Symbol:
Rps4x
Name:
ribosomal protein S4, X-linked
RGD ID:
2324318
Description:
Predicted to enable RNA binding activity. Predicted to be a structural constituent of ribosome. Involved in response to ethanol. Located in ribosome. Orthologous to human RPS4X (ribosomal protein S4 X-linked); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2-nitrofluorene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
40S ribosomal protein S4, X isoform; LOC100362640; ribosomal protein S4, X-linked X-like; small ribosomal subunit protein eS4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Rps4x-ps1
Rps4x-ps13
Rps4x-ps2
Rps4x-ps3
Rps4x-ps4
Rps4x-ps5
Rps4x-ps6
Rps4x-ps7
Rps4x-ps8
Rps4x-ps9
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 71,338,478 - 71,342,921 (-) NCBI GRCr8 mRatBN7.2 X 67,298,522 - 67,302,965 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 37,758,363 - 37,759,291 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl X 67,298,525 - 67,303,019 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 68,781,890 - 68,786,333 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 72,282,128 - 72,286,571 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 69,843,249 - 69,847,692 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 72,074,108 - 72,078,551 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 72,074,108 - 72,078,551 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 35,729,628 - 35,730,599 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 72,916,030 - 72,920,452 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 90,249,368 - 90,253,817 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 67,652,304 - 67,656,747 (-) NCBI Celera Cytogenetic Map X q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rps4x Rat (-)-epigallocatechin 3-gallate decreases expression ISO RPS4X (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of RPS4X protein CTD PMID:31195006 Rps4x Rat (1->4)-beta-D-glucan multiple interactions ISO Rps4x (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPS4X mRNA CTD PMID:36331819 Rps4x Rat 1,2-dimethylhydrazine multiple interactions ISO Rps4x (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RPS4X mRNA CTD PMID:22206623 Rps4x Rat 17beta-estradiol multiple interactions ISO RPS4X (Homo sapiens) 6480464 3 more ... CTD PMID:11179685 Rps4x Rat 17beta-estradiol decreases expression ISO Rps4x (Mus musculus) 6480464 Estradiol results in decreased expression of RPS4X mRNA CTD PMID:39298647 Rps4x Rat 17beta-estradiol increases expression ISO RPS4X (Homo sapiens) 6480464 Estradiol results in increased expression of RPS4X mRNA CTD PMID:11179685 Rps4x Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Rps4x (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Rps4x Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RPS4X (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Rps4x Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RPS4X (Homo sapiens) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [Estradiol results in increased expression of RPS4X mRNA] CTD PMID:11179685 Rps4x Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RPS4X mRNA CTD PMID:33387578 and PMID:34747641 Rps4x Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RPS4X protein CTD PMID:16548065 Rps4x Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rps4x (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RPS4X mRNA CTD PMID:21570461 Rps4x Rat 2,4,6-tribromophenol decreases expression ISO RPS4X (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Rps4x Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of RPS4X mRNA CTD PMID:21346803 Rps4x Rat 2,6-dimethoxyphenol multiple interactions ISO RPS4X (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of RPS4X protein CTD PMID:38598786 Rps4x Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of RPS4X mRNA CTD PMID:15890375 Rps4x Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RPS4X (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of RPS4X protein CTD PMID:31675489 Rps4x Rat 3,3'-diindolylmethane multiple interactions ISO RPS4X (Homo sapiens) 6480464 3 and 3'-diindolylmethane promotes the reaction [Estradiol results in increased expression of RPS4X mRNA] CTD PMID:11179685 Rps4x Rat 4,4'-sulfonyldiphenol affects expression ISO Rps4x (Mus musculus) 6480464 bisphenol S affects the expression of RPS4X mRNA CTD PMID:39298647 Rps4x Rat 4,4'-sulfonyldiphenol increases expression ISO RPS4X (Homo sapiens) 6480464 bisphenol S results in increased expression of RPS4X protein CTD PMID:34186270 Rps4x Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of RPS4X mRNA CTD PMID:15890375 Rps4x Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of