Symbol:
Mink1
Name:
misshapen-like kinase 1 (zebrafish)
RGD ID:
1622349
MGI Page
MGI
Description:
Enables ATP binding activity and protein serine/threonine kinase activity. Involved in brain development; positive regulation of MAPK cascade; and protein phosphorylation. Acts upstream of or within negative thymic T cell selection. Predicted to be located in Golgi apparatus. Predicted to be active in cytoplasm. Is expressed in knee joint primordium; knee mesenchyme; lower leg mesenchyme; tibia; and tibia cartilage condensation. Orthologous to human MINK1 (misshapen like kinase 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
B55; GCK family kinase MiNK; Map4; Map4k6; MAPK/ERK kinase kinase kinase 6; MEK kinase kinase 6; MEKKK 6; MI; MINK; misshapen-like kinase 1; misshapen/NIK-related kinase; Misshapen/NIKs-related kinase; RP23-122P1.6; Yeast Sps1/Ste20-related kinase 2; Ysk; Ysk2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MINK1 (misshapen like kinase 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Mink1 (misshapen-like kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mink1 (misshapen like kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MINK1 (misshapen like kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MINK1 (misshapen like kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mink1 (misshapen like kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MINK1 (misshapen like kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MINK1 (misshapen like kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mink1 (misshapen like kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4) HGNC
OrthoMCL
Homo sapiens (human):
TNIK (TRAF2 and NCK interacting kinase) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Mink1 (misshapen-like kinase 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MINK1 (misshapen like kinase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mink1 (misshapen-like kinase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
mig-15
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
msn
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 70,452,272 - 70,505,309 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 70,453,707 - 70,505,309 (+) Ensembl GRCm39 Ensembl GRCm38 11 70,561,580 - 70,614,482 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 70,562,881 - 70,614,483 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 70,376,383 - 70,427,984 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 70,379,085 - 70,430,673 (+) NCBI MGSCv36 mm8 Celera 11 78,111,189 - 78,162,803 (+) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 43.0 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mink1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MINK1 mRNA CTD PMID:36331819 Mink1 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of MINK1 mRNA CTD PMID:22206623 Mink1 Mouse 1-chloro-2,4-dinitrobenzene affects binding ISO MINK1 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to MINK1 protein CTD PMID:32991956 Mink1 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of MINK1 mRNA CTD PMID:39298647 Mink1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MINK1 mRNA CTD PMID:26290441 Mink1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mink1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MINK1 mRNA CTD PMID:33387578 Mink1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Mink1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MINK1 mRNA CTD PMID:34747641 Mink1 Mouse 2-hydroxypropanoic acid increases expression ISO MINK1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MINK1 mRNA CTD PMID:30851411 Mink1 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of MINK1 mRNA CTD PMID:20188158 Mink1 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Mink1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of MINK1 mRNA CTD PMID:36041667 Mink1 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of MINK1 gene CTD PMID:31683443 Mink1 Mouse all-trans-retinoic acid increases expression ISO MINK1 (Homo sapiens) 6480464 Tretinoin results in increased expression of MINK1 mRNA CTD PMID:33167477 Mink1 Mouse arsane multiple interactions ISO MINK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MINK1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MINK1 mRNA CTD PMID:39836092 Mink1 Mouse arsenic atom multiple interactions ISO MINK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MINK1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MINK1 mRNA CTD PMID:39836092 Mink1 Mouse arsenite(3-) multiple interactions ISO MINK1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to MINK1 mRNA] CTD PMID:32406909 Mink1 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO MINK1 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Mink1 Mouse beta-lapachone decreases expression ISO MINK1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of MINK1 mRNA CTD PMID:38218311 Mink1 Mouse beta-lapachone increases expression ISO MINK1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of MINK1 mRNA CTD PMID:38218311 Mink1 Mouse bisphenol A affects expression ISO Mink1 (Rattus norvegicus) 6480464 bisphenol A affects the expression of MINK1 mRNA CTD PMID:25181051 Mink1 Mouse bisphenol A multiple interactions ISO Mink1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of MINK1 mRNA CTD PMID:36041667 Mink1 Mouse bisphenol A decreases methylation ISO MINK1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of MINK1 gene CTD PMID:31601247 Mink1 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MINK1 mRNA CTD