Advanced Search (OLGA)

Gene: Ugt1a5 (UDP glucuronosyltransferase 1 family, polypeptide A5) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Ugt1a5

Name:

UDP glucuronosyltransferase 1 family, polypeptide A5

RGD ID:

1619654

MGI Page

MGI

Description:

Predicted to enable enzyme binding activity; glucuronosyltransferase activity; and protein dimerization activity. Predicted to be active in endoplasmic reticulum. Orthologous to several human genes including UGT1A5 (UDP glucuronosyltransferase family 1 member A5).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

UDP glycosyltransferase 1 family, polypeptide A5

RGD Orthologs

Human

Rat

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UGT1A4 (UDP glucuronosyltransferase family 1 member A4)	HGNC	Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):	Ugt1a5 (UDP glucuronosyltransferase family 1 member A5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	UGT1A3 (UDP glucuronosyltransferase family 1 member A3)	HGNC	EggNOG, Ensembl, Panther, Treefam
Homo sapiens (human):	UGT1A5 (UDP glucuronosyltransferase family 1 member A5)	HGNC	Ensembl, Panther, Treefam
Homo sapiens (human):	UGT1A8 (UDP glucuronosyltransferase family 1 member A8)	HGNC	OrthoDB, OrthoMCL
Homo sapiens (human):	UGT1A10 (UDP glucuronosyltransferase family 1 member A10)	HGNC	OrthoDB, OrthoMCL
Homo sapiens (human):	UGT1A9 (UDP glucuronosyltransferase family 1 member A9)	HGNC	OrthoDB, OrthoMCL
Homo sapiens (human):	UGT1A6 (UDP glucuronosyltransferase family 1 member A6)	HGNC	OrthoDB, OrthoMCL
Homo sapiens (human):	UGT1A1 (UDP glucuronosyltransferase family 1 member A1)	HGNC	OrthoDB, OrthoMCL
Homo sapiens (human):	UGT1A7 (UDP glucuronosyltransferase family 1 member A7)	HGNC	OrthoDB, OrthoMCL
Alliance orthologs ³
Homo sapiens (human):	UGT1A4 (UDP glucuronosyltransferase family 1 member A4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	UGT1A5 (UDP glucuronosyltransferase family 1 member A5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Ugt1a5 (UDP glucuronosyltransferase family 1 member A5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ugt1a7 (UDP glucuronosyltransferase 1 family, polypeptide A7)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ugt1ab (UDP glucuronosyltransferase 1 family a, b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10168	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10170	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Caenorhabditis elegans (roundworm):	ugt-22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA)
Drosophila melanogaster (fruit fly):	CG16732	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Caenorhabditis elegans (roundworm):	ugt-62	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17322	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG17323	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG17324	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Saccharomyces cerevisiae (baker's yeast):	ATG26	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Drosophila melanogaster (fruit fly):	Ugt35b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ugt86De	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ugt86Dg	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ugt86Dj	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4302	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6475	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dot	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt86Dh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5999	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt37b1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG3797	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt35a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ugt36Ba	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt36Bc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt86Dd	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ugt1a1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	88,093,734 - 88,147,724 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	88,093,734 - 88,146,719 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	88,166,012 - 88,220,002 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	88,166,012 - 88,218,997 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	90,062,587 - 90,116,577 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	89,997,183 - 90,050,148 (+)	NCBI		MGSCv36	mm8
Celera	1	91,126,155 - 91,181,062 (+)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	44.53	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ugt1a5	Mouse	bilirubin metabolic disorder		ISO	UGT1A4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hyperbilirubinemia	ClinVar	PMID:10975608 more ...
Ugt1a5	Mouse	Crigler Najjar Syndrome, Type 1		ISO	UGT1A4 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10412811 more ...
Ugt1a5	Mouse	Crigler Najjar Syndrome, Type 2		ISO	UGT1A4 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10412811 more ...
Ugt1a5	Mouse	Crigler-Najjar syndrome		ISO	UGT1A4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Crigler-Najjar syndrome	ClinVar	PMID:11013440 more ...
Ugt1a5	Mouse	genetic disease		ISO	UGT1A4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:11182932 more ...
Ugt1a5	Mouse	Gilbert syndrome		ISO	UGT1A4 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10412811 more ...
Ugt1a5	Mouse	Hyperbilirubinemia, Transient Familial Neonatal		ISO	UGT1A4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Transient familial neonatal hyperbilirubinemia	ClinVar	PMID:10412811 more ...
Ugt1a5	Mouse	Joubert syndrome 22		ISO	UGT1A4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Joubert syndrome 22	ClinVar	PMID:28492532
Ugt1a5	Mouse	Perlman syndrome		ISO	UGT1A4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Perlman syndrome	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ugt1a5	Mouse	celiac disease		ISO	UGT1A4 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:30097691