RPS4X mRNA CTD PMID:24780913 Rps4x Rat actinomycin D multiple interactions ISO RPS4X (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RPS4X protein CTD PMID:38460933 Rps4x Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of RPS4X mRNA CTD PMID:15890375 Rps4x Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RPS4X mRNA CTD PMID:16483693 Rps4x Rat arsane multiple interactions ISO RPS4X (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of RPS4X mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RPS4X mRNA CTD PMID:35809665 and PMID:39836092 Rps4x Rat arsenic atom multiple interactions ISO RPS4X (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of RPS4X mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RPS4X mRNA CTD PMID:35809665 and PMID:39836092 Rps4x Rat arsenic trichloride multiple interactions ISO RPS4X (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of RPS4X mRNA CTD PMID:35809665 Rps4x Rat arsenite(3-) multiple interactions ISO RPS4X (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to RPS4X mRNA] and arsenite promotes the reaction [G3BP1 protein binds to RPS4X protein] CTD PMID:32406909 Rps4x Rat benzo[a]pyrene affects methylation ISO RPS4X (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RPS4X promoter CTD PMID:27901495 Rps4x Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Rps4x (Mus musculus) 6480464 PPARA protein inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of RPS4X mRNA] CTD PMID:19850644 Rps4x Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rps4x (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of RPS4X mRNA CTD PMID:19850644 and PMID:34319233 Rps4x Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RPS4X mRNA CTD PMID:25181051 Rps4x Rat bisphenol A decreases expression ISO RPS4X (Homo sapiens) 6480464 bisphenol A results in decreased expression of RPS4X protein CTD PMID:37567409 Rps4x Rat bisphenol A increases expression ISO RPS4X (Homo sapiens) 6480464 bisphenol A results in increased expression of RPS4X protein CTD PMID:34186270 Rps4x Rat bisphenol A multiple interactions ISO RPS4X (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of RPS4X gene CTD PMID:31601247 Rps4x Rat bisphenol A increases expression ISO Rps4x (Mus musculus) 6480464 bisphenol A results in increased expression of RPS4X mRNA CTD PMID:33221593 Rps4x Rat bisphenol A affects expression ISO RPS4X (Homo sapiens) 6480464 bisphenol A affects the expression of RPS4X mRNA CTD PMID:30903817 Rps4x Rat bisphenol AF increases expression ISO RPS4X (Homo sapiens) 6480464 bisphenol AF results in increased expression of RPS4X protein CTD PMID:34186270 Rps4x Rat Bisphenol B increases expression ISO RPS4X (Homo sapiens) 6480464 bisphenol B results in increased expression of RPS4X protein CTD PMID:34186270 Rps4x Rat bisphenol F increases expression ISO RPS4X (Homo sapiens) 6480464 bisphenol F results in increased expression of RPS4X protein CTD PMID:34186270 Rps4x Rat bleomycin A5 decreases expression ISO RPS4X (Homo sapiens) 6480464 bleomycetin results in decreased expression of RPS4X mRNA CTD PMID:21040473 Rps4x Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of RPS4X protein CTD PMID:28903499 Rps4x Rat camptothecin increases expression ISO RPS4X (Homo sapiens) 6480464 Camptothecin results in increased expression of RPS4X mRNA CTD PMID:38460933 Rps4x Rat CGP 52608 multiple interactions ISO RPS4X (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to RPS4X gene] CTD PMID:28238834 Rps4x Rat chloropicrin affects expression ISO RPS4X (Homo sapiens) 6480464 chloropicrin affects the expression of RPS4X mRNA CTD PMID:26352163 Rps4x Rat choline multiple interactions ISO Rps4x (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of RPS4X gene CTD PMID:20938992 Rps4x Rat cisplatin increases response to substance ISO RPS4X (Homo sapiens) 6480464 RPS4X protein results in increased susceptibility to Cisplatin CTD PMID:21466612 Rps4x Rat cisplatin increases expression ISO RPS4X (Homo sapiens) 6480464 Cisplatin results in increased expression of RPS4X mRNA CTD PMID:27392435 Rps4x Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of RPS4X protein CTD PMID:22023808 Rps4x Rat clofibrate decreases expression ISO Rps4x (Mus musculus) 6480464 Clofibrate results in decreased expression of RPS4X mRNA CTD PMID:17585979 Rps4x Rat crocidolite asbestos increases expression ISO RPS4X (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of RPS4X protein CTD PMID:29553831 Rps4x Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of RPS4X mRNA CTD PMID:17379624 Rps4x Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of RPS4X mRNA CTD PMID:18636392 Rps4x Rat dichlorine increases expression EXP 6480464 Chlorine