PMID:33221593 Mink1 Mouse bisphenol A decreases expression ISO Mink1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of MINK1 mRNA CTD PMID:30816183 more ... Mink1 Mouse bisphenol F multiple interactions ISO Mink1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of MINK1 mRNA CTD PMID:36041667 Mink1 Mouse cadmium atom increases expression ISO MINK1 (Homo sapiens) 6480464 Cadmium results in increased expression of MINK1 mRNA CTD PMID:24376830 Mink1 Mouse caffeine affects phosphorylation ISO MINK1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of MINK1 protein CTD PMID:35688186 Mink1 Mouse CGP 52608 multiple interactions ISO MINK1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MINK1 gene] CTD PMID:28238834 Mink1 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of MINK1 mRNA CTD PMID:37019170 Mink1 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of MINK1 gene CTD PMID:20938992 Mink1 Mouse cisplatin multiple interactions ISO MINK1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of MINK1 mRNA and Cisplatin inhibits the reaction [Piroxicam results in increased expression of MINK1 mRNA] CTD PMID:21858171 and PMID:27392435 Mink1 Mouse cisplatin increases expression ISO MINK1 (Homo sapiens) 6480464 Cisplatin results in increased expression of MINK1 mRNA CTD PMID:27392435 Mink1 Mouse cisplatin decreases expression ISO MINK1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of MINK1 mRNA CTD PMID:27594783 Mink1 Mouse corosolic acid decreases expression ISO MINK1 (Homo sapiens) 6480464 corosolic acid results in decreased expression of MINK1 mRNA CTD PMID:37939859 Mink1 Mouse coumarin increases phosphorylation ISO MINK1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of MINK1 protein CTD PMID:35688186 Mink1 Mouse dicrotophos increases expression ISO MINK1 (Homo sapiens) 6480464 dicrotophos results in increased expression of MINK1 mRNA CTD PMID:28302478 Mink1 Mouse diuron increases expression ISO Mink1 (Rattus norvegicus) 6480464 Diuron results in increased expression of MINK1 mRNA CTD PMID:21551480 Mink1 Mouse doxorubicin decreases expression ISO MINK1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MINK1 mRNA CTD PMID:29803840 Mink1 Mouse elemental selenium increases expression ISO MINK1 (Homo sapiens) 6480464 Selenium results in increased expression of MINK1 mRNA CTD PMID:19244175 Mink1 Mouse ethanol multiple interactions EXP 6480464 Ethanol affects the expression of and affects the splicing of MINK1 mRNA CTD PMID:30319688 Mink1 Mouse folic acid multiple interactions EXP 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Mink1 Mouse FR900359 affects phosphorylation ISO MINK1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of MINK1 protein CTD PMID:37730182 Mink1 Mouse gentamycin decreases expression ISO Mink1 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of MINK1 mRNA CTD PMID:33387578 Mink1 Mouse ivermectin decreases expression ISO MINK1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MINK1 protein CTD PMID:32959892 Mink1 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of MINK1 gene CTD PMID:20938992 Mink1 Mouse lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of MINK1 mRNA CTD PMID:21322097 Mink1 Mouse lipopolysaccharide increases expression ISO MINK1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of MINK1 mRNA CTD PMID:34529319 Mink1 Mouse manganese atom multiple interactions ISO MINK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MINK1 mRNA CTD PMID:39836092 Mink1 Mouse manganese(0) multiple interactions ISO MINK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MINK1 mRNA CTD PMID:39836092 Mink1 Mouse manganese(II) chloride multiple interactions ISO MINK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MINK1 mRNA CTD PMID:39836092 Mink1 Mouse methylmercury chloride decreases expression ISO MINK1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of MINK1 mRNA CTD PMID:28001369 Mink1 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MINK1 mRNA CTD PMID:35964746 Mink1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MINK1 mRNA CTD PMID:34911549 Mink1 Mouse paracetamol decreases expression ISO MINK1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MINK1 mRNA CTD PMID:21420995 Mink1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MINK1 mRNA CTD PMID:36331819 Mink1 Mouse piroxicam multiple interactions ISO MINK1 (Homo sapiens) 6480464 Cisplatin inhibits the reaction [Piroxicam results in increased expression of MINK1 mRNA] CTD PMID:21858171 Mink1 Mouse piroxicam increases expression ISO MINK1 (Homo sapiens) 6480464 Piroxicam results in increased expression of MINK1 mRNA CTD PMID:21858171 Mink1 Mouse rac-lactic acid increases expression ISO MINK1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MINK1 mRNA CTD PMID:30851411 Mink1 Mouse selenium atom increases expression ISO MINK1 (Homo sapiens) 6480464 Selenium results in increased expression of MINK1 mRNA CTD PMID:19244175 Mink1 Mouse silicon dioxide decreases expression ISO MINK1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of MINK1 mRNA CTD PMID:25895662 Mink1 Mouse sodium arsenite multiple interactions ISO MINK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MINK1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MINK1 mRNA CTD PMID:39836092 Mink1 Mouse sunitinib increases expression ISO MINK1 (Homo sapiens) 6480464 Sunitinib results in increased expression of MINK1 mRNA CTD PMID:31533062 Mink1 Mouse thioacetamide decreases expression ISO Mink1 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of MINK1 mRNA CTD PMID:34492290 Mink1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of MINK1 gene CTD PMID:35295148 Mink1 Mouse titanium dioxide increases expression ISO MINK1 (Homo sapiens) 6480464 titanium dioxide results in increased expression of MINK1 mRNA CTD PMID:34973136 Mink1 Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of MINK1 mRNA CTD PMID:33045310 Mink1 Mouse valproic acid increases methylation ISO MINK1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MINK1 gene CTD PMID:29154799 Mink1 Mouse zoledronic acid decreases expression ISO MINK1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of MINK1 mRNA CTD PMID:20977926
(1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) choline (EXP) cisplatin (ISO) corosolic acid (ISO) coumarin (ISO) dicrotophos (ISO) diuron (ISO) doxorubicin (ISO) elemental selenium (ISO) ethanol (EXP) folic acid (EXP) FR900359 (ISO) gentamycin (ISO) ivermectin (ISO) L-methionine (EXP) lead diacetate (EXP) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methylmercury chloride (ISO) nitrates (EXP) ozone (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP) piroxicam (ISO) rac-lactic acid (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) thioacetamide (ISO) titanium dioxide (EXP,ISO) triptonide (EXP) valproic acid (ISO) zoledronic acid (ISO)
Mink1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 70,452,272 - 70,505,309 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 70,453,707 - 70,505,309 (+) Ensembl GRCm39 Ensembl GRCm38 11 70,561,580 - 70,614,482 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 70,562,881 - 70,614,483 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 70,376,383 - 70,427,984 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 70,379,085 - 70,430,673 (+) NCBI MGSCv36 mm8 Celera 11 78,111,189 - 78,162,803 (+) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 43.0 NCBI
MINK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 4,833,340 - 4,898,061 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 4,833,340 - 4,898,061 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 4,736,635 - 4,801,356 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 4,683,351 - 4,742,135 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 4,751,747 - 4,816,237 (+) NCBI Celera Cytogenetic Map 17 p13.2 NCBI HuRef 17 4,624,721 - 4,689,491 (+) NCBI HuRef CHM1_1 17 4,745,647 - 4,810,633 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 4,722,898 - 4,788,313 (+) NCBI T2T-CHM13v2.0
Mink1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 55,776,879 - 55,829,406 (+) NCBI GRCr8 mRatBN7.2 10 55,278,293 - 55,330,782 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 55,278,391 - 55,330,782 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 59,958,877 - 60,011,540 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 59,447,383 - 59,500,046 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 54,946,491 - 54,999,149 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 57,185,310 - 57,238,531 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 57,185,347 - 57,238,531 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 56,930,810 - 56,984,074 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 57,443,253 - 57,496,763 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 57,507,528 - 57,510,382 (+) NCBI Celera 10 54,424,066 - 54,476,447 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
Mink1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 10,256,434 - 10,313,834 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 10,256,722 - 10,312,011 (+) NCBI ChiLan1.0 ChiLan1.0
MINK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 12,441,492 - 12,506,241 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 14,409,955 - 14,474,570 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 4,879,851 - 4,944,374 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 4,868,625 - 4,932,789 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 4,868,620 - 4,932,789 (+) Ensembl panpan1.1 panPan2
MINK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 31,707,975 - 31,718,013 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 31,708,553 - 31,749,842 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 31,847,635 - 31,889,644 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 31,813,049 - 31,855,271 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 31,813,030 - 31,855,277 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 31,779,569 - 31,821,588 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 31,739,278 - 31,781,273 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 31,915,651 - 31,957,663 (-) NCBI UU_Cfam_GSD_1.0
Mink1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 53,036,609 - 53,087,076 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936677 2,813,899 - 2,864,366 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936677 2,813,899 - 2,864,366 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MINK1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 52,016,299 - 52,066,693 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 52,016,297 - 52,066,687 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 54,085,255 - 54,102,452 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MINK1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 4,305,680 - 4,370,554 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 4,305,701 - 4,369,780 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 17,264,905 - 17,331,152 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mink1
.
Predicted Target Of
Count of predictions: 3838 Count of miRNA genes: 685 Interacting mature miRNAs: 894 Transcripts: ENSMUST00000072237, ENSMUST00000072873, ENSMUST00000079244, ENSMUST00000102558, ENSMUST00000102559, ENSMUST00000132208, ENSMUST00000133310, ENSMUST00000136663, ENSMUST00000142650, ENSMUST00000149845, ENSMUST00000152857, ENSMUST00000153503, ENSMUST00000178764 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
27226783 Tibl5_m tibia length 5, 5 week (mouse) 11 68190826 101890826 Mouse 1300628 Lgth6_m body length 6 (mouse) Not determined 11 66733420 100733652 Mouse 4141367 Inf1_m acute ozone induced inflammation (mouse) Not determined 44630038 113058009 Mouse 4141875 Etax9_m ethanol induced ataxia 9 (mouse) Not determined 55284985 72209927 Mouse 1300765 Bbaa4_m B.burgdorferi-associated arthritis 4 (mouse) Not determined 11 46185167 80185262 Mouse 1301788 Lbw8_m lupus NZB x NZW 8 (mouse) Not determined 11 36503287 70509492 Mouse 1302021 Nidd1n_m non-insulin-dependent diabetes mellitus 1 in NSY (mouse) Not determined 11 45165873 79978324 Mouse 4142121 Tmc1m2_m Tmc1 modifier 2 (mouse) Not determined 11 56864027 114157957 Mouse 1301896 Tria1_m T-cell receptor induced activation 1 (mouse) Not determined 11 36613565 70613855 Mouse 4141982 Skts-fp2_m skin tumor susceptibility in FVB and PWK 2 (mouse) Not determined 58719266 85066529 Mouse 4141853 Skmw17_m skeletal muscle weight 17 (mouse) Not determined 11 37080941 71081064 Mouse 1357878 Mastr_m modifier of astrocytoma (mouse) Not determined 11 45708581 89818733 Mouse 1300784 Prdt3_m prion disease incubation time 3 (mouse) Not determined 11 66733420 100733652 Mouse 11039501 Ltpr6a_m Leishmania tropica response 6a (mouse) 11 64830336 98830473 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 13524840 Ppiq9a_m prepulse inhibition QTL 9a (mouse) 11 52494385 86494385 Mouse 11039502 Ltpr6b_m Leishmania tropica response 6b (mouse) 11 64830336 98830473 Mouse 36049792 Ars5_m antibody response to SARS-CoV 5, day 7, IgM (mouse) 11 68990826 72490826 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 1300664 Etohcta9_m ethanol conditioned taste aversion 9 (mouse) Not determined 11 57754660 91754758 Mouse 10053682 Eae45_m experimental allergic encephalomyelitis susceptibility 45 (mouse) Not determined 11 58490555 74754758 Mouse 1300924 Ity2_m immunity to S. typhimurium 2 (mouse) Not determined 1 58508030 87695238 Mouse 13208569 Bmiq10_m body mass index QTL 10 (mouse) 11 35890827 84890826 Mouse 11039515 Ltpr6_m Leishmania tropica response 6 (mouse) 11 64830336 98830473 Mouse 11532699 Sluc36b_m susceptibility to lung cancer 36b (mouse) 11 42256617 76256730 Mouse 11532698 Sluc36a_m susceptibility to lung cancer 36a (mouse) 11 42256617 76256730 Mouse 1300774 Pgia7_m proteoglycan induced arthritis 7 (mouse) Not determined 11 53390588 87390737 Mouse 4141830 Pregq1_m pregnancy QTL 1 (mouse) Not determined 11 54126752 83733652 Mouse 1301546 Pcir2_m periosteal circumference 2 (mouse) Not determined 11 66733420 100733652 Mouse 1300905 Scc6_m colon tumor susceptibility 6 (mouse) Not determined 11 6880277 89019734 Mouse 35673314 Ari2_m antibody response to influenza 2, day 10, IgG3 (mouse) 11 68990826 72490826 Mouse 39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 1301328 Mol4_m modifier of LPS-response 4 (mouse) Not determined 11 36282577 83481356 Mouse 10412246 Dfs2_m dental fluorosis suseptibility 2 (mouse) Not determined 11 21807364 95881231 Mouse 1357766 Si5lq6_m serum IGFBP-5 level QTL 6 (mouse) Not determined 11 66733420 100733652 Mouse 4142316 Ity2b_m immunity to S. typhimurium 2b (mouse) Not determined 