Symbol:
DTL
Name:
denticleless E3 ubiquitin protein ligase homolog
RGD ID:
1604818
HGNC Page
HGNC:30288
Description:
Contributes to ubiquitin-protein transferase activity. Involved in several processes, including protein ubiquitination; regulation of G2/M transition of mitotic cell cycle; and translesion synthesis. Located in centrosome; cytosol; and nuclear lumen. Part of Cul4A-RING E3 ubiquitin ligase complex and Cul4B-RING E3 ubiquitin ligase complex.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CDT2; DCAF2; DDB1 and CUL4 associated factor 2; DDB1- and CUL4-associated factor 2; denticleless homolog; denticleless protein homolog; L2DTL; lethal(2) denticleless protein homolog; RA regulated nuclear matrix associated protein; RA-regulated nuclear matrix-associated protein; RAMP; retinoic acid-regulated nuclear matrix-associated protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Dtl (denticleless E3 ubiquitin protein ligase) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Dtl (denticleless E3 ubiquitin protein ligase homolog) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Dtl (denticleless E3 ubiquitin protein ligase homolog) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
DTL (denticleless E3 ubiquitin protein ligase homolog) NCBI
Ortholog
Canis lupus familiaris (dog):
DTL (denticleless E3 ubiquitin protein ligase homolog) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dtl (denticleless E3 ubiquitin protein ligase homolog) NCBI
Ortholog
Sus scrofa (pig):
DTL (denticleless E3 ubiquitin protein ligase homolog) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
DTL (denticleless E3 ubiquitin protein ligase homolog) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Dtl (denticleless E3 ubiquitin protein ligase homolog) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Fam114a1 (family with sequence similarity 114, member A1) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Dtl (denticleless E3 ubiquitin protein ligase homolog)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dtl (denticleless E3 ubiquitin protein ligase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dtl (denticleless E3 ubiquitin protein ligase homolog (Drosophila))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
cdt-2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
l(2)dtl
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
dtl.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
dtl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
dtl.S
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 212,035,748 - 212,105,013 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 212,035,553 - 212,107,400 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 212,209,090 - 212,278,355 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 210,275,754 - 210,344,809 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 185,435,998 - 185,505,287 (+) NCBI Celera Cytogenetic Map 1 q32.3 NCBI HuRef 1 182,885,955 - 182,955,234 (+) NCBI HuRef CHM1_1 1 213,481,305 - 213,550,518 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 211,281,835 - 211,351,118 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
DTL Human (-)-demecolcine decreases expression EXP 6480464 Demecolcine results in decreased expression of DTL mRNA CTD PMID:23649840 DTL Human 1,1-dichloroethene increases expression ISO Dtl (Mus musculus) 6480464 vinylidene chloride results in increased expression of DTL mRNA CTD PMID:26682919 DTL Human 1-naphthyl isothiocyanate increases expression ISO Dtl (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in increased expression of DTL mRNA CTD PMID:30723492 DTL Human 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of DTL mRNA CTD PMID:18936297 DTL Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DTL mRNA CTD PMID:16474171 and PMID:20106945 DTL Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DTL mRNA CTD PMID:21632981 and PMID:21802500 DTL Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Dtl (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DTL mRNA CTD PMID:33387578 DTL Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Dtl (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DTL mRNA CTD PMID:32109520 DTL Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dtl (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DTL mRNA CTD PMID:26377647 DTL Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DTL mRNA CTD PMID:26159488 DTL Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of DTL mRNA CTD PMID:26159488 DTL Human 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DTL mRNA CTD PMID:22574217 DTL Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Dtl (Mus musculus) 6480464 2 more ... CTD PMID:38648751 DTL Human 2-hydroxypropanoic acid increases expression EXP 6480464 Lactic Acid results in increased expression of DTL mRNA CTD PMID:30851411 DTL Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of DTL mRNA CTD PMID:21179406 DTL Human 2-palmitoylglycerol increases expression EXP 6480464 2-palmitoylglycerol results in increased expression of DTL mRNA CTD PMID:37199045 DTL Human 3-methylcholanthrene increases expression ISO Dtl (Mus musculus) 6480464 Methylcholanthrene results in increased expression of DTL mRNA CTD PMID:20713471 DTL Human 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of DTL mRNA CTD PMID:30616060 DTL Human 6-propyl-2-thiouracil decreases expression ISO Dtl (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of DTL mRNA CTD PMID:25825206 DTL Human acrylamide increases expression ISO Dtl (Rattus norvegicus) 6480464 Acrylamide results in increased expression of DTL mRNA CTD PMID:28959563 DTL Human acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of DTL mRNA CTD PMID:32763439 DTL Human aflatoxin B1 affects expression EXP 6480464 Aflatoxin B1 affects the expression of DTL protein CTD PMID:20106945 DTL Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of DTL mRNA CTD PMID:22100608 DTL Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of DTL mRNA CTD PMID:33167477 DTL Human arsenous acid increases sumoylation EXP 6480464 Arsenic Trioxide results in increased sumoylation of DTL protein CTD PMID:28318385 DTL Human atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of DTL mRNA CTD PMID:22378314 DTL Human azathioprine decreases expression EXP 6480464 Azathioprine results in decreased expression of DTL mRNA CTD PMID:22623647 DTL Human bazedoxifene decreases expression EXP 6480464 bazedoxifene results in decreased expression of DTL mRNA CTD PMID:19914376 DTL Human benzo[a]pyrene increases expression ISO Dtl (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of DTL mRNA CTD PMID:20713471 DTL Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of DTL mRNA CTD PMID:32234424 DTL Human benzo[a]pyrene multiple interactions ISO Dtl (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of DTL mRNA CTD PMID:27858113 DTL Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of DTL mRNA CTD PMID:20064835 and PMID:21802500 DTL Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7 more ... CTD PMID:20382639 DTL Human benzo[a]pyrene diol epoxide I increases expression EXP 6480464 7 more ... CTD PMID:26238291 DTL Human benzo[b]fluoranthene increases expression ISO Dtl (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of DTL mRNA CTD PMID:26377693 DTL Human benzo[b]fluoranthene multiple interactions ISO Dtl (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of DTL mRNA CTD PMID:27858113 DTL Human beta-hexachlorocyclohexane decreases expression ISO Dtl (Mus musculus) 6480464 beta-hexachlorocyclohexane results in decreased expression of DTL mRNA CTD PMID:25270620 DTL Human bis(2-ethylhexyl) phthalate increases expression ISO Dtl (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of DTL mRNA CTD PMID:21318169 DTL Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DTL mRNA CTD PMID:16474171 DTL Human bisphenol A increases expression ISO Dtl (Rattus norvegicus) 6480464 bisphenol A results in increased expression of DTL mRNA CTD PMID:32145629 DTL Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DTL mRNA CTD PMID:30903817 DTL Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DTL mRNA CTD PMID:29275510 DTL Human bisphenol A affects expression ISO Dtl (Rattus norvegicus) 6480464 bisphenol A affects the expression of DTL mRNA CTD PMID:25181051 DTL Human cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of DTL mRNA CTD PMID:24376830 DTL Human cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of DTL mRNA CTD PMID:26472689 DTL Human caffeine affects phosphorylation EXP 6480464 