,359 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	99,013,542 - 99,021,350 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	4,380,113 - 4,387,861 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cpa1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	5,912,447 - 5,918,430 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624783	5,912,419 - 5,918,446 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cpa1
21 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	41
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000014465
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	56647776	78882945	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	56647776	78882945	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	81266970	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114705	78881294	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	17946999	62946999	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	56647776	78882945	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	56647776	78882945	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	58635877	78886137	Rat

Markers in Region

RH129113

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	59,263,290 - 59,263,471 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	57,958,856 - 57,959,036	NCBI	Rnor6.0
Rnor_5.0	4	57,719,773 - 57,719,953	UniSTS	Rnor5.0
RGSC_v3.4	4	57,555,134 - 57,555,314	UniSTS	RGSC3.4
Celera	4	54,362,210 - 54,362,390	UniSTS
RH 3.4 Map	4	350.2	UniSTS
Cytogenetic Map	4	q22	UniSTS

Cpa

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	59,258,878 - 59,259,145 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	57,954,444 - 57,954,710	NCBI	Rnor6.0
Rnor_5.0	4	57,715,361 - 57,715,627	UniSTS	Rnor5.0
RGSC_v3.4	4	57,550,722 - 57,550,988	UniSTS	RGSC3.4
Celera	4	54,357,798 - 54,358,064	UniSTS
Cytogenetic Map	4	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
4	11	36	84	84	85	54	25	54	6	182	83	65	33	54	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_016998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC107243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH002148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J00713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	V01232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014465 ⟹ ENSRNOP00000014465

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	59,257,417 - 59,263,544 (+)	Ensembl
Rnor_6.0 Ensembl	4	57,952,982 - 57,959,109 (+)	Ensembl

RefSeq Acc Id:

NM_016998 ⟹ NP_058694

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,224,801 - 60,230,928 (+)	NCBI
mRatBN7.2	4	59,257,417 - 59,263,544 (+)	NCBI
Rnor_6.0	4	57,952,982 - 57,959,109 (+)	NCBI
Rnor_5.0	4	57,713,899 - 57,720,026 (+)	NCBI
RGSC_v3.4	4	57,549,260 - 57,555,361 (+)	RGD
Celera	4	54,356,336 - 54,362,463 (+)	NCBI

Sequence:

show sequence

CGTCCTTGTTTCTGACATCGTGAGCTAACAATAAGGTATCTGCGGCTGTGGGAAACCGGATGAG
TAGTCCCAGCTGGGAGACCTCAGGCGCAGCTGACCCCATGGTCAAGGGTAGAAGCCTGGCTTAT
CTCTCCACCTGCCTTGTTCCCCGATACTTTATCAGGAAGAGTGGAAAGGTGCCGCAGTTTGGAA
CTCCAGCCTCTCCCTCCCCATGGGACTTGATCCAGATGTGAGGGGAACTGTCCCCGGGGACCCC
TGTCAGCGTTTAAAAAGGCCTCAGATCTCAGTCTTGGCCTGACCTTCTCACCATGAAGAGACTA
CTGATTCTGAGTCTGCTGCTGGAAGCAGTCTGTGGCAATGAGAACTTTGTGGGACACCAGGTTC
TCCGAATCTCTGCAGCCGATGAAGCCCAGGTGCAGAAAGTGAAGGAGTTGGAGGACCTGGAGCA
CTTGCAGTTGGACTTCTGGCGGGACGCTGCCCGGGCCGGTATCCCCATTGATGTCAGAGTGCCC
TTCCCCAGCATCCAATCTGTGAAAGCATTCTTGGAATATCATGGTATTAGCTATGAGATCATGA
TTGAAGATGTGCAGTTACTGCTCGATGAGGAGAAACAGCAGATGTCTGCCTTCCAGGCCAGGGC
CTTGTCCACTGACTCTTTCAATTATGCCACCTATCATACGCTGGATGAGATCTACGAATTCATG
GACCTGCTGGTGGCTGAGCACCCACAGCTTGTGAGCAAGATCCAGATCGGCAACACCTTTGAAG
GTCGCCCCATCCATGTGCTGAAGTTCAGCACTGGAGGGACCAATCGCCCAGCAATCTGGATCGA
CACTGGCATCCATTCTAGGGAGTGGGTCACCCAGGCTAGTGGGGTCTGGTTTGCAAAGAAGATC
ACCAAAGACTATGGCCAGGACCCCACCTTCACAGCCGTTCTTGACAACATGGACATCTTCCTGG
AGATTGTCACCAACCCTGATGGTTTTGCCTACACCCACAAAACGAATCGCATGTGGCGCAAGAC
TCGATCACACACCCAGGGCTCCCTCTGTGTTGGTGTGGACCCCAACAGGAACTGGGACGCTGGC
TTTGGGATGGCCGGAGCAAGTAGCAACCCCTGCTCGGAAACTTACCGAGGCAAATTTCCCAACT
CTGAGGTGGAGGTCAAGTCCATCGTGGACTTTGTGACGAGCCATGGGAACATCAAGGCCTTCAT
CTCCATCCACAGCTATTCCCAGCTCCTGCTCTACCCCTACGGCTACACGTCGGAACCAGCCCCT
GACCAGGCAGAGCTGGATCAGCTAGCTAAGTCTGCTGTGACAGCCTTGACGTCTCTACACGGGA
CCAAGTTCAAGTATGGCAGCATCATCGATACAATCTATCAAGCCAGTGGGAGCACTATCGATTG
GACCTACAGCCAGGGCATCAAGTACTCTTTCACTTTTGAACTGAGGGACACTGGGCTTAGAGGA
TTCCTGCTGCCTGCCTCCCAGATCATCCCTACGGCGGAGGAGACATGGCTGGCCCTTTTGACCA
TCATGGACCACACAGTCAAACACCCCTACTGAAAGCAGCCCTTATCCCCCACCTCTTTCTTCTC
CTTAGTCCCAATAAAGTCTGATTGTATAAGAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_058694	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40893	(Get FASTA)	NCBI Sequence Viewer
	AAA40955	(Get FASTA)	NCBI Sequence Viewer
	CAA24542	(Get FASTA)	NCBI Sequence Viewer
	EDM15258	(Get FASTA)	NCBI Sequence Viewer
	EDM15259	(Get FASTA)	NCBI Sequence Viewer
	EDM15260	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014465.1
	ENSRNOP00055030067
	ENSRNOP00060033723
	ENSRNOP00065037868
GenBank Protein	P00731	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_058694 ⟸ NM_016998
- Peptide Label:	preproprotein
- UniProtKB:	P00731 (UniProtKB/Swiss-Prot), A6IEH1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKRLLILSLLLEAVCGNENFVGHQVLRISAADEAQVQKVKELEDLEHLQLDFWRDAARAGIPID VRVPFPSIQSVKAFLEYHGISYEIMIEDVQLLLDEEKQQMSAFQARALSTDSFNYATYHTLDEI YEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWF AKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRN WDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTS EPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDT GLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY hide sequence

