Actc1 (actin, alpha, cardiac muscle 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Actc1 (actin, alpha, cardiac muscle 1) Rattus norvegicus

Analyze

Symbol:

Actc1

Name:

actin, alpha, cardiac muscle 1

RGD ID:

2026

Description:

Predicted to enable ATP binding activity; microfilament motor activity; and myosin binding activity. Involved in cardiac muscle contraction; response to ethanol; and response to xenobiotic stimulus. Predicted to be located in several cellular components, including I band; filopodium; and lamellipodium. Predicted to be active in actin filament; glutamatergic synapse; and sarcomere. Biomarker of hypertension. Human ortholog(s) of this gene implicated in atrial heart septal defect 5; dilated cardiomyopathy; dilated cardiomyopathy 1R; and hypertrophic cardiomyopathy 11. Orthologous to human ACTC1 (actin alpha cardiac muscle 1); PARTICIPATES IN dilated cardiomyopathy pathway; hypertrophic cardiomyopathy pathway; INTERACTS WITH 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

actin alpha cardiac; actin alpha cardiac 1; actin, alpha cardiac muscle 1; actin, alpha, cardiac; actin, alpha, cardiac 1; alpha-actin cardiac; alpha-cardiac actin; MGC156490

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACTC1 (actin alpha cardiac muscle 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	Actc1 (actin, alpha, cardiac muscle 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Actc1 (actin alpha cardiac muscle 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100987752 (actin alpha cardiac muscle 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACTC1 (actin alpha cardiac muscle 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Actc1 (actin alpha cardiac muscle 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACTC1 (actin alpha cardiac muscle 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACTC1 (actin alpha cardiac muscle 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Actc1 (actin alpha cardiac muscle 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ACTC1 (actin alpha cardiac muscle 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Actc1 (actin, alpha, cardiac muscle 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:86709	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ACT1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	actc1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	100,811,987 - 100,817,523 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	100,811,987 - 100,817,523 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	104,444,093 - 104,449,627 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	113,043,134 - 113,048,668 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	110,726,488 - 110,732,015 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	105,507,403 - 105,512,939 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	105,507,403 - 105,512,939 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	112,080,853 - 112,086,389 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	99,901,022 - 99,906,558 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	99,797,449 - 99,798,402 (-)	NCBI
Celera	3	99,781,510 - 99,787,044 (-)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

atrial heart septal defect (ISO)

atrial heart septal defect 5 (ISO)

Bloom syndrome (ISO)

cardiomyopathy (ISO)

colorectal cancer (ISO)

dilated cardiomyopathy (ISO)

dilated cardiomyopathy 1A (ISO)

dilated cardiomyopathy 1R (ISO)

Dilated Cardiomyopathy with Left Ventricular Noncompaction (ISO)

Endotoxemia (IEP)

familial hypertrophic cardiomyopathy (ISO)

genetic disease (ISO)

hypertension (IEP)

hypertrophic cardiomyopathy (ISO)

hypertrophic cardiomyopathy 1 (ISO)

hypertrophic cardiomyopathy 11 (ISO)

pre-malignant neoplasm (ISO)

refractive error (ISO)

restrictive cardiomyopathy (ISO)

Stomach Neoplasms (ISO)

Wolff-Parkinson-White syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acetic acid (ISO)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cantharidin (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

carmustine (ISO)

choline (ISO)

clofibrate (ISO)

cobalt atom (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cytarabine (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

diethyl malate (ISO)

dimethyl sulfoxide (ISO)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

enzyme inhibitor (ISO)

estriol (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

graphite (EXP)

hyaluronic acid (EXP)

hydrogen peroxide (EXP)

L-methionine (ISO)

methamphetamine (ISO)

methylmercury chloride (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nickel subsulfide (EXP)

nickel sulfate (ISO)

nitrofen (EXP)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

paraquat (EXP)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP)

pioglitazone (ISO)

pirinixic acid (ISO)

progesterone (ISO)

propiconazole (ISO)

quercetin (EXP)

SB 431542 (ISO)

silicon dioxide (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sodium nitrate (ISO)

streptozocin (EXP)

succimer (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

titanium dioxide (ISO)

toluene (ISO)

trichloroethene (ISO)

trichostatin A (ISO)

triclosan (ISO)

urethane (ISO)

valproic acid (ISO)

zinc atom (EXP)

zinc sulfate (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament organization (IBA)

actin filament-based movement (ISO)

actin-mediated cell contraction (ISO)

actin-myosin filament sliding (IBA,ISO)

actomyosin structure organization (ISO)

cardiac muscle contraction (IDA)

cardiac muscle tissue morphogenesis (ISO)

cardiac myofibril assembly (ISO)

glomerular mesangial cell development (IEA)

heart contraction (IBA,ISO)

mesenchyme migration (ISS)

negative regulation of apoptotic process (ISO)

positive regulation of gene expression (ISS)

regulation of blood pressure (IEA)

response to ethanol (IEP)

response to virus (IEA)

response to xenobiotic stimulus (IEP)

skeletal muscle thin filament assembly (ISO)

vascular associated smooth muscle contraction (IEA)

Cellular Component

actin cytoskeleton (IEA)

actin filament (IBA,ISO)

cell body (ISS)

cytoplasm (ISO,ISS)

filopodium (ISS)

glutamatergic synapse (ISO)

I band (ISO)

lamellipodium (ISS)

motile cilium (IEA)

protein-containing complex (IEA)

sarcomere (IBA,ISO)

smooth muscle contractile fiber (IEA)

synapse (ISO)

Molecular Function

ATP binding (ISO)

hydrolase activity (IEA)

microfilament motor activity (ISO)

myosin binding (IBA,ISO)

protein binding (IPI,ISO)

protein kinase binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

dilated cardiomyopathy pathway (IEA)

hypertrophic cardiomyopathy pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	[Analysis of written enunciations of a patient as the basis for diagnosing schizophrenia]	Falicki Z, etal., Pol Tyg Lek 1978 Aug 7;33(32):1259-60.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Current estimates from the Health Interview Survey: United States--1977.	Howie LJ and Drury TF, Vital Health Stat 10 1978 Sep;(126):1-98.
4.	Expression of the genes coding for the skeletal muscle and cardiac actions in the heart.	Mayer Y, etal., Nucleic Acids Res 1984 Jan 25;12(2):1087-100.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	alpha-cardiac actin (ACTC) binds to the band 3 (AE1) cardiac isoform.	Moura Lima PR, etal., J Cell Biochem. 2003 Aug 15;89(6):1215-21.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Actin mutations in dilated cardiomyopathy, a heritable form of heart failure.	Olson TM, etal., Science. 1998 May 1;280(5364):750-2.
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	Endotoxin and cytokines alter contractile protein expression in cardiac myocytes in vivo.	Patten M, etal., Pflugers Arch. 2001 Sep;442(6):920-7.
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	Medium perfusion enables engineering of compact and contractile cardiac tissue.	Radisic M, etal., Am J Physiol Heart Circ Physiol. 2004 Feb;286(2):H507-16. Epub 2003 Oct 9.
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Comprehensive gene review and curation	RGD comprehensive gene curation
17.	Age-related changes of cardiac gene expression following myocardial ischemia/reperfusion.	Simkhovich BZ, etal., Arch Biochem Biophys. 2003 Dec 15;420(2):268-78.
18.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
19.	Long-term alcohol administration inhibits synthesis of both myofibrillar and sarcoplasmic proteins in heart.	Vary TC and Deiter G, Metabolism. 2005 Feb;54(2):212-9.
20.	Nifedipine represses ion channels, transporters and Ca(2+)-binding proteins in hearts of spontaneously hypertensive rats.	Zwadlo C and Borlak J, Toxicol Appl Pharmacol. 2006 Jun 15;213(3):224-34. Epub 2005 Dec 15.