results in increased expression of RPS4X mRNA CTD PMID:18636392 Rps4x Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of RPS4X mRNA CTD PMID:15890375 Rps4x Rat disodium selenite increases expression ISO RPS4X (Homo sapiens) 6480464 Sodium Selenite results in increased expression of RPS4X mRNA CTD PMID:18175754 Rps4x Rat enzyme inhibitor multiple interactions ISO RPS4X (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of RPS4X protein CTD PMID:23301498 Rps4x Rat epoxiconazole increases expression ISO Rps4x (Mus musculus) 6480464 epoxiconazole results in increased expression of RPS4X mRNA CTD PMID:35436446 Rps4x Rat folic acid multiple interactions ISO Rps4x (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Rps4x Rat fulvestrant multiple interactions ISO RPS4X (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of RPS4X gene CTD PMID:31601247 Rps4x Rat furfural multiple interactions ISO RPS4X (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of RPS4X protein CTD PMID:38598786 Rps4x Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RPS4X mRNA CTD PMID:33387578 Rps4x Rat ivermectin decreases expression ISO RPS4X (Homo sapiens) 6480464 Ivermectin results in decreased expression of RPS4X protein CTD PMID:32959892 Rps4x Rat L-methionine multiple interactions ISO Rps4x (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of RPS4X gene CTD PMID:20938992 Rps4x Rat lead(0) affects expression ISO RPS4X (Homo sapiens) 6480464 Lead affects the expression of RPS4X mRNA CTD PMID:28903495 Rps4x Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of RPS4X mRNA CTD PMID:15890375 Rps4x Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of RPS4X mRNA CTD PMID:15890375 Rps4x Rat nitrates multiple interactions ISO Rps4x (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RPS4X mRNA CTD PMID:35964746 Rps4x Rat Nutlin-3 multiple interactions ISO RPS4X (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RPS4X protein CTD PMID:38460933 Rps4x Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of RPS4X mRNA CTD PMID:18636392 Rps4x Rat paracetamol affects expression ISO Rps4x (Mus musculus) 6480464 Acetaminophen affects the expression of RPS4X mRNA CTD PMID:17562736 Rps4x Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of RPS4X mRNA CTD PMID:33387578 Rps4x Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rps4x (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPS4X mRNA CTD PMID:36331819 Rps4x Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of RPS4X mRNA CTD PMID:15890375 Rps4x Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of RPS4X mRNA CTD PMID:15890375 Rps4x Rat potassium dichromate increases expression ISO RPS4X (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of RPS4X mRNA CTD PMID:11678601 Rps4x Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of RPS4X protein CTD PMID:35544339 Rps4x Rat SB 431542 multiple interactions ISO RPS4X (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of RPS4X protein CTD PMID:37664457 Rps4x Rat sodium arsenite multiple interactions ISO RPS4X (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RPS4X mRNA CTD PMID:39836092 Rps4x Rat sodium chloride multiple interactions ISO RPS4X (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of RPS4X protein more ... CTD PMID:38598786 Rps4x Rat Soman increases expression EXP 6480464 Soman results in increased expression of RPS4X mRNA CTD PMID:19281266 Rps4x Rat sunitinib increases expression ISO RPS4X (Homo sapiens) 6480464 Sunitinib results in increased expression of RPS4X mRNA CTD PMID:31533062 Rps4x Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of RPS4X mRNA CTD PMID:33387578 Rps4x Rat titanium dioxide affects methylation ISO Rps4x (Mus musculus) 6480464 titanium dioxide affects the methylation of RPS4X promoter CTD PMID:35295148 Rps4x Rat trichloroethene decreases methylation EXP 6480464 Trichloroethylene results in decreased methylation of RPS4X gene CTD PMID:27618143 Rps4x Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of RPS4X mRNA CTD PMID:23555832
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2-nitrofluorene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,3'-diindolylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A5 (ISO) Brodifacoum (EXP) camptothecin (ISO) CGP 52608 (ISO) chloropicrin (ISO) choline (ISO) cisplatin (EXP,ISO) clofibrate (ISO) crocidolite asbestos (ISO) dibutyl phthalate (EXP) dichlorine (EXP) diethylstilbestrol (EXP) disodium selenite (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) folic acid (ISO) fulvestrant (ISO) furfural (ISO) gentamycin (EXP) ivermectin (ISO) L-methionine (ISO) lead(0) (ISO) methapyrilene (EXP) N-nitrosodimethylamine (EXP) nitrates (ISO) Nutlin-3 (ISO) ozone (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP) potassium dichromate (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) sunitinib (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) trichloroethene (EXP) vinclozolin (EXP)