Ensembl Acc Id:

ENSRNOP00000014465 ⟸ ENSRNOT00000014465

Protein Domains

Peptidase M14 Peptidase M14 carboxypeptidase A

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P00731-F1-model_v2	AlphaFold	P00731	1-419	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692940

Promoter ID:

EPDNEW_R3464

Type:

single initiation site

Name:

Cpa1_1

Description:

carboxypeptidase A1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	57,953,276 - 57,953,336	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2388	AgrOrtholog
BioCyc Gene	G2FUF-45341	BioCyc
Ensembl Genes	ENSRNOG00000010725	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055021619	UniProtKB/Swiss-Prot
	ENSRNOG00060023537	UniProtKB/Swiss-Prot
	ENSRNOG00065026752	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000014465.4	UniProtKB/Swiss-Prot
	ENSRNOT00055036980	UniProtKB/Swiss-Prot
	ENSRNOT00060040785	UniProtKB/Swiss-Prot
	ENSRNOT00065046149	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.70.340	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zn peptidases	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	CPA_M14_CPD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	M14A-like_propep	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	M14A_act_pep	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_M14	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24269	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	24269	ENTREZGENE
PANTHER	CARBOXYPEPTIDASE A1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEASE FAMILY M14 CARBOXYPEPTIDASE A,B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Peptidase_M14	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Propep_M14	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cpa1	PhenoGen
PRINTS	CRBOXYPTASEA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CARBOXYPEPT_ZN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CARBOXYPEPT_ZN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PEPTIDASE_M14	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000010725	RatGTEx
	ENSRNOG00055021619	RatGTEx
	ENSRNOG00060023537	RatGTEx
	ENSRNOG00065026752	RatGTEx
SMART	Zn_pept	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Protease propeptides/inhibitors	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zn-dependent exopeptidases	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IEH1	ENTREZGENE, UniProtKB/TrEMBL
	A6IEH2_RAT	UniProtKB/TrEMBL
	A6IEH3_RAT	UniProtKB/TrEMBL
	CBPA1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-02	Cpa1	carboxypeptidase A1	Cpa1	carboxypeptidase A1 (pancreatic)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-01-10	Cpa1	carboxypeptidase A1 (pancreatic)	Cpa1	carboxypeptidase A1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Cpa1	carboxypeptidase A1		Carboxypeptidase A1 (pancreatic)	Name updated	625702	APPROVED
2002-06-10	Cpa1	Carboxypeptidase A1 (pancreatic)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in pancreas	1298779
gene_homology	shares 78% homology with bovine carboxypeptidase A	1298779
gene_product	putative carboxypeptidase A protein	1298779

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI