Symbol:
Tiam2
Name:
TIAM Rac1 associated GEF 2
RGD ID:
2324148
Description:
Predicted to enable GTPase activator activity and guanyl-nucleotide exchange factor activity. Predicted to be involved in positive regulation of axonogenesis and small GTPase-mediated signal transduction. Predicted to be located in cytoplasm. Predicted to be active in membrane and synapse. Orthologous to human TIAM2 (TIAM Rac1 associated GEF 2); INTERACTS WITH 4,4'-sulfonyldiphenol; bisphenol A; bisphenol F.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC100362710; rho guanine nucleotide exchange factor TIAM2; T-cell lymphoma invasion and metastasis 2; T-lymphoma invasion and metastasis-inducing protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 46,323,450 - 46,524,769 (+) NCBI GRCr8 mRatBN7.2 1 43,918,179 - 44,119,499 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 43,918,174 - 44,119,493 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 1 44,232,520 - 44,433,450 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 44,311,513 - 44,433,193 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 45,562,714 - 45,763,294 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 38,479,385 - 38,514,359 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 39,555,701 - 39,754,110 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Tiam2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 46,323,450 - 46,524,769 (+) NCBI GRCr8 mRatBN7.2 1 43,918,179 - 44,119,499 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 43,918,174 - 44,119,493 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 1 44,232,520 - 44,433,450 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 44,311,513 - 44,433,193 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 45,562,714 - 45,763,294 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 38,479,385 - 38,514,359 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 39,555,701 - 39,754,110 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
TIAM2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 154,995,315 - 155,257,723 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 154,832,697 - 155,257,723 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 155,316,449 - 155,578,857 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 155,453,115 - 155,620,549 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 155,540,736 - 155,670,437 NCBI Celera 6 156,145,600 - 156,313,154 (+) NCBI Celera Cytogenetic Map 6 q25.2-q25.3 NCBI HuRef 6 152,973,625 - 153,141,133 (+) NCBI HuRef CHM1_1 6 155,674,081 - 155,841,472 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 156,197,278 - 156,459,744 (+) NCBI T2T-CHM13v2.0
Tiam2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 3,376,675 - 3,569,672 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 3,376,848 - 3,581,619 (+) Ensembl GRCm39 Ensembl GRCm38 17 3,326,313 - 3,519,397 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 3,326,573 - 3,531,344 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 3,326,573 - 3,519,397 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 3,353,689 - 3,475,879 (+) NCBI MGSCv36 mm8 Celera 17 3,867,789 - 4,054,192 (+) NCBI Celera Cytogenetic Map 17 A1 NCBI cM Map 17 1.99 NCBI
Tiam2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955439 6,939,563 - 7,067,507 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955439 6,942,702 - 7,147,145 (-) NCBI ChiLan1.0 ChiLan1.0
TIAM2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 175,016,172 - 175,281,087 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 172,907,831 - 173,172,685 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 152,809,716 - 153,074,427 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 158,774,096 - 159,038,777 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 158,902,783 - 159,038,777 (+) Ensembl panpan1.1 panPan2
TIAM2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 44,897,699 - 45,001,094 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 44,870,103 - 45,002,684 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 45,707,011 - 45,838,149 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 45,062,854 - 45,184,503 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 45,053,768 - 45,184,501 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 44,920,794 - 45,051,675 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 44,792,357 - 44,923,421 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 45,357,659 - 45,479,661 (+) NCBI UU_Cfam_GSD_1.0
Tiam2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 140,110,602 - 140,212,560 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 7,362,598 - 7,465,076 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 7,336,078 - 7,464,553 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TIAM2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 11,648,508 - 11,759,348 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 11,648,506 - 11,897,869 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 13,622,596 - 13,664,877 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TIAM2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 82,537,021 - 82,823,525 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 82,688,773 - 82,822,949 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 54,926,150 - 55,198,751 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tiam2
.