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ugt1a5	Mouse	(-)-cotinine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Cotinine	CTD	PMID:14570768 and PMID:16141602
Ugt1a5	Mouse	(5Z,8Z,11Z,13E)-15-HETE	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of 15-hydroxy-5 more ...	CTD	PMID:15231852
Ugt1a5	Mouse	(S)-nicotine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Nicotine	CTD	PMID:14570768 and PMID:16141602
Ugt1a5	Mouse	(S)-nicotine	decreases expression	EXP		6480464	Nicotine results in decreased expression of UGT1A5 mRNA	CTD	PMID:21955143
Ugt1a5	Mouse	1-Hydroxypyrene	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of 1-hydroxypyrene	CTD	PMID:15802387
Ugt1a5	Mouse	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of UGT1A5 mRNA	CTD	PMID:39298647
Ugt1a5	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases activity	ISO	UGT1A4 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased activity of UGT1A4 protein	CTD	PMID:16155002
Ugt1a5	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of UGT1A5 mRNA	CTD	PMID:26377647
Ugt1a5	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with AHR protein mutant form] results in decreased expression of UGT1A5 mRNA and NFE2L2 protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of UGT1A5 mRNA]	CTD	PMID:19474220 and PMID:22496397
Ugt1a5	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of UGT1A5 mRNA	CTD	PMID:19474220
Ugt1a5	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects response to substance	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 promoter SNP affects the susceptibility to Tetrachlorodibenzodioxin	CTD	PMID:18433817
Ugt1a5	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of UGT1A4 mRNA and Tetrachlorodibenzodioxin results in increased expression of UGT1A4 protein	CTD	PMID:16155002 and PMID:18433817
Ugt1a5	Mouse	20-HETE	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of 20-hydroxy-5 more ...	CTD	PMID:15231852
Ugt1a5	Mouse	3-methylcholanthrene	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Methylcholanthrene results in increased expression of UGT1A4 mRNA	CTD	PMID:19118567
Ugt1a5	Mouse	4,4'-sulfonyldiphenol	affects expression	EXP		6480464	bisphenol S affects the expression of UGT1A5 mRNA	CTD	PMID:39298647
Ugt1a5	Mouse	4,4'-sulfonyldiphenol	affects methylation	EXP		6480464	bisphenol S affects the methylation of UGT1A5 gene	CTD	PMID:31683443
Ugt1a5	Mouse	4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 gene polymorphism results in increased glucuronidation of 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone and UGT1A4 protein results in increased glucuronidation of 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone	CTD	PMID:14871856 and PMID:31307193
Ugt1a5	Mouse	4-hydroxyphenytoin	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of and results in decreased activity of hydroxyphenytoin	CTD	PMID:15855726
Ugt1a5	Mouse	5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Omeprazole results in increased expression of UGT1A4 mRNA	CTD	PMID:19118567
Ugt1a5	Mouse	Afloqualone	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of afloqualone	CTD	PMID:15475412
Ugt1a5	Mouse	Afloqualone	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	Trifluoperazine inhibits the reaction [UGT1A4 protein results in increased glucuronidation of afloqualone]	CTD	PMID:15475412
Ugt1a5	Mouse	amentoflavone	decreases activity	ISO	UGT1A4 (Homo sapiens)	6480464	amentoflavone results in decreased activity of UGT1A4 protein	CTD	PMID:29470958
Ugt1a5	Mouse	amphibole asbestos	decreases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Asbestos and Amphibole results in decreased expression of UGT1A4 protein	CTD	PMID:20855422
Ugt1a5	Mouse	androsterone	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein SNP results in increased glucuronidation of Androsterone analog	CTD	PMID:15708967
Ugt1a5	Mouse	arachidonic acid	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Arachidonic Acid	CTD	PMID:15231852
Ugt1a5	Mouse	Aroclor 1254	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Chlorodiphenyl (54% Chlorine) results in increased expression of UGT1A4 mRNA	CTD	PMID:17851650
Ugt1a5	Mouse	benzo[a]pyrene	increases activity	ISO	UGT1A4 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased activity of UGT1A4 protein	CTD	PMID:17065433
Ugt1a5	Mouse	benzo[a]pyrene	decreases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of UGT1A4 mRNA	CTD	PMID:32234424
Ugt1a5	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of UGT1A5 mRNA	CTD	PMID:20127859 and PMID:32417428
Ugt1a5	Mouse	benzo[a]pyrene	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	Benzo(a)pyrene promotes the reaction [Butyric Acid results in increased expression of UGT1A4 mRNA]	CTD	PMID:30439556
Ugt1a5	Mouse	benzo[a]pyrene	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of UGT1A4 mRNA	CTD	PMID:30439556
Ugt1a5	Mouse	beta-naphthoflavone	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	beta-Naphthoflavone results in increased expression of UGT1A4 mRNA	CTD	PMID:19118567
Ugt1a5	Mouse	beta-naphthoflavone	increases expression	EXP		6480464	beta-Naphthoflavone results in increased expression of UGT1A5 mRNA	CTD	PMID:19144771
Ugt1a5	Mouse	betulin	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of betulin	CTD	PMID:30776358
Ugt1a5	Mouse	biphenyl-4-amine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of 4-biphenylamine	CTD	PMID:15840509
Ugt1a5	Mouse	biphenyl-4-amine	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[Alamethicin results in increased activity of UGT1A4 protein] which results in increased glucuronidation of 4-biphenylamine more ...	CTD	PMID:17080401
Ugt1a5	Mouse	bisphenol A	decreases expression	ISO	UGT1A4 (Homo sapiens)	6480464	bisphenol A results in decreased expression of UGT1A4 mRNA	CTD	PMID:24214726
Ugt1a5	Mouse	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of UGT1A5 mRNA	CTD	PMID:38685157
Ugt1a5	Mouse	buta-1,3-diene	increases expression	EXP		6480464	1 and 3-butadiene results in increased expression of UGT1A5 mRNA	CTD	PMID:29038090
Ugt1a5	Mouse	butyric acid	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	Benzo(a)pyrene promotes the reaction [Butyric Acid results in increased expression of UGT1A4 mRNA]	CTD	PMID:30439556
Ugt1a5	Mouse	butyric acid	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Butyric Acid results in increased expression of UGT1A4 mRNA	CTD	PMID:30439556
Ugt1a5	Mouse	captan	increases expression	EXP		6480464	Captan results in increased expression of UGT1A5 mRNA	CTD	PMID:31558096
Ugt1a5	Mouse	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of UGT1A5 mRNA	CTD	PMID:22496397
Ugt1a5	Mouse	clozapine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein SNP results in increased glucuronidation of Clozapine	CTD	PMID:15708967
Ugt1a5	Mouse	dibenzo[a,l]pyrene	increases glycosylation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glycosylation of dibenzo(a and l)pyrene	CTD	PMID:21780761
Ugt1a5	Mouse	dichloroacetic acid	increases expression	EXP		6480464	Dichloroacetic Acid results in increased expression of UGT1A5 mRNA	CTD	PMID:28962523
Ugt1a5	Mouse	diclofenac	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Diclofenac	CTD	PMID:15843492
Ugt1a5	Mouse	dimethylarsinic acid	multiple interactions	EXP		6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of UGT1A5 mRNA	CTD	PMID:34876320
Ugt1a5	Mouse	ethanol	increases expression	EXP		6480464	Ethanol results in increased expression of UGT1A5 mRNA	CTD	PMID:21955143
Ugt1a5	Mouse	ethoxyquin	increases expression	EXP		6480464	Ethoxyquin results in increased expression of UGT1A5 mRNA	CTD	PMID:19144771
Ugt1a5	Mouse	farnesol	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Farnesol	CTD	PMID:15320866
Ugt1a5	Mouse	fenthion	increases expression	EXP		6480464	Fenthion results in increased expression of UGT1A5 mRNA	CTD	PMID:34813904
Ugt1a5	Mouse	finasteride	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	Finasteride inhibits the reaction [UGT1A4 protein results in increased glucuronidation of Imipramine] and Finasteride inhibits the reaction [UGT1A4 protein results in increased glucuronidation of Trifluoperazine]	CTD	PMID:25448279
Ugt1a5	Mouse	flurbiprofen	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Flurbiprofen	CTD	PMID:15843492
Ugt1a5	Mouse	folpet	increases expression	EXP		6480464	folpet results in increased expression of UGT1A5 mRNA	CTD	PMID:31558096
Ugt1a5	Mouse	Hecogenin	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[hecogenin results in decreased activity of UGT1A4 protein] which results in decreased glycosylation of senecionine more ...	CTD	PMID:17080401 more ...
Ugt1a5	Mouse	imipramine	affects metabolic processing	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein affects the metabolism of Imipramine	CTD	PMID:15286053
Ugt1a5	Mouse	imipramine	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	Finasteride inhibits the reaction [UGT1A4 protein results in increased glucuronidation of Imipramine]	CTD	PMID:25448279
Ugt1a5	Mouse	imipramine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Imipramine and UGT1A4 protein SNP results in increased glucuronidation of Imipramine	CTD	PMID:14570768 more ...
Ugt1a5	Mouse	indometacin	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Indomethacin	CTD	PMID:15843492
Ugt1a5	Mouse	inulin	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of UGT1A5 mRNA	CTD	PMID:36331819
Ugt1a5	Mouse	ketoprofen	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Ketoprofen	CTD	PMID:15843492