11 67078191 79813912 Mouse 1301319 Dautb4_m dopamine uptake transporter binding 4 (mouse) Not determined 11 62156005 96156153 Mouse 36049778 Ars6_m antibody response to SARS-CoV 6, day 15, IgM (mouse) 11 68990826 72490826 Mouse 1301830 Ssta4_m susceptibility to Salmonella typhimurium antigens 4 (mouse) Not determined 11 50078191 84078411 Mouse 36049779 Ars7_m antibody response to SARS-CoV 7, day 29, IgG1 (mouse) 11 68990826 72490826 Mouse 36049790 Ars3_m antibody response to SARS-CoV 3, day 7, IgG2b (mouse) 11 68990826 72490826 Mouse 36049791 Ars4_m antibody response to SARS-CoV 4, day 7, IgG3 (mouse) 11 68990826 72490826 Mouse 1301833 Tbbmd5_m total body bone mineral density 5 (mouse) Not determined 11 66733420 100733652 Mouse 36049788 Ars1_m antibody response to SARS-CoV 1, day 7, IgG1 (mouse) 11 68990826 72490826 Mouse 36049789 Ars2_m antibody response to SARS-CoV 2, day 7, IgG2a+IgG2c (mouse) 11 68990826 72490826 Mouse 36049786 Ars10_m antibody response to SARS-CoV 10, 4 days post-rechallenge, IgG2a+IgG2c (mouse) 11 68990826 72490826 Mouse 10766457 Nwa3_m New Zealand White autoimmunity 3 (mouse) 11 38016115 72016209 Mouse 36049787 Ars11_m antibody response to SARS-CoV 11, 4 days post-rechallenge, IgM (mouse) 11 68990826 72490826 Mouse 36049784 Ars8_m antibody response to SARS-CoV 8, day 29, IgG2a+IgG2c (mouse) 11 68990826 72490826 Mouse 36049785 Ars9_m antibody response to SARS-CoV 9, day 29, IgM (mouse) 11 68990826 72490826 Mouse 4142300 Ctrq3_m C. trachomatis resistance QTL 3 (mouse) Not determined 11 44630038 76854757 Mouse 4141012 Femwf6_m femur work to failure 6 (mouse) Not determined 66733420 100733652 Mouse 1301987 Pid3_m prior incubation determinant 3 (mouse) Not determined 11 61686820 88699728 Mouse 27226730 Tibmd1_m tibia midshaft diameter 1, 5 week (mouse) 11 62590826 109390826 Mouse 1301988 Bmd11_m bone mineral density 11 (mouse) Not determined 11 46319407 80319522 Mouse 4141894 Nidd6k_m Nidd6 on KK-A (mouse) Not determined 19124204 96897826 Mouse 1301999 Lmr15_m leishmaniasis resistance 15 (mouse) Not determined 11 63319407 81830473 Mouse 10044004 Stzid3_m streptozotocin induced diabetes susceptibility 3 (mouse) Not determined 11 63319407 94063918 Mouse 26884453 Sklq16_m skull length QTL 16, 16 week (mouse) 11 3250000 72690826 Mouse
J04698
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 70,614,632 - 70,614,793 UniSTS GRCm38 MGSCv37 11 70,428,134 - 70,428,295 UniSTS GRCm37 Celera 11 78,162,953 - 78,163,114 UniSTS Cytogenetic Map 11 B4 UniSTS Cytogenetic Map 11 B3 UniSTS cM Map 11 42.0 UniSTS Whitehead_YAC 11 UniSTS
MARC_21871-21872:1046872408:1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 70,608,877 - 70,609,617 UniSTS GRCm38 MGSCv37 11 70,422,379 - 70,423,119 UniSTS GRCm37 Celera 11 78,157,198 - 78,157,938 UniSTS Cytogenetic Map 11 B4 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000072237 ⟹ ENSMUSP00000072091
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,453,707 - 70,505,308 (+) Ensembl GRCm38.p6 Ensembl 11 70,562,881 - 70,614,482 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000072873 ⟹ ENSMUSP00000072649
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,453,716 - 70,504,954 (+) Ensembl GRCm38.p6 Ensembl 11 70,562,890 - 70,614,128 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000079244 ⟹ ENSMUSP00000078234
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,453,843 - 70,505,309 (+) Ensembl GRCm38.p6 Ensembl 11 70,563,017 - 70,614,483 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000102558 ⟹ ENSMUSP00000099618