Additional References at PubMed

PMID:8889548	PMID:9114002	PMID:12477932	PMID:12947022	PMID:14605248	PMID:15491989	PMID:16288873	PMID:16481394	PMID:16611632	PMID:16854843	PMID:17611253	PMID:17765196
PMID:17947298	PMID:19182904	PMID:19666135	PMID:19799913	PMID:19946888	PMID:20962418	PMID:21362503	PMID:21423176	PMID:22364878	PMID:22516433	PMID:22664934	PMID:22750946
PMID:23533145	PMID:23580065	PMID:24413018	PMID:29476059	PMID:30361391

Genomics

Comparative Map Data

Actc1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	100,811,987 - 100,817,523 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	100,811,987 - 100,817,523 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	104,444,093 - 104,449,627 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	113,043,134 - 113,048,668 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	110,726,488 - 110,732,015 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	105,507,403 - 105,512,939 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	105,507,403 - 105,512,939 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	112,080,853 - 112,086,389 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	99,901,022 - 99,906,558 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	99,797,449 - 99,798,402 (-)	NCBI
Celera	3	99,781,510 - 99,787,044 (-)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

ACTC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	34,790,230 - 34,795,549 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	34,790,107 - 34,795,589 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	35,082,431 - 35,087,750 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	32,867,589 - 32,875,219 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	32,869,723 - 32,875,153	NCBI
Celera	15	11,839,644 - 11,847,274 (-)	NCBI		Celera
Cytogenetic Map	15	q14	ENTREZGENE
HuRef	15	11,925,790 - 11,933,402 (-)	NCBI		HuRef
CHM1_1	15	35,198,283 - 35,205,917 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	32,595,427 - 32,600,746 (-)	NCBI		T2T-CHM13v2.0

Actc1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	113,877,763 - 113,883,356 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	113,877,763 - 113,884,029 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	114,047,282 - 114,052,875 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	114,047,282 - 114,053,548 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	113,873,025 - 113,878,547 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	113,738,730 - 113,744,252 (-)	NCBI		MGSCv36	mm8
Celera	2	115,178,495 - 115,181,826 (-)	NCBI		Celera
Cytogenetic Map	2	E4	NCBI
cM Map	2	57.55	NCBI

Actc1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	2,137,101 - 2,145,416 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	2,139,541 - 2,144,678 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100987752
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	15	28,151,250 - 28,162,184 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	13,707,475 - 13,712,905 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	31,966,278 - 31,971,782 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	31,966,278 - 31,971,782 (-)	Ensembl	panpan1.1		panPan2

ACTC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	2,514,825 - 2,519,398 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	2,514,824 - 2,519,382 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	2,565,508 - 2,570,605 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	2,629,472 - 2,634,566 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	2,629,472 - 2,634,456 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	2,564,616 - 2,569,707 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	2,663,927 - 2,669,017 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	2,792,736 - 2,797,835 (-)	NCBI		UU_Cfam_GSD_1.0

Actc1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	81,053,582 - 81,059,040 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936673	1,092,717 - 1,100,331 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936673	1,092,700 - 1,098,256 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACTC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	136,281,167 - 136,286,547 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	136,281,119 - 136,286,551 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	152,412,178 - 152,417,610 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACTC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	48,105,271 - 48,110,670 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	48,105,216 - 48,110,896 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	92,799,132 - 92,804,294 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Actc1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624804	2,005,997 - 2,011,023 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624804	2,006,439 - 2,011,809 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Actc1
20 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	119
Count of miRNA genes:	95
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000011773
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1582252	Sual1	Serum uric acid level QTL 1	3.4	0.0123	blood uric acid amount (VT:0010302)	blood uric acid level (CMO:0000501)	3	96127817	102200699	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat

Markers in Region

BG373920

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	100,811,733 - 100,811,903 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	105,507,150 - 105,507,319	NCBI	Rnor6.0
Rnor_5.0	3	112,080,600 - 112,080,769	UniSTS	Rnor5.0
RGSC_v3.4	3	99,900,769 - 99,900,938	UniSTS	RGSC3.4
Celera	3	99,781,257 - 99,781,426	UniSTS
RH 3.4 Map	3	815.2	UniSTS
Cytogenetic Map	3	q35	UniSTS

LOC345651

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	11,664,470 - 11,665,066 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	13,717,202 - 13,717,797	NCBI	Rnor6.0
Rnor_5.0	12	15,747,215 - 15,747,810	UniSTS	Rnor5.0
RGSC_v3.4	12	12,048,429 - 12,049,024	UniSTS	RGSC3.4
Celera	12	13,453,802 - 13,454,397	UniSTS
Cytogenetic Map	12	p11	UniSTS
Cytogenetic Map	19	q12	UniSTS
Cytogenetic Map	3	q35	UniSTS