Ugt1a5	Mouse	lamotrigine	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[Phenobarbital results in increased activity of UGT1A4 protein] which results in increased glucuronidation of lamotrigine more ...	CTD	PMID:19845433
Ugt1a5	Mouse	lamotrigine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of lamotrigine	CTD	PMID:17151188 and PMID:19845433
Ugt1a5	Mouse	Licochalcone A	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	licochalcone A inhibits the reaction [Trifluoperazine results in increased activity of UGT1A4 protein]	CTD	PMID:26875642
Ugt1a5	Mouse	lipopolysaccharide	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[usnic acid co-treated with Lipopolysaccharides] results in increased expression of UGT1A4 mRNA	CTD	PMID:22777745
Ugt1a5	Mouse	methotrexate	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Methotrexate results in increased expression of UGT1A4 mRNA	CTD	PMID:20854796
Ugt1a5	Mouse	methylarsonic acid	multiple interactions	EXP		6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of UGT1A5 mRNA	CTD	PMID:34876320
Ugt1a5	Mouse	morphine	increases expression	EXP		6480464	Morphine results in increased expression of UGT1A5 mRNA	CTD	PMID:21955143
Ugt1a5	Mouse	N'-Nitrosoanabasine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of N'-nitrosoanabasine	CTD	PMID:18238858
Ugt1a5	Mouse	N'-Nitrosoanatabine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of N'-nitrosoanatabine	CTD	PMID:18238858
Ugt1a5	Mouse	N'-Nitrosonornicotine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of N'-nitrosonornicotine	CTD	PMID:18238858
Ugt1a5	Mouse	N-hydroxy-PhIP	increases metabolic processing	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased metabolism of 2-hydroxyamino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine	CTD	PMID:15986396
Ugt1a5	Mouse	N-hydroxy-PhIP	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein promotes the reaction [2-hydroxyamino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine binds to Glucuronides]	CTD	PMID:15986396
Ugt1a5	Mouse	N-hydroxy-PhIP	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of 2-hydroxyamino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine	CTD	PMID:15310245
Ugt1a5	Mouse	N-Nitrosopyrrolidine	decreases expression	ISO	UGT1A4 (Homo sapiens)	6480464	N-Nitrosopyrrolidine results in decreased expression of UGT1A4 mRNA	CTD	PMID:32234424
Ugt1a5	Mouse	nicotine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Nicotine	CTD	PMID:14570768 and PMID:16141602
Ugt1a5	Mouse	nicotine	decreases expression	EXP		6480464	Nicotine results in decreased expression of UGT1A5 mRNA	CTD	PMID:21955143
Ugt1a5	Mouse	Nor-9-carboxy-delta9-THC	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of UGT1A4 gene	CTD	PMID:30521419
Ugt1a5	Mouse	obeticholic acid	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of obeticholic acid	CTD	PMID:31299240
Ugt1a5	Mouse	obeticholic acid	decreases expression	ISO	UGT1A4 (Homo sapiens)	6480464	obeticholic acid results in decreased expression of UGT1A4 mRNA	CTD	PMID:27939613
Ugt1a5	Mouse	oltipraz	increases expression	EXP		6480464	oltipraz results in increased expression of UGT1A5 mRNA	CTD	PMID:19144771
Ugt1a5	Mouse	omeprazole	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Omeprazole results in increased expression of UGT1A4 mRNA	CTD	PMID:19118567
Ugt1a5	Mouse	perfluorodecanoic acid	multiple interactions	EXP		6480464	PPARA protein affects the reaction [perfluorodecanoic acid results in increased expression of UGT1A5 mRNA]	CTD	PMID:27344344
Ugt1a5	Mouse	perfluorodecanoic acid	increases expression	EXP		6480464	perfluorodecanoic acid results in increased expression of UGT1A5 mRNA	CTD	PMID:27344344
Ugt1a5	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of UGT1A5 mRNA	CTD	PMID:36331819
Ugt1a5	Mouse	phenobarbital	increases activity	ISO	UGT1A4 (Homo sapiens)	6480464	Phenobarbital results in increased activity of UGT1A4 protein	CTD	PMID:19845433
Ugt1a5	Mouse	phenobarbital	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[Phenobarbital results in increased activity of UGT1A4 protein] which results in increased glucuronidation of lamotrigine	CTD	PMID:19845433
Ugt1a5	Mouse	pirinixic acid	increases activity	ISO	UGT1A4 (Homo sapiens)	6480464	pirinixic acid results in increased activity of UGT1A4 protein	CTD	PMID:19845433
Ugt1a5	Mouse	pirinixic acid	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[pirinixic acid results in increased activity of UGT1A4 protein] which results in increased glucuronidation of lamotrigine	CTD	PMID:19845433
Ugt1a5	Mouse	pirinixic acid	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	pirinixic acid results in increased expression of UGT1A4 mRNA and pirinixic acid results in increased expression of UGT1A4 protein	CTD	PMID:17151188
Ugt1a5	Mouse	pregnenolone 16alpha-carbonitrile	increases activity	ISO	UGT1A4 (Homo sapiens)	6480464	Pregnenolone Carbonitrile results in increased activity of UGT1A4 protein	CTD	PMID:16155002 and PMID:19845433
Ugt1a5	Mouse	pregnenolone 16alpha-carbonitrile	multiple interactions	EXP		6480464	[Pregnenolone Carbonitrile results in increased activity of NR1I2 protein] which results in increased expression of UGT1A5 mRNA	CTD	PMID:22496397
Ugt1a5	Mouse	pregnenolone 16alpha-carbonitrile	increases expression	EXP		6480464	Pregnenolone Carbonitrile results in increased expression of UGT1A5 mRNA	CTD	PMID:22496397
Ugt1a5	Mouse	pregnenolone 16alpha-carbonitrile	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[Pregnenolone Carbonitrile results in increased activity of UGT1A4 protein] which results in increased glucuronidation of lamotrigine	CTD	PMID:19845433
Ugt1a5	Mouse	pregnenolone 16alpha-carbonitrile	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Pregnenolone Carbonitrile results in increased expression of UGT1A4 mRNA and Pregnenolone Carbonitrile results in increased expression of UGT1A4 protein	CTD	PMID:16155002
Ugt1a5	Mouse	sarpogrelate	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of sarpogrelate metabolite	CTD	PMID:23704698
Ugt1a5	Mouse	senecionine	increases glycosylation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glycosylation of senecionine	CTD	PMID:20092275
Ugt1a5	Mouse	senecionine	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[hecogenin results in decreased activity of UGT1A4 protein] which results in decreased glycosylation of senecionine	CTD	PMID:20092275
Ugt1a5	Mouse	sodium arsenate	multiple interactions	EXP		6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of UGT1A5 mRNA	CTD	PMID:34876320
Ugt1a5	Mouse	sodium arsenite	multiple interactions	EXP		6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of UGT1A5 mRNA	CTD	PMID:34876320
Ugt1a5	Mouse	spironolactone	increases expression	EXP		6480464	Spironolactone results in increased expression of UGT1A5 mRNA	CTD	PMID:19144771
Ugt1a5	Mouse	sulindac	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Sulindac	CTD	PMID:15843492
Ugt1a5	Mouse	sulindac sulfone	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of sulindac sulfone	CTD	PMID:15843492
Ugt1a5	Mouse	tamoxifen	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Tamoxifen	CTD	PMID:15135306
Ugt1a5	Mouse	triclocarban	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	NR1I3 gene mutant form inhibits the reaction [triclocarban results in increased expression of UGT1A4 mRNA]	CTD	PMID:22761658
Ugt1a5	Mouse	triclocarban	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	triclocarban results in increased expression of UGT1A4 mRNA	CTD	PMID:22761658
Ugt1a5	Mouse	triclosan	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Triclosan	CTD	PMID:30776358
Ugt1a5	Mouse	trifluoperazine	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	Finasteride inhibits the reaction [UGT1A4 protein results in increased glucuronidation of Trifluoperazine] more ...	CTD	PMID:15475412 more ...
Ugt1a5	Mouse	trifluoperazine	increases activity	ISO	UGT1A4 (Homo sapiens)	6480464	Trifluoperazine results in increased activity of UGT1A4 protein	CTD	PMID:26875642
Ugt1a5	Mouse	trifluoperazine	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Trifluoperazine	CTD	PMID:15135306 more ...
Ugt1a5	Mouse	Triptolide	decreases expression	EXP		6480464	triptolide results in decreased expression of UGT1A5 mRNA	CTD	PMID:32835833
Ugt1a5	Mouse	troglitazone	decreases expression	ISO	UGT1A4 (Homo sapiens)	6480464	troglitazone results in decreased expression of UGT1A4 mRNA	CTD	PMID:19631733
Ugt1a5	Mouse	troglitazone	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	troglitazone results in increased expression of UGT1A4 mRNA	CTD	PMID:19631733
Ugt1a5	Mouse	ursodeoxycholic acid	increases glucuronidation	ISO	UGT1A4 (Homo sapiens)	6480464	UGT1A4 protein results in increased glucuronidation of Ursodeoxycholic Acid	CTD	PMID:31299240
Ugt1a5	Mouse	usnic acid	multiple interactions	ISO	UGT1A4 (Homo sapiens)	6480464	[usnic acid co-treated with Lipopolysaccharides] results in increased expression of UGT1A4 mRNA	CTD	PMID:22777745
Ugt1a5	Mouse	usnic acid	increases expression	ISO	UGT1A4 (Homo sapiens)	6480464	usnic acid results in increased expression of UGT1A4 mRNA	CTD	PMID:21953288 and PMID:22777745
Ugt1a5	Mouse	valproic acid	decreases methylation	ISO	UGT1A4 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of UGT1A4 gene	CTD	PMID:29154799
Ugt1a5	Mouse	valproic acid	decreases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of UGT1A4 mRNA	CTD	PMID:29501571
Ugt1a5	Mouse	zinc molecular entity	decreases expression	ISO	UGT1A4 (Homo sapiens)	6480464	Zinc Compounds results in decreased expression of UGT1A4 mRNA	CTD	PMID:24035972