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,453,896 - 70,504,538 (+) Ensembl GRCm38.p6 Ensembl 11 70,563,070 - 70,613,712 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000102559 ⟹ ENSMUSP00000099619
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,453,724 - 70,505,304 (+) Ensembl GRCm38.p6 Ensembl 11 70,562,898 - 70,614,478 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000132208
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,500,877 - 70,501,805 (+) Ensembl GRCm38.p6 Ensembl 11 70,610,051 - 70,610,979 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000133310
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,489,814 - 70,495,857 (+) Ensembl GRCm38.p6 Ensembl 11 70,598,988 - 70,605,031 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000136663 ⟹ ENSMUSP00000117959
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,492,815 - 70,505,309 (+) Ensembl GRCm38.p6 Ensembl 11 70,601,989 - 70,614,483 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000142650
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,500,564 - 70,501,535 (+) Ensembl GRCm38.p6 Ensembl 11 70,609,738 - 70,610,709 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000149845 ⟹ ENSMUSP00000137075
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,495,049 - 70,497,905 (+) Ensembl GRCm38.p6 Ensembl 11 70,604,223 - 70,607,079 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000152857
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,498,638 - 70,499,654 (+) Ensembl GRCm38.p6 Ensembl 11 70,607,812 - 70,608,828 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000153503
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,497,527 - 70,498,599 (+) Ensembl GRCm38.p6 Ensembl 11 70,606,701 - 70,607,773 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000178764 ⟹ ENSMUSP00000136149
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 70,495,026 - 70,498,250 (+) Ensembl GRCm38.p6 Ensembl 11 70,604,200 - 70,607,424 (+) Ensembl
RefSeq Acc Id:
NM_001045959 ⟹ NP_001039424
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,453,694 - 70,505,309 (+) NCBI GRCm38 11 70,562,881 - 70,614,482 (+) NCBI MGSCv37 11 70,376,383 - 70,427,984 (+) RGD Celera 11 78,111,189 - 78,162,803 (+) RGD cM Map 11 ENTREZGENE
Sequence:
ACTCGGGTTGCAGGCGCGCGGGTGAGAGCGCCTGTCAGCCGCTGGGTCGGTCCTCCCGCTGGCCCTCCCCCTCCCCGGCCTTCGGGGCAGGCGCGGTGGAGCCCGCCCCTCGAGTCCCCCGATGGGGG
hide sequence
RefSeq Acc Id:
NM_001045964 ⟹ NP_001039429
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,453,694 - 70,505,309 (+) NCBI GRCm38 11 70,562,881 - 70,614,482 (+) NCBI MGSCv37 11 70,376,383 - 70,427,984 (+) RGD Celera 11 78,111,189 - 78,162,803 (+) RGD cM Map 11 ENTREZGENE
Sequence:
ACTCGGGTTGCAGGCGCGCGGGTGAGAGCGCCTGTCAGCCGCTGGGTCGGTCCTCCCGCTGGCCCTCCCCCTCCCCGGCCTTCGGGGCAGGCGCGGTGGAGCCCGCCCCTCGAGTCCCCCGATGGGGG
hide sequence
RefSeq Acc Id:
NM_001403555 ⟹ NP_001390484
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,453,694 - 70,505,309 (+) NCBI
RefSeq Acc Id:
NM_001403556 ⟹ NP_001390485
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,453,694 - 70,505,309 (+) NCBI
RefSeq Acc Id:
NM_001403557 ⟹ NP_001390486
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,453,694 - 70,505,309 (+) NCBI
RefSeq Acc Id:
NM_016713 ⟹ NP_057922
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,453,694 - 70,505,309 (+) NCBI GRCm38 11 70,562,881 - 70,614,482 (+) NCBI MGSCv37 11 70,376,383 - 70,427,984 (+) RGD Celera 11 78,111,189 - 78,162,803 (+) RGD cM Map 11 ENTREZGENE
Sequence:
ACTCGGGTTGCAGGCGCGCGGGTGAGAGCGCCTGTCAGCCGCTGGGTCGGTCCTCCCGCTGGCC
hide sequence
RefSeq Acc Id:
NM_176893 ⟹ NP_795712