Rps4x Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 71,338,478 - 71,342,921 (-) NCBI GRCr8 mRatBN7.2 X 67,298,522 - 67,302,965 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 37,758,363 - 37,759,291 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl X 67,298,525 - 67,303,019 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 68,781,890 - 68,786,333 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 72,282,128 - 72,286,571 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 69,843,249 - 69,847,692 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 72,074,108 - 72,078,551 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 72,074,108 - 72,078,551 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 35,729,628 - 35,730,599 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 72,916,030 - 72,920,452 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 90,249,368 - 90,253,817 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 67,652,304 - 67,656,747 (-) NCBI Celera Cytogenetic Map X q22 NCBI
RPS4X Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 72,272,042 - 72,277,248 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 72,255,679 - 72,277,248 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 71,491,892 - 71,497,098 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 71,409,178 - 71,413,866 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 71,275,474 - 71,280,162 NCBI Celera X 71,835,666 - 71,840,357 (-) NCBI Celera Cytogenetic Map X q13.1 NCBI HuRef X 65,247,573 - 65,252,264 (-) NCBI HuRef CHM1_1 X 71,385,460 - 71,390,151 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 70,704,936 - 70,710,145 (-) NCBI T2T-CHM13v2.0
Rps4x Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 101,228,548 - 101,232,929 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 101,228,547 - 101,233,000 (-) Ensembl GRCm39 Ensembl GRCm38 X 102,184,941 - 102,189,391 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 102,184,941 - 102,189,394 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 99,380,282 - 99,384,645 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 98,387,662 - 98,392,025 (-) NCBI MGSCv36 mm8 Celera X 89,097,025 - 89,101,322 (-) NCBI Celera Cytogenetic Map X D NCBI cM Map X 45.2 NCBI
Rps4x Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955475 11,655,813 - 11,662,391 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955475 11,656,537 - 11,661,803 (-) NCBI ChiLan1.0 ChiLan1.0
RPS4X Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 71,945,744 - 71,950,505 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 71,949,351 - 71,954,112 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 61,508,955 - 61,513,689 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 71,593,324 - 71,598,042 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 71,593,324 - 71,598,042 (-) Ensembl panpan1.1 panPan2
RPS4X Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 56,290,914 - 56,296,267 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 56,182,729 - 56,296,274 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 47,117,017 - 47,122,368 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 57,345,348 - 57,350,715 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 57,345,348 - 57,350,715 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 55,253,287 - 55,258,639 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 56,663,284 - 56,668,634 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 56,505,786 - 56,511,141 (-) NCBI UU_Cfam_GSD_1.0
Rps4x Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 45,610,931 - 45,615,597 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936762 1,364,318 - 1,367,945 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936762 1,364,238 - 1,368,858 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RPS4X Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 58,149,318 - 58,155,157 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 58,149,302 - 58,155,179 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 65,859,070 - 65,864,948 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RPS4X Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 62,093,900 - 62,098,528 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 62,093,902 - 62,097,466 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 3,946,458 - 3,951,121 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rps4x
.