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ugt1a5	Mouse	cellular response to ethanol		ISO	Ugt1a5 (Rattus norvegicus)	9068941		RGD	PMID:11412396 and REF_RGD_ID:2317026
Ugt1a5	Mouse	cellular response to glucocorticoid stimulus		ISO	Ugt1a5 (Rattus norvegicus)	9068941		RGD	PMID:10100302 and REF_RGD_ID:2317062
Ugt1a5	Mouse	cellular response to hormone stimulus		ISO	Ugt1a5 (Rattus norvegicus)	9068941	triiodothyronine T3	RGD	PMID:10100302 and REF_RGD_ID:2317062
Ugt1a5	Mouse	liver development		ISO	Ugt1a5 (Rattus norvegicus)	9068941		RGD	PMID:18938141 and REF_RGD_ID:2317023
Ugt1a5	Mouse	vitamin D3 metabolic process	involved_in	ISO	UGT1A4 (Homo sapiens)	9068941	PMID:18177842 and PMID:24641623	UniProt	PMID:18177842 and PMID:24641623

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ugt1a5	Mouse	endoplasmic reticulum	is_active_in	IBA	PANTHER:PTN002630028 more ...	2290270		GO_Central	GO_REF:0000033
Ugt1a5	Mouse	endoplasmic reticulum	located_in	ISO	UniProtKB:P22310	2290270		GO_Central	GO_REF:0000119