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,453,694 - 70,505,309 (+) NCBI GRCm38 11 70,562,881 - 70,614,482 (+) NCBI MGSCv37 11 70,376,383 - 70,427,984 (+) RGD Celera 11 78,111,189 - 78,162,803 (+) RGD cM Map 11 ENTREZGENE
Sequence:
ACTCGGGTTGCAGGCGCGCGGGTGAGAGCGCCTGTCAGCCGCTGGGTCGGTCCTCCCGCTGGCC
hide sequence
RefSeq Acc Id:
XM_006533677 ⟹ XP_006533740
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,452,272 - 70,505,306 (+) NCBI GRCm38 11 70,561,580 - 70,614,480 (+) NCBI
Sequence:
TTAAGTATGGTTTATTAGAACATAAGACCAGAAAAGAAAAATATATATACATAAGGTCAAAGAAACAGCAGAATCTTGAAAGTCTTTGATATCACTACCCACAAGGCAGTGGGAGTCATCAAACGGTG
hide sequence
RefSeq Acc Id:
XM_006533678 ⟹ XP_006533741
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,452,272 - 70,505,306 (+) NCBI GRCm38 11 70,561,580 - 70,614,480 (+) NCBI
Sequence:
TTAAGTATGGTTTATTAGAACATAAGACCAGAAAAGAAAAATATATATACATAAGGTCAAAGAAACAGCAGAATCTTGAAAGTCTTTGATATCACTACCCACAAGGCAGTGGGAGTCATCAAACGGTG
hide sequence
RefSeq Acc Id:
XM_017314645 ⟹ XP_017170134
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,452,272 - 70,505,306 (+) NCBI GRCm38 11 70,561,580 - 70,614,480 (+) NCBI
Sequence:
TTAAGTATGGTTTATTAGAACATAAGACCAGAAAAGAAAAATATATATACATAAGGTCAAAGAAACAGCAGAATCTTGAAAGTCTTTGATATCACTACCCACAAGGCAGTGGGAGTCATCAAACGGTG
hide sequence
RefSeq Acc Id:
XM_017314646 ⟹ XP_017170135
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,452,272 - 70,505,306 (+) NCBI GRCm38 11 70,561,580 - 70,614,480 (+) NCBI
Sequence:
TTAAGTATGGTTTATTAGAACATAAGACCAGAAAAGAAAAATATATATACATAAGGTCAAAGAA
hide sequence
RefSeq Acc Id:
XM_030246117 ⟹ XP_030101977
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,452,272 - 70,505,306 (+) NCBI GRCm38 11 70,561,580 - 70,614,480 (+) NCBI
Sequence:
TTAAGTATGGTTTATTAGAACATAAGACCAGAAAAGAAAAATATATATACATAAGGTCAAAGAA
hide sequence
RefSeq Acc Id:
XM_030246118 ⟹ XP_030101978
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,487,988 - 70,505,304 (+) NCBI GRCm38 11 70,597,162 - 70,614,478 (+) NCBI
Sequence:
TCCCAGGACCCTGCAGGAATCTTTGAGCTGGTGGAGGTGGTTGGCAATGGAACCTATGGACAGGTATACAAGGGGCGGCACGTCAAGACTGGGCAGCTGGCTGCCATTAAGGTCATGGATGTCACAGA
hide sequence
RefSeq Acc Id:
XR_388490
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 70,452,272 - 70,505,306 (+) NCBI GRCm38 11 70,561,580 - 70,614,480 (+) NCBI
Sequence:
TTAAGTATGGTTTATTAGAACATAAGACCAGAAAAGAAAAATATATATACATAAGGTCAAAGAA
hide sequence
RefSeq Acc Id:
NP_001039429 ⟸ NM_001045964
- Peptide Label:
isoform 4
- UniProtKB:
G3X9G2 (UniProtKB/TrEMBL), Q5SXG1 (UniProtKB/TrEMBL)
- Sequence:
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKED
hide sequence
RefSeq Acc Id:
NP_001039424 ⟸ NM_001045959
- Peptide Label:
isoform 3
- UniProtKB:
Q5SXG3 (UniProtKB/TrEMBL), Q5SXG1 (UniProtKB/TrEMBL)
- Sequence:
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEE
hide sequence
RefSeq Acc Id:
NP_795712 ⟸ NM_176893
- Peptide Label:
isoform 2
- UniProtKB:
Q921M6 (UniProtKB/Swiss-Prot), Q5SXG2 (UniProtKB/Swiss-Prot), Q9JM92 (UniProtKB/Swiss-Prot), Q9JM52 (UniProtKB/Swiss-Prot), Q5SXG1 (UniProtKB/TrEMBL)
- Sequence:
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKED
hide sequence
RefSeq Acc Id:
NP_057922 ⟸ NM_016713
- Peptide Label:
isoform 1
- UniProtKB:
Q5SXG1 (UniProtKB/TrEMBL)
- Sequence:
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEE
hide sequence
RefSeq Acc Id:
XP_006533741 ⟸ XM_006533678
- Peptide Label:
isoform X2
- UniProtKB:
Q5SXG1 (UniProtKB/TrEMBL)
- Sequence:
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKED
hide sequence
RefSeq Acc Id:
XP_006533740 ⟸ XM_006533677
- Peptide Label:
isoform X1
- UniProtKB:
Q5SXG1 (UniProtKB/TrEMBL)
- Sequence:
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKED
hide sequence