STS_ADH2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	100,812,851 - 100,813,988 (+)	MAPPER	mRatBN7.2
mRatBN7.2	4	37,621,193 - 37,621,465 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	35,593,637 - 35,593,908	NCBI	Rnor6.0
Rnor_6.0	3	105,508,268 - 105,509,404	NCBI	Rnor6.0
Rnor_5.0	4	35,451,038 - 35,451,309	UniSTS	Rnor5.0
Rnor_5.0	3	112,081,718 - 112,082,854	UniSTS	Rnor5.0
RGSC_v3.4	3	99,901,887 - 99,903,023	UniSTS	RGSC3.4
RGSC_v3.4	4	34,652,200 - 34,652,471	UniSTS	RGSC3.4
Celera	4	33,105,107 - 33,105,378	UniSTS
Celera	3	99,782,375 - 99,783,511	UniSTS
Cytogenetic Map	3	q35	UniSTS
Cytogenetic Map	4	q21	UniSTS
Cytogenetic Map	4	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		43
Medium			13	9	4	9	8	11		6	16	11	8
Low	2		27	15	14	15			27	18	18
Below cutoff			3	3		3			37	11	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC109739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI603593	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI706373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF109672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK356511	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000011773 ⟹ ENSRNOP00000011773

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	100,811,987 - 100,817,523 (-)	Ensembl
Rnor_6.0 Ensembl	3	105,507,403 - 105,512,939 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000116592 ⟹ ENSRNOP00000082679

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	100,811,987 - 100,817,523 (-)	Ensembl

RefSeq Acc Id:

NM_019183 ⟹ NP_062056

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	100,811,987 - 100,817,523 (-)	NCBI
Rnor_6.0	3	105,507,403 - 105,512,939 (-)	NCBI
Rnor_5.0	3	112,080,853 - 112,086,389 (-)	NCBI
RGSC_v3.4	3	99,901,022 - 99,906,558 (-)	RGD
Celera	3	99,781,510 - 99,787,044 (-)	RGD

Sequence:

show sequence

GACCAAATAAGGCAAGGTGGCAGCTCAGGGGCCCTCCACCCCTGCCCCCGGCTGCTCCAACTGA
CCCCGTCCATCAGCGCGCTATAAAGCCGCGCTCCAGGCGACTGTCACCTAGTGCCTGCCACCAG
CGCCAGCCCAGCTGAACCCAGCCGCCCAAAGCACGCCTACAGATCCCACAGAAGCTGTACCAGG
ATGTGTGACGACGAGGAGACCACAGCTTTGGTGTGCGACAATGGCTCCGGACTGGTGAAGGCTG
GCTTTGCGGGTGATGATGCTCCCAGAGCTGTCTTCCCATCCATCGTGGGTCGCCCACGCCACCA
GGGTGTCATGGTAGGTATGGGGCAGAAAGACTCCTATGTAGGTGACGAGGCTCAGAGCAAGCGA
GGCATCCTGACTCTGAAGTACCCCATAGAGCACGGCATTATCACCAACTGGGACGACATGGAGA
AGATCTGGCACCACACCTTCTACAATGAGCTCCGTGTGGCCCCTGAGGAGCACCCGACCCTGCT
CACTGAGGCCCCACTGAACCCCAAGGCCAACCGTGAGAAGATGACACAGATCATGTTTGAGACC
TTCAATGTGCCTGCCATGTATGTGGCCATCCAGGCGGTGCTGTCCCTGTACGCTTCTGGGAGAA
CCACAGGCATTGTTCTGGATTCTGGCGACGGTGTGACTCATAACGTCCCCATCTATGAGGGTTA
TGCCTTACCCCATGCCATCATGCGTCTGGATCTAGCTGGTCGGGACCTCACTGACTACCTTATG
AAGATCCTCACTGAGCGCGGGTACTCCTTTGTCACCACCGCTGAACGTGAAATTGTCCGAGACA
TCAAAGAAAAACTGTGTTATGTCGCCCTGGATTTTGAGAATGAGATGGCCACCGCTGCATCTTC
CTCCTCTCTGGAGAAGAGCTACGAACTTCCCGATGGCCAGGTCATCACCATTGGCAACGAGCGT
TTCCGCTGTCCTGAGACTCTCTTCCAGCCCTCTTTCATTGGTATGGAGTCTGCCGGCATTCACG
AAACTACTTATAACAGCATCATGAAGTGTGACATCGATATCCGCAAAGACCTGTACGCCAACAA
TGTCCTGTCTGGAGGCACCACCATGTACCCTGGGATTGCTGATCGTATGCAAAAGGAAATAACT
GCACTGGCTCCCAGCACCATGAAGATTAAGATTATTGCTCCCCCTGAGCGTAAATACTCTGTCT
GGATTGGGGGCTCCATCCTGGCCTCTCTGTCTACCTTCCAACAAATGTGGATCAGCAAGCAAGA
GTACGATGAGGCCGGGCCCTCCATTGTCCACCGCAAGTGCTTCTGAGGCGGCTACCTTACACTC
AGGACGACAGTATTGTGCTTGGAATCCTCTGAGGCCCTCTCCCATCTCCCATCAGTCATTGTAC
AGTTTGTTTACACACGTGCAGTTTGTTTGTGCTTCAAATATTTATTGCTTTATAAATAAACCAG
ACCAGGACTTGCAACCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_062056	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI27452	(Get FASTA)	NCBI Sequence Viewer
	EDL79827	(Get FASTA)	NCBI Sequence Viewer
	P68035	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062056 ⟸ NM_019183