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ugt1a5	Mouse	enzyme binding	enables	ISO	UniProtKB:P22310	2290270		GO_Central	GO_REF:0000119
Ugt1a5	Mouse	enzyme binding	enables	IBA	PANTHER:PTN002630028 more ...	2290270		GO_Central	GO_REF:0000033
Ugt1a5	Mouse	glucuronosyltransferase activity	enables	ISO	UniProtKB:P22310	2290270		GO_Central	GO_REF:0000119
Ugt1a5	Mouse	protein heterodimerization activity	enables	ISO	UniProtKB:P22310	2290270		GO_Central	GO_REF:0000119
Ugt1a5	Mouse	protein homodimerization activity	enables	ISO	UniProtKB:P22310	2290270		GO_Central	GO_REF:0000119
Ugt1a5	Mouse	retinoic acid binding	NOT\|enables	ISO	UGT1A4 (Homo sapiens)	9068941	PMID:20308471	BHF-UCL	PMID:20308471

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ugt1a5	Mouse	nicotine pharmacodynamics pathway		ISO	UGT1A4 (Homo sapiens)	10402751		SMPDB	SMP:00431
Ugt1a5	Mouse	nicotine pharmacokinetics pathway		ISO	UGT1A4 (Homo sapiens)	10402751		SMPDB	SMP:00628
Ugt1a5	Mouse	phenytoin pharmacodynamics pathway		ISO	UGT1A4 (Homo sapiens)	10402751		SMPDB	SMP:00327
Ugt1a5	Mouse	tamoxifen pharmacodynamics pathway		ISO	UGT1A4 (Homo sapiens)	10402751		SMPDB	SMP:00471
Ugt1a5	Mouse	tamoxifen pharmacokinetics pathway		ISO	UGT1A4 (Homo sapiens)	10402751		SMPDB	SMP:00606

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ugt1a5	Mouse	ascorbate and aldarate metabolic pathway		IEA		6907045		KEGG	mmu:00053
Ugt1a5	Mouse	O-linked glycan biosynthetic pathway		IEA		6907045		KEGG	mmu:00514
Ugt1a5	Mouse	pentose and glucuronate interconversion pathway		IEA		6907045		KEGG	mmu:00040
Ugt1a5	Mouse	porphyrin and chlorophyll metabolic pathway		IEA		6907045		KEGG	mmu:00860
Ugt1a5	Mouse	retinol metabolic pathway		IEA		6907045		KEGG	mmu:00830
Ugt1a5	Mouse	starch and sucrose metabolic pathway		IEA		6907045		KEGG	mmu:00500
Ugt1a5	Mouse	steroid hormone biosynthetic pathway		IEA		6907045		KEGG	mmu:00140

#	Reference Title	Reference Citation
1.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
2.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:14672974	PMID:14681479	PMID:15052633	PMID:21267068	PMID:21873635

Ugt1a5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	88,093,734 - 88,147,724 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	88,093,734 - 88,146,719 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	88,166,012 - 88,220,002 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	88,166,012 - 88,218,997 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	90,062,587 - 90,116,577 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	89,997,183 - 90,050,148 (+)	NCBI		MGSCv36	mm8
Celera	1	91,126,155 - 91,181,062 (+)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	44.53	NCBI

UGT1A4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	233,718,736 - 233,773,300 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	233,718,736 - 233,773,300 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	234,627,382 - 234,681,946 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	234,292,177 - 234,346,684 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	234,409,437 - 234,463,945	NCBI
Celera	2	228,348,057 - 228,402,577 (+)	NCBI		Celera
Cytogenetic Map	2	q37.1	NCBI
HuRef	2	226,427,432 - 226,481,779 (+)	NCBI		HuRef
CHM1_1	2	234,633,252 - 234,682,899 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	234,207,385 - 234,261,929 (+)	NCBI		T2T-CHM13v2.0