Predicted Target Of
Count of predictions: 54 Count of miRNA genes: 50 Interacting mature miRNAs: 52 Transcripts: ENSRNOT00000065386 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1357397 Bw41 Body weight QTL 41 4.19 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 7421626 Bp360 Blood pressure QTL 360 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 4393289 49393289 Rat 1357400 Bw62 Body weight QTL62 4.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 1 22340647 67340647 Rat 1357401 Bw43 Body weight QTL 43 3.75 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 631494 Bp95 Blood pressure QTL 95 40 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 16206210 49268520 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 5684998 Bss101 Bone structure and strength QTL 101 3.6 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 1 15431621 49361612 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 5684999 Bss102 Bone structure and strength QTL 102 5.5 7e-07 tibia strength trait (VT:1000284) tibia stiffness (CMO:0001735) 1 15431621 49361612 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1578756 Iddm22 Insulin dependent diabetes mellitus QTL 22 2.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 11835181 56835181 Rat 631508 Sald1 Serum aldosterone level QTL 1 3.7 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 1 9856001 54856001 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 724520 Bp145 Blood pressure QTL 145 2.1 0.0024 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 20784828 65784828 Rat 1558642 Prcr2 Prostate cancer resistance QTL 2 4.3 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 1 20763158 44095856 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 2302038 Pia31 Pristane induced arthritis QTL 31 5.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 1 10992065 55992065 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 634353 Rends2 Renal damage susceptibility QTL 2 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 1 19333571 56983283 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
D15Rat45
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 44,095,638 - 44,095,856 (+) MAPPER mRatBN7.2 Rnor_6.0 1 44,409,585 - 44,409,802 NCBI Rnor6.0 Rnor_5.0 1 45,739,429 - 45,739,646 UniSTS Rnor5.0 RGSC_v3.4 1 38,490,284 - 38,490,502 RGD RGSC3.4 RGSC_v3.4 1 38,490,285 - 38,490,502 UniSTS RGSC3.4 RGSC_v3.1 1 38,493,229 - 38,493,447 RGD Celera 1 39,730,228 - 39,730,445 UniSTS FHH x ACI Map 15 19.6699 UniSTS FHH x ACI Map 15 19.6699 RGD
BE118732
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 44,097,687 - 44,097,847 (+) MAPPER mRatBN7.2 Rnor_6.0 1 44,411,639 - 44,411,798 NCBI Rnor6.0 Rnor_5.0 1 45,741,483 - 45,741,642 UniSTS Rnor5.0 RGSC_v3.4 1 38,492,232 - 38,492,391 UniSTS RGSC3.4 Celera 1 39,732,277 - 39,732,436 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
89
88
57
25
57
6
216
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000065386 ⟹ ENSRNOP00000060330
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 43,918,174 - 44,119,493 (+) Ensembl Rnor_6.0 Ensembl 1 44,311,513 - 44,433,193 (+) Ensembl
RefSeq Acc Id:
NM_001427473 ⟹ NP_001414402
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 46,400,865 - 46,524,769 (+) NCBI
RefSeq Acc Id:
NM_001427474 ⟹ NP_001414403
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 46,323,456 - 46,524,769 (+) NCBI
RefSeq Acc Id:
XM_006227904 ⟹ XP_006227966
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 46,489,773 - 46,524,769 (+) NCBI mRatBN7.2 1 44,084,514 - 44,119,499 (+) NCBI Rnor_6.0 1 44,398,406 - 44,433,450 (+) NCBI Rnor_5.0 1 45,562,714 - 45,763,294 (+) NCBI
Sequence:
GACCTCAAGGTGTGTTAAGCGGTTTCCCCACAGACAAGCCACTCGAGTACTGGAGACTGTCAGTGGACATATGGTACTTAGCGAATCTGTTGTCCCTGCATCTGCTGTAACCTCCTGGTGCCTCTTCA
hide sequence
RefSeq Acc Id:
XM_039099650 ⟹ XP_038955578
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 46,323,450 - 46,524,769 (+) NCBI mRatBN7.2 1 43,918,179 - 44,119,499 (+) NCBI
RefSeq Acc Id:
XM_063282703 ⟹ XP_063138773
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 46,416,018 - 46,524,769 (+) NCBI
RefSeq Acc Id:
XP_006227966 ⟸ XM_006227904
- Peptide Label:
isoform X3
- Sequence:
MYRRSAEQIVELCRGTTSMEAPTDSRDPPPRPLARHLSDADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFSVLETPSQFRKLLF
hide sequence
Ensembl Acc Id:
ENSRNOP00000060330 ⟸ ENSRNOT00000065386
RefSeq Acc Id:
XP_038955578 ⟸ XM_039099650
- Peptide Label:
isoform X2
RefSeq Acc Id:
NP_001414403 ⟸ NM_001427474
- UniProtKB:
D3ZMS5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001414402 ⟸ NM_001427473
- UniProtKB:
D3ZMS5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138773 ⟸ XM_063282703
- Peptide Label:
isoform X1
- UniProtKB:
D3ZMS5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-09-13
Tiam2
TIAM Rac1 associated GEF 2
Tiam2
T-cell lymphoma invasion and metastasis 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-08-30
Tiam2
T-cell lymphoma invasion and metastasis 2
LOC100362710
T-cell lymphoma invasion and metastasis 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-06
LOC100362710
T-cell lymphoma invasion and metastasis 2
Symbol and Name status set to provisional
70820 PROVISIONAL