Caffeine affects the phosphorylation of DTL protein CTD PMID:35688186 DTL Human calcitriol decreases expression EXP 6480464 Calcitriol results in decreased expression of DTL mRNA CTD PMID:21592394 DTL Human calcitriol multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of DTL mRNA CTD PMID:21592394 DTL Human carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of DTL mRNA CTD PMID:25979313 DTL Human carbon nanotube affects expression ISO Dtl (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of DTL mRNA CTD PMID:25554681 DTL Human carbon nanotube increases expression ISO Dtl (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of DTL mRNA CTD PMID:25554681 DTL Human chlorpyrifos decreases expression ISO Dtl (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of DTL mRNA CTD PMID:37019170 DTL Human chromium(6+) multiple interactions EXP 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of DTL mRNA CTD PMID:38479592 DTL Human chrysene multiple interactions ISO Dtl (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of DTL mRNA CTD PMID:27858113 DTL Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of DTL mRNA CTD PMID:27594783 DTL Human copper atom multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in decreased expression of DTL mRNA CTD PMID:20971185 DTL Human copper(0) multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in decreased expression of DTL mRNA CTD PMID:20971185 DTL Human copper(II) chloride increases expression EXP 6480464 cupric chloride results in increased expression of DTL mRNA CTD PMID:38568856 DTL Human coumarin affects phosphorylation EXP 6480464 coumarin affects the phosphorylation of DTL protein CTD PMID:35688186 DTL Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of DTL mRNA CTD PMID:20106945 and PMID:21632981 DTL Human cyclosporin A affects expression EXP 6480464 Cyclosporine affects the expression of DTL mRNA CTD PMID:25562108 DTL Human DDT decreases methylation ISO Dtl (Rattus norvegicus) 6480464 DDT results in decreased methylation of DTL gene CTD PMID:31682807 DTL Human diarsenic trioxide increases sumoylation EXP 6480464 Arsenic Trioxide results in increased sumoylation of DTL protein CTD PMID:28318385 DTL Human dibutyl phthalate decreases expression ISO Dtl (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of DTL mRNA CTD PMID:17361019 and PMID:21266533 DTL Human dichloroacetic acid increases expression ISO Dtl (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of DTL mRNA CTD PMID:28962523 DTL Human dioxygen decreases expression EXP 6480464 Oxygen deficiency results in decreased expression of DTL mRNA CTD PMID:26516004 DTL Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DTL mRNA CTD PMID:27188386 DTL Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of DTL mRNA CTD PMID:29803840 and PMID:30031762 DTL Human endosulfan multiple interactions EXP 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of DTL mRNA CTD PMID:26159488 DTL Human epoxiconazole increases expression ISO Dtl (Mus musculus) 6480464 epoxiconazole results in increased expression of DTL mRNA CTD PMID:35436446 DTL Human erastin increases expression EXP 6480464 erastin results in increased expression of DTL mRNA alternative form CTD PMID:35234341 DTL Human ethanol increases expression ISO Dtl (Mus musculus) 6480464 Ethanol results in increased expression of DTL mRNA CTD PMID:30319688 DTL Human ethyl methanesulfonate increases expression EXP 6480464 Ethyl Methanesulfonate results in increased expression of DTL mRNA CTD PMID:23649840 DTL Human folic acid decreases expression ISO Dtl (Mus musculus) 6480464 Folic Acid results in decreased expression of DTL mRNA CTD PMID:25629700 DTL Human folpet decreases expression ISO Dtl (Mus musculus) 6480464 folpet results in decreased expression of DTL mRNA CTD PMID:31558096 DTL Human FR900359 affects phosphorylation EXP 6480464 FR900359 affects the phosphorylation of DTL protein CTD PMID:37730182 DTL Human genistein increases expression EXP 6480464 Genistein results in increased expression of DTL mRNA CTD PMID:16474171 DTL Human hexadecanoic acid increases phosphorylation EXP 6480464 Palmitic Acid results in increased phosphorylation of DTL protein CTD PMID:28073184 DTL Human Lasiocarpine increases expression EXP 6480464 lasiocarpine results in increased expression of DTL mRNA CTD PMID:32234424 DTL Human lead(0) affects expression EXP 6480464 Lead affects the expression of DTL mRNA CTD PMID:28903495 DTL Human lidocaine decreases expression ISO Dtl (Rattus norvegicus) 6480464 Lidocaine results in decreased expression of DTL mRNA CTD PMID:35283115 DTL Human lipopolysaccharide multiple interactions EXP 6480464 Plant Extracts affects the reaction [Lipopolysaccharides affects the expression of DTL mRNA] CTD PMID:28070326 DTL Human lipopolysaccharide affects expression EXP 6480464 Lipopolysaccharides affects the expression of DTL mRNA CTD PMID:28070326 DTL Human lucanthone decreases expression EXP 6480464 Lucanthone results in decreased expression of DTL mRNA CTD PMID:21148553 DTL Human methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of DTL mRNA CTD PMID:25290377 DTL Human methyl methanesulfonate increases expression EXP 6480464 Methyl Methanesulfonate results in increased expression of DTL mRNA CTD PMID:23649840 DTL Human methylparaben increases expression EXP 6480464 methylparaben results in increased expression of DTL mRNA CTD PMID:38568856 DTL Human nickel atom increases expression EXP 6480464 Nickel results in increased expression of DTL mRNA CTD PMID:25583101 DTL Human niclosamide decreases expression EXP 6480464 Niclosamide results in decreased expression of DTL mRNA CTD PMID:36318118 DTL Human ozone multiple interactions ISO Dtl (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of DTL mRNA more ... CTD PMID:25658374 more ... DTL Human ozone increases expression ISO Dtl (Mus musculus) 6480464 Ozone results in increased expression of DTL mRNA CTD PMID:33026818 DTL Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of DTL mRNA CTD PMID:22230336 DTL Human paracetamol increases expression ISO Dtl (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of DTL mRNA CTD PMID:33387578 DTL Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of DTL mRNA CTD PMID:26690555 DTL Human phenobarbital increases expression ISO Dtl (Mus musculus) 6480464 Phenobarbital results in increased expression of DTL mRNA CTD PMID:23091169 DTL Human phenylmercury acetate decreases expression EXP 6480464 Phenylmercuric Acetate results in decreased expression of DTL mRNA CTD PMID:26272509 DTL Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DTL mRNA CTD PMID:27188386 DTL Human pirinixic acid multiple interactions ISO Dtl (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of DTL mRNA and PPARA protein affects the reaction [pirinixic acid results in increased expression of DTL mRNA] CTD PMID:20813756 and PMID:21318169 DTL Human pirinixic acid increases expression ISO Dtl (Mus musculus) 6480464 pirinixic acid results in increased expression of DTL mRNA CTD PMID:20813756 and PMID:21318169 DTL Human piroxicam decreases expression EXP 6480464 Piroxicam results in decreased expression of DTL mRNA CTD PMID:21858171 DTL Human pravastatin affects expression ISO Dtl (Mus musculus) 6480464 Pravastatin affects the expression of DTL mRNA CTD PMID:27225895 DTL Human pravastatin decreases expression ISO Dtl (Rattus norvegicus) 6480464 Pravastatin results in decreased expression of DTL mRNA CTD PMID:27225895 DTL Human progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of DTL mRNA CTD PMID:21795739 DTL Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of DTL mRNA CTD PMID:21632981 DTL Human rac-lactic acid increases expression EXP 6480464 Lactic Acid results in increased expression of DTL mRNA CTD PMID:30851411 DTL Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DTL mRNA CTD PMID:27188386 DTL Human senecionine increases expression ISO Dtl (Rattus norvegicus) 6480464 senecionine results in increased expression of DTL mRNA CTD PMID:32419051 DTL Human Senkirkine increases expression ISO Dtl (Rattus norvegicus) 6480464 senkirkine results in increased expression of DTL mRNA CTD PMID:32419051 DTL Human silicon dioxide decreases expression ISO Dtl (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of DTL mRNA CTD PMID:19073995 DTL Human silicon dioxide increases expression ISO Dtl (Mus musculus) 6480464 Silicon Dioxide results in increased expression of DTL mRNA CTD PMID:29341224 DTL Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of DTL mRNA CTD PMID:29301061 and PMID:34032870 DTL Human sodium arsenite decreases expression ISO Dtl (Mus musculus) 6480464 sodium arsenite results in decreased expression of DTL mRNA CTD PMID:37682722 DTL Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of DTL mRNA CTD PMID:38568856 DTL Human succimer multiple interactions ISO Dtl (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of DTL mRNA CTD PMID:21641980 DTL Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of DTL mRNA CTD PMID:31533062 DTL Human testosterone multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of DTL mRNA CTD PMID:21592394 DTL Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of DTL mRNA CTD PMID:21592394 DTL Human tetrachloromethane increases expression ISO Dtl (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DTL mRNA CTD PMID:17484886 DTL Human tetraphene multiple interactions ISO Dtl (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of DTL mRNA CTD PMID:27858113 DTL Human thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of DTL mRNA CTD PMID:22378314 DTL Human thioacetamide increases expression ISO Dtl (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of DTL mRNA CTD PMID:34492290 DTL Human titanium dioxide increases expression ISO Dtl (Mus musculus) 6480464 titanium dioxide results in increased expression of DTL mRNA CTD PMID:23557971 DTL Human titanium dioxide decreases methylation ISO Dtl (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DTL gene CTD PMID:35295148 DTL Human triclosan decreases expression EXP 6480464 Triclosan results in decreased expression of DTL mRNA CTD PMID:30510588 DTL Human trimellitic anhydride increases expression ISO Dtl (Mus musculus) 6480464 trimellitic anhydride results in increased expression of DTL mRNA CTD PMID:19042947 DTL Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of DTL mRNA CTD PMID:37042841 DTL Human triptonide decreases expression ISO Dtl (Mus musculus) 6480464 triptonide results in decreased expression of DTL mRNA CTD PMID:33045310 DTL Human tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of DTL mRNA CTD PMID:22378314 DTL Human tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of DTL mRNA CTD PMID:29453283 DTL Human urethane decreases expression EXP 6480464 Urethane results in decreased expression of DTL mRNA CTD PMID:28818685 DTL Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of DTL gene CTD PMID:29154799 DTL Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of DTL mRNA CTD PMID:23179753 and PMID:27188386 DTL Human vincristine decreases expression EXP 6480464 Vincristine results in decreased expression of DTL mRNA CTD PMID:23649840 DTL Human zaragozic acid A decreases expression ISO Dtl (Rattus norvegicus) 6480464 squalestatin 1 results in decreased expression of DTL mRNA CTD PMID:27225895 DTL Human zaragozic acid A decreases expression ISO Dtl (Mus musculus) 6480464 squalestatin 1 results in decreased expression of DTL mRNA CTD PMID:27225895
(-)-demecolcine (EXP) 1,1-dichloroethene (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-hydroxypropanoic acid (EXP) 2-methylcholine (EXP) 2-palmitoylglycerol (EXP) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) acrylamide (EXP,ISO) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP) arsenous acid (EXP) atrazine (EXP) azathioprine (EXP) bazedoxifene (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) benzo[b]fluoranthene (ISO) beta-hexachlorocyclohexane (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium atom (EXP) cadmium dichloride (EXP) caffeine (EXP) calcitriol (EXP) carbamazepine (EXP) carbon nanotube (ISO) chlorpyrifos (ISO) chromium(6+) (EXP) chrysene (ISO) cisplatin (EXP) copper atom (EXP) copper(0) (EXP) copper(II) chloride (EXP) coumarin (EXP) cyclosporin A (EXP) DDT (ISO) diarsenic trioxide (EXP) dibutyl phthalate (ISO) dichloroacetic acid (ISO) dioxygen (EXP) dorsomorphin (EXP) doxorubicin (EXP) endosulfan (EXP) epoxiconazole (ISO) erastin (EXP) ethanol (ISO) ethyl methanesulfonate (EXP) folic acid (ISO) folpet (ISO) FR900359 (EXP) genistein (EXP) hexadecanoic acid (EXP) Lasiocarpine (EXP) lead(0) (EXP) lidocaine (ISO) lipopolysaccharide (EXP) lucanthone (EXP) methamphetamine (EXP) methyl methanesulfonate (EXP) methylparaben (EXP) nickel atom (EXP) niclosamide (EXP) ozone (ISO) paracetamol (EXP,ISO) phenobarbital (ISO) phenylmercury acetate (EXP) pirinixic acid (ISO) piroxicam (EXP) pravastatin (ISO) progesterone (EXP) quercetin (EXP) rac-lactic acid (EXP) SB 431542 (EXP) senecionine (ISO) Senkirkine (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) succimer (ISO) sunitinib (EXP) testosterone (EXP) tetrachloromethane (ISO) tetraphene (ISO) thapsigargin (EXP) thioacetamide (ISO) titanium dioxide (ISO) triclosan (EXP) trimellitic anhydride (ISO) triphenyl phosphate (EXP) triptonide (ISO) tunicamycin (EXP) urethane (EXP) valproic acid (EXP) vincristine (EXP) zaragozic acid A (ISO)