Ugt1a5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	96,210,053 - 96,256,264 (+)	NCBI		GRCr8
mRatBN7.2	9	88,762,250 - 88,808,465 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	88,713,184 - 88,808,465 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	97,186,086 - 97,232,360 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	102,322,282 - 102,368,552 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	100,690,441 - 100,736,659 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	95,256,628 - 95,302,822 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	95,161,157 - 95,302,822 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	94,943,844 - 94,990,037 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	87,052,169 - 87,098,362 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	86,323,550 - 86,369,556 (+)	NCBI		Celera
Cytogenetic Map	9	q35	NCBI

Variants in Ugt1a5
2802 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	185
Count of miRNA genes:	167
Interacting mature miRNAs:	173
Transcripts:	ENSMUST00000097659
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
11039528	Ccc3_m	colitis susceptibility in the Collaborative Cross 3 (mouse)					1	3680142	195051546	Mouse
1357847	Jckm2_m	juvenile cystic kidney modifier 2 (mouse)			Not determined		1	74991977	133290937	Mouse
4142394	Mssq1_m	mandible size and shape QTL 1 (mouse)			Not determined			73615692	107615830	Mouse
10412185	Hcs9_m	hepatocarcinogenesis susceptibility 9 (mouse)			Not determined		1	63854690	189303617	Mouse
1558928	Mord2_m	modifier of retinal degeneration 2 (mouse)			Not determined		1	77123115	110536075	Mouse
25394564	Skmw49_m	skeletal muscle weight 49, TA (mouse)					1	83420119	88552630	Mouse
13824984	Twq5_m	testis weight QTL 5 (mouse)					1	3069992	184732197	Mouse
14697706	Stsl3a_m	Salmonella typhimurium susceptibility locus 3a (mouse)					1	77476637	95827725	Mouse
12790991	Aath1_m	aortic arch atherosclerosis 1 (mouse)					1	86483929	120483929	Mouse
1357721	Sle17_m	systematic lupus erythematosus susceptibility 17 (mouse)			Not determined		1	39132808	126445310	Mouse
1302146	Cocrb1_m	cocaine related behavior 1 (mouse)			Not determined		1	70133533	104139557	Mouse
14696692	Tavq1_m	total attack value QTL 1 (mouse)					1	81977715	88427722	Mouse
14696693	Avd2q1_m	attack value day 2 QTL 1 (mouse)					1	78977717	90927722	Mouse
14746998	Mancz1_m	mandible centroid size 1 (mouse)					1	57941351	91941351	Mouse
1300746	Skl1_m	skeletal size (tail length) 1 (mouse)			Not determined		1	57991977	91992080	Mouse
12791004	Aath7_m	aortic arch atherosclerosis 7 (mouse)					1	82832635	116832635	Mouse
4141725	Wbcq4_m	white blood cell quantitative locus 4 (mouse)			Not determined		1	79858683	113858791	Mouse
12050069	Nabq1_m	nasal bone morphology QTL 1 (mouse)					1	79858683	113858791	Mouse
1357488	Splq3_m	spleen weight QTL 3 (mouse)			Not determined		1	34760138	150193871	Mouse
13452395	Leusq2_m	leucocytosis susceptibility QTL 2 (mouse)					1	80245593	126386517	Mouse
1558717	Ses1a_m	salmonella enteritidis susceptibility 1a (mouse)			Not determined		1	56726922	90727077	Mouse
1301304	Hrq3_m	heart rate quantitative locus 3 (mouse)			Not determined		1	73615692	107615830	Mouse
1357753	Kidq2_m	kidney weight QTL 2 (mouse)			Not determined		1	34760138	150193871	Mouse
1301667	Lxw5_m	lupus BXSB x NZW 5 (mouse)			Not determined		1	58549191	92549443	Mouse
11667074	Led2_m	late embryonic death 2 (mouse)					1	85696027	117195081	Mouse
1357741	Nidd5k_m	Nidd5 on KK-A<y> (mouse)			Not determined		1	55974948	89975057	Mouse
1301162	Skull1_m	skull morphology 1 (mouse)			Not determined		1	57991977	91992080	Mouse
4142467	Wbcq1_m	white blood cell quantitative locus 1 (mouse)			Not determined		1	56266214	90266360	Mouse
1301933	Insq6_m	insulin QTL 6 (mouse)			Not determined		1	56726922	90727077	Mouse
1300821	Lore1_m	loss of righting induced by ethanol 1 (mouse)			Not determined		1	75549191	92941077	Mouse
1301722	Cia9_m	collagen induced arthritis QTL 9 (mouse)			Not determined		1	45783900	189303617	Mouse
10412238	Alpq5_m	alcohol preference QTL 5 (mouse)			Not determined		1	82832635	116832635	Mouse
1357505	Vtbt1_m	vertebral trabecular bone trait 1 (mouse)			Not determined		1	56266214	90266360	Mouse
1301444	Alcw5_m	alcohol withdrawal 5 (mouse)			Not determined		1	58549191	92549443	Mouse
1558860	W10q7_m	weight 10 weeks QTL 7 (mouse)			Not determined		1	34760138	150193871	Mouse
14747009	Manh49_m	mandible shape 49 (mouse)					1	57941351	91941351	Mouse
1300976	Bmd19_m	bone mineral density 19 (mouse)			Not determined		1	73266214	108838414	Mouse
4141914	Gcsfis_m	G-CSF induced splenomegaly (mouse)			Not determined			74516235	148715579	Mouse
27095928	Pglq6_m	pelvic girdle length QTL 6, 10 week (mouse)					1	75976637	148775742	Mouse
27095931	Pglq1_m	pelvic girdle length QTL 1, 5 week (mouse)					1	75976637	128527737	Mouse
1301748	Abbp1_m	A/J and C57BL/6 blood pressure 1 (mouse)			Not determined		1	62946755	120529678	Mouse
1357439	Popoa_m	premature ovulation and primary oocyte arrest (mouse)			Not determined		1	82643189	135615379	Mouse
4142291	Aec2_m	autoimmune exocrinopathy 2 (mouse)			Not determined			52457737	182250592	Mouse
1300989	Lrdg1_m	light induced retinal degeneration 1 (mouse)			Not determined		1	73755175	147125370	Mouse
27095918	Ulnl1_m	ulna length 1, 5 week (mouse)					1	67339159	129727737	Mouse
1302119	Cia15_m	collagen induced arthritis 15 (mouse)			Not determined		1	65889006	88496101	Mouse
1301350	Nidd4k_m	Nidd4 on KK-A (mouse)			Not determined		7	82291982	147125370	Mouse
1300841	Ssial1_m	susceptibility to sialadenitis 1 (mouse)			Not determined		1	63920002	153557562	Mouse
26884448	Sklq1_m	skull length QTL 1, 5 week (mouse)					1	75976637	181327565	Mouse
1357679	Egrm1_m	early growth rate, maternal effect 1 (mouse)			Not determined		1	57991977	91992080	Mouse