- UniProtKB:

A0JPJ4 (UniProtKB/Swiss-Prot), P68035 (UniProtKB/Swiss-Prot), A6HP76 (UniProtKB/TrEMBL), A0A0G2K4M6 (UniProtKB/TrEMBL), A0A8I5ZVP6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR
GILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET
FNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLM
KILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNER
FRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEIT
ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

hide sequence

RefSeq Acc Id:

ENSRNOP00000011773 ⟸ ENSRNOT00000011773

RefSeq Acc Id:

ENSRNOP00000082679 ⟸ ENSRNOT00000116592

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P68035-F1-model_v2	AlphaFold	P68035	1-377	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2026	AgrOrtholog
BioCyc Gene	G2FUF-48347	BioCyc
Ensembl Genes	ENSRNOG00000008536	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00000058039	UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000011773	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000073101	UniProtKB/TrEMBL
	ENSRNOP00000082679.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011773	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000083468	UniProtKB/TrEMBL
	ENSRNOT00000116592.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.420.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7379877	IMAGE-MGC_LOAD
InterPro	Actin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Actin/actin-like_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Actin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_NBD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29275	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156490	IMAGE-MGC_LOAD
NCBI Gene	29275	ENTREZGENE
PANTHER	ACTIN, ALPHA CARDIAC MUSCLE 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ACTIN, AORTIC SMOOTH MUSCLE	UniProtKB/TrEMBL
	PTHR11937	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Actin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Actc1	PhenoGen
PRINTS	ACTIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ACTINS_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ACTINS_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ACTINS_ACT_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	ACTIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF53067	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC204129
UniProt	A0A0G2K4M6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZVP6	ENTREZGENE, UniProtKB/TrEMBL
	A0JPJ4	ENTREZGENE
	A6HP76	ENTREZGENE, UniProtKB/TrEMBL
	ACTC_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A0JPJ4	UniProtKB/Swiss-Prot
	P04270	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-05-15	Actc1	actin, alpha, cardiac muscle 1	Actc1	actin, alpha, cardiac 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-12	Actc1	actin, alpha, cardiac 1	Actc1	actin alpha cardiac 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Actc1	actin alpha cardiac 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in cardiac muscle	69737
gene_homology	gene has high similarity to the skeletal muscle actin Acta1 except for high divergence in the 3' untranslated sequence	69737
gene_homology	has high similarity over 3'untranslated sequence with human cardiac muscle actin	69737
gene_product	member of the actin family	69737

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)