RefSeq Acc Id:
XP_017170134 ⟸ XM_017314645
- Peptide Label:
isoform X6
- UniProtKB:
Q5SXG1 (UniProtKB/TrEMBL)
- Sequence:
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKED
hide sequence
RefSeq Acc Id:
XP_017170135 ⟸ XM_017314646
- Peptide Label:
isoform X7
- UniProtKB:
Q5SXG1 (UniProtKB/TrEMBL)
- Sequence:
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEE
hide sequence
RefSeq Acc Id:
XP_030101977 ⟸ XM_030246117
- Peptide Label:
isoform X8
- UniProtKB:
Q5SXG1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030101978 ⟸ XM_030246118
- Peptide Label:
isoform X9
- UniProtKB:
F7AMS7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000136149 ⟸ ENSMUST00000178764
Ensembl Acc Id:
ENSMUSP00000078234 ⟸ ENSMUST00000079244
Ensembl Acc Id:
ENSMUSP00000072649 ⟸ ENSMUST00000072873
Ensembl Acc Id:
ENSMUSP00000072091 ⟸ ENSMUST00000072237
Ensembl Acc Id:
ENSMUSP00000137075 ⟸ ENSMUST00000149845
Ensembl Acc Id:
ENSMUSP00000117959 ⟸ ENSMUST00000136663
Ensembl Acc Id:
ENSMUSP00000099619 ⟸ ENSMUST00000102559
Ensembl Acc Id:
ENSMUSP00000099618 ⟸ ENSMUST00000102558
RefSeq Acc Id:
NP_001390484 ⟸ NM_001403555
- Peptide Label:
isoform 5
- UniProtKB:
Q5SXG1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001390486 ⟸ NM_001403557
- Peptide Label:
isoform 7
- UniProtKB:
Q5SXG1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001390485 ⟸ NM_001403556
- Peptide Label:
isoform 6
- UniProtKB:
Q5SXG1 (UniProtKB/TrEMBL)
RGD ID: 6821287 Promoter ID: MM_KWN:8226 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung Transcripts: NM_001045959, NM_001045964, NM_016713, NM_176893, UC007JVH.1, UC007JVM.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 70,375,806 - 70,376,542 (+) MPROMDB
RGD ID: 6821275 Promoter ID: MM_KWN:8228 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: OTTMUST00000013647 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 70,412,166 - 70,412,666 (+) MPROMDB
RGD ID: 6821277 Promoter ID: MM_KWN:8229 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Lung Transcripts: OTTMUST00000013649 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 70,415,154 - 70,415,654 (+) MPROMDB
RGD ID: 6821274 Promoter ID: MM_KWN:8230 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Lung Transcripts: OTTMUST00000013646 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 70,417,566 - 70,418,067 (+) MPROMDB
RGD ID: 6821280 Promoter ID: MM_KWN:8231 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Lung Transcripts: OTTMUST00000013656, UC007JVN.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 70,419,291 - 70,420,617 (+) MPROMDB
RGD ID: 6821279 Promoter ID: MM_KWN:8232 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Lung Transcripts: OTTMUST00000013655 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 70,420,779 - 70,421,279 (+) MPROMDB
RGD ID: 6821278 Promoter ID: MM_KWN:8233 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: OTTMUST00000013653 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 70,423,326 - 70,423,826 (+) MPROMDB
RGD ID: 8675336 Promoter ID: EPDNEW_M15699 Type: initiation region Name: Mink1_1 Description: Mus musculus misshapen-like kinase 1 , transcript variant 3,mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M15700 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 70,562,880 - 70,562,940 EPDNEW
RGD ID: 8675338 Promoter ID: EPDNEW_M15700 Type: multiple initiation site Name: Mink1_2 Description: Mus musculus misshapen-like kinase 1 , transcript variant 3,mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M15699 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 70,606,567 - 70,606,627 EPDNEW