PMC153064P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	1	88,201,037 - 88,201,490	UniSTS	GRCm38
MGSCv37	1	90,097,612 - 90,098,065	UniSTS	GRCm37
Celera	1	91,162,107 - 91,162,560	UniSTS
Cytogenetic Map	1	D	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_201643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB094481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC087780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC087801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY227196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC139093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC139094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000097659 ⟹ ENSMUSP00000095263

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	1	88,093,734 - 88,146,719 (+)	Ensembl
GRCm38.p6 Ensembl	1	88,166,012 - 88,218,997 (+)	Ensembl

RefSeq Acc Id:

NM_201643 ⟹ NP_964005

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	1	88,093,734 - 88,147,724 (+)	NCBI
GRCm38	1	88,166,012 - 88,220,002 (+)	ENTREZGENE
MGSCv37	1	90,062,587 - 90,116,577 (+)	RGD
Celera	1	91,126,155 - 91,181,062 (+)	RGD
cM Map	1		ENTREZGENE

Sequence:

show sequence

TGAGGAAACCTGACTCTTCTGCGCATCCACTGAAGTGACTATGGGACTCCGCATGCCCCTACAAGGATTAGTGGGGCTGCTCCTGCTGTGTGCCCTGCCTTGGACTGAAGGTGAGAAGGTGCTAGTGT
TTCCTGTGGGGGGAAGCCACTGGCTGAGCATGAGGGATGTTGTGAGAGAGCTCCACGCCCAAGGTCACCAGACTGTGGTCCTGGCTCCAGAGGTGAACATGCGCATCAAAGAAGAGGACTTTTTCACT
TTCAAAGTCTATGCCGTTCCCTATACAAGACAAGAATTGGAAGAAATGATGGAAAACCTTAAAGTGTTTTTTGACACAGGAAACTATATGAAGAAAATCTTTAAAACATCTGAGGCTTTGAGAAACAT
GTCAACCGTTCTCTTAAAGACTTGTACAAATATATTGCACAACGAGTCCCTGCTCCACCACCTGAATTCCAGCTCCTTTGATGTAGTCTTTACAGATCCCGTGTTTCCCTGTGGGGCATTGTTGGCCA
AGTACTTAGGTATTCCTGCTGTGTTCTTTCTACGATACATCCCCTGTGGCATAGAATATGAGGCCACACAGTGTCCAAGCCCTTCCTCTTATATTCCGAACCTATTCACAAGGCTTTCCGACCACATG
GACTTCCTGCAAAGGGTCCAGAACATGCTGTACCATCTGGTCTTGAAGTACATTTGCCATTTATTGATCACTCCCTATGAAAGCCTGGCCTCTGAGCTTTTTCAGAGAGAAGTGTCCTCAGTGGAGCT
TTTCAGCTATGCATCCGTGTGGCTGTTCCGAGGGGACTTTGTACTCGACTACCCCAGGCCCATCATGCCTAACATGGTCTTCATTGGGGGCATAAACTGTGTTACCAAGAAGCCCCTCTCTCAGGAAT
TTGAAGCCTATGTCAACGCCTCTGGGGAGCATGGCATCGTTGTTTTCTCTTTGGGATCCATGGTCTCAGAGATTCCGGAGAAGAAAGCCATGGAAATTGCTGAGGCTTTGGGCAGAATTCCTCAGACG
GTCCTGTGGCGCTACACCGGAACTAGACCATCGAATCTTGCAAAGAACACAATTCTTGTCAAATGGCTACCCCAAAATGATCTGCTTGGTCATCCAAAGACTCGGGCATTCATCACACACTCTGGCTC
CCATGGTATTTATGAAGGAATATGCAATGGAGTTCCGATGGTGATGATGCCCCTATTTGGCGATCAGATGGACAATGCCAAGCGCATGGAAACTCGGGGAGCTGGGGTGACCCTGAATGTCCTTGAAA
TGACTGCTGATGATTTGGAAAATGCCCTTAAAACTGTCATCAACAACAAGAGCTACAAGGAGAACATCATGCGCCTCTCCAGCCTTCACAAGGACCGTCCTATAGAGCCTCTGGACCTGGCTGTGTTC
TGGGTGGAATACGTGATGAGGCACAAGGGGGCACCACACCTGCGCCCGGCCGCCCATGACCTCACCTGGTATCAGTACCACTCCTTGGATGTGATTGGCTTCCTCCTGGCCATTGTGTTGACAGTGGT
CTTCATTGTCTTTAAATGTTGTGCCTATGGCTGCCGGAAATGCTTTGGGGGAAAGGGGCGAGTGAAGAAATCACACAAATCCAAGACCCATTGAGAAGTGGGGGGAAGTGAAGGAGAAGTATTAGTTC
ATTATCTGATCAGTTGAAACTTGGAAACAAGTGTTAAATCCATATTGTTTTTGTTAGGGAAATAATTCACCATACATTATACATTCAGCACATTTAAAAATAATAATAATAACAATCTAATTGCTGGC
CACACCCATCAGGGAAGGTTCTAGTATATGTGATGTGCTTTTCCAGTATCTTCAGTCTAGACAACTCTTGCCATCTGTTGGTAATTTACAGAAAGTCTGGCACTCTGCTTTCAGTGACAGCCCCACAG
TTTCCCCTGCTCCCGCCAGCTGACGGCTTTCTCCCCTGGATTCTCAGACTGCCGTGGCCTTCTCCAGTGTTAGTCATTCTTCATTGTGTTCATGCATTATGGGTGGCAAGACCTTTGGAGCTTTGGGA
GAAGAGATGAGGCTGTGACACTGATGGCCCTGTGTTTGAGATAATAATTGTTGCTTGTGCCGGAATTTGATGAAAACCAAAGTATGTTCTAAGGCAAGTACATCTTCTATTGTGTTCCCAAACCAAGA
ACTTATCAATAAATTCATATAAATTGTATCACTACTCTTCTTTTCATTGGTGTTATATTTATTTGTTGTCAAAGTATATCCTCTAATTGTAAAAGCACTACATGATCATGATGCAGAACTTGAAAACT
AGAACAGATTCACACAGGTATACATACACACAAGAAAGGAACCAGCTGTAATTACAGTGCTCATGAATAACCATGGCTGCTGCCTAGTTTGATTCTGAGTCTTCCAAAGGTGCATTGGCTGATGGCTT
GCAGCCTTGCTGATGCTCAGCCTGTGATATCACTGGGAAGTTGTGCAACCATTAAGTGGCAGTCTAGTGTGAGAAAGCTAGGTCTCTGGAGGTGTTCCTTTGAAGGAGATACAGGGATAGAGGTACCT
TCTCTTTCTTTGTTCCCATACTATCCTGAAACAAGAAGGTTCCCGGACAGTCTCTTTGAGTATTCTCTTATCTTACACAGGTCCCAAAGCAACATAACCACATGATCAGGGATGAAAAGTCTATAGCT
AGCCCAAAATAAACCTTTGCTCATGAGTTGCTACATCTCAGGTATTTGTTACAGTAACATAAAGTTTATTAACATACCTATTGTTTTGACAAATACACATAAAACATTACAGACATTCTGTATTAGTC
AGTTTTGCATCAGCATAATGAAATAACCAAAGCAAGTAAGTTAAAAGAGAGAAGGGCTGTTTAACTTAGAGGTTATCTTGCTTTGGCTCAGTTCTGTGAGGGTAACAGAAGGTGGCATATCAAACAGG
AGCATGTACATGAACAAACCATGAATTATATCTTGAGGCAGGAACAGGGAGCTAGAGTCTGGGCTGTCACAATCCTCTTTGAGGAAGATCTTTAATGACCTATGGGCATTTTAATAGGCCCTACCTGA
AAAAAAAAGTTTTCCCTGCTTCTCAATAGCACACACTGAAGACCAAGCTTTTATCACATGGCTCTTTGGGGGCATTTCAGATTCAAGCTATATATTCTGACCAAAAGTTCCAAAAGTTCATGTCCATT
TCGCAATT