DTL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 212,035,748 - 212,105,013 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 212,035,553 - 212,107,400 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 212,209,090 - 212,278,355 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 210,275,754 - 210,344,809 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 185,435,998 - 185,505,287 (+) NCBI Celera Cytogenetic Map 1 q32.3 NCBI HuRef 1 182,885,955 - 182,955,234 (+) NCBI HuRef CHM1_1 1 213,481,305 - 213,550,518 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 211,281,835 - 211,351,118 (+) NCBI T2T-CHM13v2.0
Dtl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 191,269,468 - 191,307,656 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 191,269,468 - 191,307,656 (-) Ensembl GRCm39 Ensembl GRCm38 1 191,537,356 - 191,575,544 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 191,537,356 - 191,575,544 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 193,361,244 - 193,399,413 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 193,237,980 - 193,276,149 (-) NCBI MGSCv36 mm8 Celera 1 198,486,790 - 198,526,178 (-) NCBI Celera Cytogenetic Map 1 H6 NCBI cM Map 1 96.44 NCBI
Dtl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 105,646,908 - 105,685,921 (-) NCBI GRCr8 mRatBN7.2 13 103,115,810 - 103,155,029 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 103,117,186 - 103,154,890 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 13 110,219,276 - 110,257,345 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 110,220,283 - 110,257,367 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 114,783,177 - 114,821,239 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 107,603,353 - 107,640,812 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 107,792,703 - 107,830,078 (-) NCBI Celera 13 102,555,070 - 102,594,148 (-) NCBI Celera Cytogenetic Map 13 q27 NCBI
Dtl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 5,254,558 - 5,299,573 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 5,256,057 - 5,299,573 (-) NCBI ChiLan1.0 ChiLan1.0
DTL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 37,300,460 - 37,367,503 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 37,264,941 - 37,331,990 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 187,603,600 - 187,672,006 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 192,466,408 - 192,535,071 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 192,466,408 - 192,535,071 (+) Ensembl panpan1.1 panPan2
DTL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 10,323,842 - 10,368,529 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 10,323,559 - 10,369,560 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 9,901,494 - 9,944,363 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 10,030,330 - 10,073,724 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 10,030,370 - 10,073,719 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 9,952,445 - 9,997,665 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 10,055,386 - 10,098,331 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 10,179,868 - 10,228,472 (+) NCBI UU_Cfam_GSD_1.0
Dtl Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 64,087,630 - 64,149,419 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936557 1,347,991 - 1,389,836 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936557 1,347,991 - 1,389,836 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DTL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 131,227,705 - 131,275,451 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 131,225,840 - 131,275,426 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 144,272,743 - 144,325,340 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DTL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 17,418,078 - 17,485,320 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 17,418,090 - 17,485,164 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 17,940,853 - 18,008,338 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dtl