Predicted Target Of
Count of predictions: 35 Count of miRNA genes: 22 Interacting mature miRNAs: 24 Transcripts: ENSRNOT00000004278, ENSRNOT00000051149 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 65612192 120568734 Rat 738035 Stresp1 Stress response QTL 1 4.96 0.000011 stress-related behavior trait (VT:0010451) defensive burying - coping X 41304447 112935181 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
G36435
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 X 71,342,670 - 71,342,823 (+) Marker Load Pipeline mRatBN7.2 X 67,302,714 - 67,302,867 (+) MAPPER mRatBN7.2 Rnor_6.0 X 72,078,301 - 72,078,453 NCBI Rnor6.0 Rnor_5.0 X 72,920,223 - 72,920,375 UniSTS Rnor5.0 RGSC_v3.4 X 90,253,567 - 90,253,719 UniSTS RGSC3.4 Celera X 67,656,497 - 67,656,649 UniSTS
GDB:194748
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 37,758,608 - 37,759,229 (+) MAPPER mRatBN7.2 Rnor_6.0 4 35,729,855 - 35,730,475 NCBI Rnor6.0 Rnor_5.0 4 35,587,475 - 35,588,095 UniSTS Rnor5.0 RGSC_v3.4 4 34,793,919 - 34,794,539 UniSTS RGSC3.4 Celera 4 33,242,496 - 33,243,116 UniSTS Cytogenetic Map X q31 UniSTS
GDB:194747
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 67,301,536 - 67,301,970 (+) MAPPER mRatBN7.2 mRatBN7.2 4 37,759,098 - 37,759,229 (+) MAPPER mRatBN7.2 Rnor_6.0 4 35,730,345 - 35,730,475 NCBI Rnor6.0 Rnor_6.0 X 72,077,123 - 72,077,556 NCBI Rnor6.0 Rnor_5.0 4 35,587,965 - 35,588,095 UniSTS Rnor5.0 Rnor_5.0 X 72,919,045 - 72,919,478 UniSTS Rnor5.0 RGSC_v3.4 X 90,252,389 - 90,252,822 UniSTS RGSC3.4 RGSC_v3.4 4 34,794,409 - 34,794,539 UniSTS RGSC3.4 Celera 4 33,242,986 - 33,243,116 UniSTS Celera X 67,655,319 - 67,655,752 UniSTS Cytogenetic Map X q31 UniSTS
G36434
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 67,302,794 - 67,302,914 (+) MAPPER mRatBN7.2 Rnor_6.0 X 72,078,381 - 72,078,500 NCBI Rnor6.0 Rnor_5.0 X 72,920,303 - 72,920,422 UniSTS Rnor5.0 RGSC_v3.4 X 90,253,647 - 90,253,766 UniSTS RGSC3.4 Celera X 67,656,577 - 67,656,696 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
18
22
97
225
182
180
118
50
118
12
435
193
185
90
118
62
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004278 ⟹ ENSRNOP00000004278
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 67,298,525 - 67,302,922 (-) Ensembl Rnor_6.0 Ensembl X 72,074,202 - 72,077,590 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000051149 ⟹ ENSRNOP00000043988
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 37,758,363 - 37,759,291 (-) Ensembl Rnor_6.0 Ensembl 4 35,729,628 - 35,730,599 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076090
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 72,075,740 - 72,078,495 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076978 ⟹ ENSRNOP00000067969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 67,298,525 - 67,303,019 (-) Ensembl Rnor_6.0 Ensembl X 72,074,108 - 72,078,551 (-) Ensembl
RefSeq Acc Id:
NM_001007600 ⟹ NP_001007601
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 71,338,478 - 71,342,921 (-) NCBI mRatBN7.2 X 67,298,522 - 67,302,965 (-) NCBI Rnor_6.0 X 72,074,108 - 72,078,551 (-) NCBI Celera X 67,652,304 - 67,656,747 (-) NCBI
Sequence:
CTCCGACCCTAATTTCTTCGTTCGCCGGAAGAAGGCGAGTCTCTTTCCGTTCCCAGCGCAGCCATGGCTCGTGGTCCCAAGAAACATCTGAAGCGCGTAGCGGCTCCAAAACACTGGATGCTGGATAA
hide sequence
RefSeq Acc Id:
NP_001007601 ⟸ NM_001007600
- UniProtKB:
P62703 (UniProtKB/Swiss-Prot), A6IQE4 (UniProtKB/TrEMBL), A0A8L2QYQ1 (UniProtKB/TrEMBL)
- Sequence:
MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRK
hide sequence
Ensembl Acc Id:
ENSRNOP00000004278 ⟸ ENSRNOT00000004278
Ensembl Acc Id:
ENSRNOP00000043988 ⟸ ENSRNOT00000051149
Ensembl Acc Id:
ENSRNOP00000067969 ⟸ ENSRNOT00000076978
RGD ID: 13701886 Promoter ID: EPDNEW_R12407 Type: multiple initiation site Name: Rps4x_2 Description: ribosomal protein S4, X-linked SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R3402 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 72,078,511 - 72,078,571 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-04-08
Rps4x
ribosomal protein S4, X-linked
LOC100362640
ribosomal protein S4, X-linked X-like
Name and Symbol changed
629549 APPROVED
2010-05-06
LOC100362640
ribosomal protein S4, X-linked X-like
Symbol and Name status set to provisional
70820 PROVISIONAL