hide sequence


Protein RefSeqs	NP_964005	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI39094	(Get FASTA)	NCBI Sequence Viewer
	AAI39095	(Get FASTA)	NCBI Sequence Viewer
	AAP48595	(Get FASTA)	NCBI Sequence Viewer
	BAD11305	(Get FASTA)	NCBI Sequence Viewer
	EDL40128	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000095263
	ENSMUSP00000095263.5

RefSeq Acc Id:	NP_964005 ⟸ NM_201643
- Peptide Label:	precursor
- UniProtKB:	B2RT14 (UniProtKB/TrEMBL), Q6XL48 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGLRMPLQGLVGLLLLCALPWTEGEKVLVFPVGGSHWLSMRDVVRELHAQGHQTVVLAPEVNMRIKEEDFFTFKVYAVPYTRQELEEMMENLKVFFDTGNYMKKIFKTSEALRNMSTVLLKTCTNILH NESLLHHLNSSSFDVVFTDPVFPCGALLAKYLGIPAVFFLRYIPCGIEYEATQCPSPSSYIPNLFTRLSDHMDFLQRVQNMLYHLVLKYICHLLITPYESLASELFQREVSSVELFSYASVWLFRGDF VLDYPRPIMPNMVFIGGINCVTKKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPM VMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRK CFGGKGRVKKSHKSKTH hide sequence

Ensembl Acc Id:

ENSMUSP00000095263 ⟸ ENSMUST00000097659

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RT14-F1-model_v2	AlphaFold	B2RT14	1-529	view protein structure

RGD ID:

6818681

Promoter ID:

MM_KWN:1555

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_0Hour, Liver

Transcripts:

NM_201643

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	1	90,062,409 - 90,062,909 (+)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000089943	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000097659	ENTREZGENE
	ENSMUST00000097659.5	UniProtKB/TrEMBL
Gene3D-CATH	Glycogen Phosphorylase B	UniProtKB/TrEMBL
InterPro	UDP-glycosyltransferase	UniProtKB/TrEMBL
	UDP_glucos_trans	UniProtKB/TrEMBL
	UDP_glycos_trans_CS	UniProtKB/TrEMBL
KEGG Report	mmu:394433	UniProtKB/TrEMBL
MGD	MGI:3032634	ENTREZGENE
NCBI Gene	394433	ENTREZGENE
PANTHER	EG:EG0003.4 PROTEIN-RELATED	UniProtKB/TrEMBL
	UDP GLUCURONOSYLTRANSFERASE FAMILY 1 MEMBER A1	UniProtKB/TrEMBL
Pfam	UDPGT	UniProtKB/TrEMBL
PhenoGen	Ugt1a5	PhenoGen
PROSITE	UDPGT	UniProtKB/TrEMBL
Superfamily-SCOP	UDP-Glycosyltransferase/glycogen phosphorylase	UniProtKB/TrEMBL
UniProt	B2RT14	ENTREZGENE, UniProtKB/TrEMBL
	Q6XL48	ENTREZGENE, UniProtKB/TrEMBL
	Q76K67_MOUSE	UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)