.
Confirmed Target Of
MIR30A hsa-miR-30a-5p OncomiRDB external_info NA NA 22287560 MIR30A hsa-miR-30a-5p Mirtarbase external_info Flow//Luciferase reporter assay//qRT-PCR//Western Functional MTI 22287560 MIR215 hsa-miR-215-3p Mirecords external_info NA NA 20433742
Predicted Target Of
Count of predictions: 1395 Count of miRNA genes: 838 Interacting mature miRNAs: 942 Transcripts: ENST00000366991, ENST00000463791, ENST00000475419, ENST00000489149, ENST00000496442, ENST00000542077 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597486649 GWAS1582723_H Cleft palate, cleft lip QTL GWAS1582723 (human) 1e-20 Cleft palate, cleft lip 1 212058621 212058622 Human 597234207 GWAS1330281_H appendicular lean mass QTL GWAS1330281 (human) 1e-09 appendicular lean mass 1 212101071 212101072 Human 597288126 GWAS1384200_H body weight QTL GWAS1384200 (human) 4e-09 body mass (VT:0001259) body weight (CMO:0000012) 1 212037832 212037833 Human 597280465 GWAS1376539_H QT interval QTL GWAS1376539 (human) 7e-11 QT interval QT interval (CMO:0000235) 1 212072826 212072827 Human 597236725 GWAS1332799_H appendicular lean mass QTL GWAS1332799 (human) 1e-12 appendicular lean mass 1 212101071 212101072 Human 597209813 GWAS1305887_H large artery stroke QTL GWAS1305887 (human) 0.000007 large artery stroke 1 212064456 212064457 Human 597488270 GWAS1584344_H cleft lip QTL GWAS1584344 (human) 1e-13 cleft lip 1 212058621 212058622 Human 597320975 GWAS1417049_H JT interval QTL GWAS1417049 (human) 2e-15 heart electrical impulse conduction trait (VT:2000017) heart electrical conduction measurement (CMO:0000230) 1 212066143 212066144 Human 597315599 GWAS1411673_H body surface area QTL GWAS1411673 (human) 5e-11 body surface area 1 212095711 212095712 Human 596975520 GWAS1095039_H body height QTL GWAS1095039 (human) 7e-16 body height 1 212101071 212101072 Human 597485195 GWAS1581269_H cleft lip QTL GWAS1581269 (human) 6e-33 cleft lip 1 212058621 212058622 Human 597103053 GWAS1199127_H platelet crit QTL GWAS1199127 (human) 4e-09 platelet quantity (VT:0003179) plateletcrit (CMO:0001349) 1 212086062 212086063 Human 597279493 GWAS1375567_H QT interval QTL GWAS1375567 (human) 5e-11 QT interval QT interval (CMO:0000235) 1 212072826 212072827 Human 597319623 GWAS1415697_H JT interval QTL GWAS1415697 (human) 5e-15 heart electrical impulse conduction trait (VT:2000017) heart electrical conduction measurement (CMO:0000230) 1 212072826 212072827 Human
RH91389
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 212,277,897 - 212,278,034 UniSTS GRCh37 Build 36 1 210,344,520 - 210,344,657 RGD NCBI36 Celera 1 185,504,997 - 185,505,134 RGD Cytogenetic Map 1 q32 UniSTS HuRef 1 182,954,944 - 182,955,081 UniSTS GeneMap99-GB4 RH Map 1 694.71 UniSTS
RAMP__5641
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 212,277,639 - 212,278,279 UniSTS GRCh37 Build 36 1 210,344,262 - 210,344,902 RGD NCBI36 Celera 1 185,504,739 - 185,505,379 RGD HuRef 1 182,954,686 - 182,955,326 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2424
2766
2224
4915
1718
2347
6
618
1942
461
2270
7222
6420
53
3680
842
1736
1617
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000366991 ⟹ ENSP00000355958
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 212,035,748 - 212,105,013 (+) Ensembl
Ensembl Acc Id:
ENST00000463791
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 212,080,369 - 212,100,426 (+) Ensembl
Ensembl Acc Id:
ENST00000475419
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 212,035,846 - 212,104,594 (+) Ensembl
Ensembl Acc Id:
ENST00000489149
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 212,072,074 - 212,100,700 (+) Ensembl
Ensembl Acc Id:
ENST00000496442
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 212,100,646 - 212,107,400 (+) Ensembl
Ensembl Acc Id:
ENST00000542077 ⟹ ENSP00000443870
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 212,035,553 - 212,105,006 (+) Ensembl
RefSeq Acc Id:
NM_001286229 ⟹ NP_001273158
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 212,035,748 - 212,105,013 (+) NCBI HuRef 1 182,885,931 - 182,955,395 (+) NCBI CHM1_1 1 213,481,281 - 213,550,679 (+) NCBI T2T-CHM13v2.0 1 211,281,835 - 211,351,118 (+) NCBI
Sequence:
GGAGTTTGGCGGCCGGGGCTTACAGTGGCGGGAGTTGGAGGCGATAACGATTTGTGTTGTGAGAGGCGCAAGCTGCGATTTCTGCTGAACTTGGAGGCATTTCTACGACTTTTCTCTCAGCTGAGGCT
hide sequence
RefSeq Acc Id:
NM_001286230 ⟹ NP_001273159
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 212,035,748 - 212,105,013 (+) NCBI HuRef 1 182,885,931 - 182,955,395 (+) NCBI CHM1_1 1 213,481,281 - 213,550,679 (+) NCBI T2T-CHM13v2.0 1 211,281,835 - 211,351,118 (+) NCBI
Sequence:
GGAGTTTGGCGGCCGGGGCTTACAGTGGCGGGAGTTGGAGGCGATAACGATTTGTGTTGTGAGAGGCGCAAGCTGCGATTTCTGCTGAACTTGGAGGCATTTCTACGACTTTTCTCTCAGCTGAGGCT
hide sequence
RefSeq Acc Id:
NM_016448 ⟹ NP_057532
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 212,035,748 - 212,105,013 (+) NCBI GRCh37 1 212,208,919 - 212,278,187 (+) ENTREZGENE GRCh37 1 212,208,919 - 212,278,187 (+) NCBI Build 36 1 210,275,754 - 210,344,809 (+) NCBI Archive HuRef 1 182,885,931 - 182,955,395 (+) NCBI CHM1_1 1 213,481,281 - 213,550,679 (+) NCBI T2T-CHM13v2.0 1 211,281,835 - 211,351,118 (+) NCBI
Sequence:
GGAGTTTGGCGGCCGGGGCTTACAGTGGCGGGAGTTGGAGGCGATAACGATTTGTGTTGTGAGA
hide sequence
RefSeq Acc Id:
XM_011509614 ⟹ XP_011507916
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 212,035,971 - 212,105,013 (+) NCBI
Sequence:
GCTGGCGGAATTCATTTCCCCCGAAACACACGCCACCTCCGACCAGGGCCGACTCCAATTCTGAACTCAGCTTCTGAGTTCTCCCATGGCAAGGGATGGTCTTCACAATACCCTCTTCAATCCCTTCT
hide sequence
RefSeq Acc Id:
XM_047422489 ⟹ XP_047278445
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 212,066,811 - 212,105,013 (+) NCBI
RefSeq Acc Id:
XM_054336974 ⟹ XP_054192949
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 1 211,282,058 - 211,351,118 (+) NCBI
RefSeq Acc Id:
XM_054336975 ⟹ XP_054192950
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 1 211,312,894 - 211,351,118 (+) NCBI
RefSeq Acc Id:
NP_057532 ⟸ NM_016448
- Peptide Label:
isoform 1
- UniProtKB:
Q9NZJ0 (UniProtKB/Swiss-Prot), Q9NW34 (UniProtKB/Swiss-Prot), Q9NW03 (UniProtKB/Swiss-Prot), Q96SN0 (UniProtKB/Swiss-Prot), Q5VT77 (UniProtKB/Swiss-Prot), D3DT98 (UniProtKB/Swiss-Prot), A8K8H8 (UniProtKB/Swiss-Prot), Q9NWM5 (UniProtKB/Swiss-Prot), B4E0E6 (UniProtKB/TrEMBL)
- Sequence:
MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVK
hide sequence
RefSeq Acc Id:
NP_001273159 ⟸ NM_001286230
- Peptide Label:
isoform 3
- UniProtKB:
F5GZ90 (UniProtKB/TrEMBL), B4E0E6 (UniProtKB/TrEMBL)
- Sequence:
MLFNSVLRQPQLGVLRNAPNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDT
hide sequence
RefSeq Acc Id:
NP_001273158 ⟸ NM_001286229
- Peptide Label:
isoform 2
- Sequence:
MGYSSLILDSTGSTLFANCTDDNIYMFNMTGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSG
hide sequence
RefSeq Acc Id:
XP_011507916 ⟸ XM_011509614
- Peptide Label:
isoform X1
- UniProtKB:
B4E0E6 (UniProtKB/TrEMBL)
- Sequence:
MEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWD
hide sequence
Ensembl Acc Id:
ENSP00000443870 ⟸ ENST00000542077
Ensembl Acc Id:
ENSP00000355958 ⟸ ENST00000366991
RefSeq Acc Id:
XP_047278445 ⟸ XM_047422489
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_054192949 ⟸ XM_054336974
- Peptide Label:
isoform X1
- UniProtKB:
B4E0E6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054192950 ⟸ XM_054336975
- Peptide Label:
isoform X2
RGD ID: 6785829 Promoter ID: HG_KWN:7235 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000090142, OTTHUMT00000090182, UC001HIX.1, UC001HIY.1, UC001HIZ.2, UC009XDB.1 Position: Human Assembly Chr Position (strand) Source Build 36 1 210,275,341 - 210,276,312 (-) MPROMDB
RGD ID: 6858922 Promoter ID: EPDNEW_H2626 Type: initiation region Name: DTL_1 Description: denticleless E3 ubiquitin protein ligase homolog SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 212,035,793 - 212,035,853 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-26
DTL
denticleless E3 ubiquitin protein ligase homolog
denticleless E3 ubiquitin protein ligase homolog (Drosophila)
Symbol and/or name change
5135510 APPROVED
2012-03-01
DTL
denticleless E3 ubiquitin protein ligase homolog (Drosophila)
DTL
denticleless homolog (Drosophila)
Symbol and/or name change
5135510 APPROVED
