Symbol:
FCMR
Name:
Fc mu receptor
RGD ID:
1603318
HGNC Page
HGNC:14315
Description:
Enables high-affinity IgM receptor activity and polymeric immunoglobulin binding activity. Involved in Fc receptor-mediated immune complex endocytosis. Located in several cellular components, including bounding membrane of organelle; centrosome; and trans-Golgi network membrane.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
FAIM3; fas apoptotic inhibitory molecule 3; Fc fragment of IgM receptor; FcmuR; IgM Fc fragment receptor; IgM Fc receptor; IgM FcR; immunoglobulin mu Fc receptor; regulator of Fas-induced apoptosis Toso; TOSO
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Fcmr (Fc fragment of IgM receptor) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
Fcmr (Fc mu receptor) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Fcmr (Fc mu receptor) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
FCMR (Fc mu receptor) NCBI
Ortholog
Canis lupus familiaris (dog):
FCMR (Fc mu receptor) HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fcmr (Fc mu receptor) NCBI
Ortholog
Sus scrofa (pig):
FCMR (Fc mu receptor) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
FCMR (Fc mu receptor) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Fcmr (Fc mu receptor) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Cd84 (CD84 molecule) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Fcmr (Fc mu receptor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fcmr (Fc fragment of IgM receptor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 206,903,317 - 206,923,196 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 206,903,317 - 206,923,247 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 207,076,662 - 207,096,541 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 205,144,354 - 205,161,966 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 180,328,164 - 180,346,901 (-) NCBI Celera Cytogenetic Map 1 q32.1 NCBI HuRef 1 177,774,904 - 177,793,610 (-) NCBI HuRef CHM1_1 1 208,349,195 - 208,367,907 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 206,167,622 - 206,187,486 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
FCMR Human 1,2-dimethylhydrazine multiple interactions ISO RGD:1359282 6480464 [APC protein affects the susceptibility to 1,2-Dimethylhydrazine] which results in increased expression of FCMR mRNA CTD PMID:27840820 FCMR Human 1,2-dimethylhydrazine increases expression ISO RGD:1622299 6480464 1,2-Dimethylhydrazine results in increased expression of FCMR mRNA CTD PMID:22206623 FCMR Human 1-naphthyl isothiocyanate decreases expression ISO RGD:1359282 6480464 1-Naphthylisothiocyanate results in decreased expression of FCMR mRNA CTD PMID:30723492 FCMR Human 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of FCMR mRNA CTD PMID:21826169 FCMR Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of FCMR mRNA CTD PMID:24758408|PMID:31614463 FCMR Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with EGF protein] results in increased expression of FCMR mRNA; EGF protein promotes more ... CTD PMID:24758408 FCMR Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1359282 6480464 Tetrachlorodibenzodioxin affects the expression of FCMR mRNA CTD PMID:34747641 FCMR Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1359282 6480464 Tetrachlorodibenzodioxin results in increased expression of FCMR mRNA CTD PMID:33387578 FCMR Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1622299 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of FCMR mRNA CTD PMID:38648751 FCMR Human 2,6-dinitrotoluene affects expression ISO RGD:1359282 6480464 2,6-dinitrotoluene affects the expression of FCMR mRNA CTD PMID:21346803 FCMR Human 2-butoxyethanol decreases expression ISO RGD:1622299 6480464 n-butoxyethanol results in decreased expression of FCMR mRNA CTD PMID:19812364 FCMR Human 6-propyl-2-thiouracil decreases expression ISO RGD:1359282 6480464 Propylthiouracil results in decreased expression of FCMR mRNA CTD PMID:24780913 FCMR Human acrylamide decreases expression ISO RGD:1359282 6480464 Acrylamide results in decreased expression of FCMR mRNA CTD PMID:28959563 FCMR Human alpha-Zearalanol increases expression ISO RGD:1359282 6480464 Zeranol results in increased expression of FCMR mRNA CTD PMID:35163327 FCMR Human amphetamine decreases expression ISO RGD:1359282 6480464 Amphetamine results in decreased expression of FCMR mRNA CTD PMID:30779732 FCMR Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of FCMR mRNA CTD PMID:24449571 FCMR Human benzo[a]pyrene decreases expression ISO RGD:1622299 6480464 Benzo(a)pyrene results in decreased expression of FCMR mRNA CTD PMID:21569818 FCMR Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of FCMR mRNA CTD PMID:32234424 FCMR Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of FCMR 5' UTR CTD PMID:27901495 FCMR Human benzo[b]fluoranthene increases expression ISO RGD:1622299 6480464 benzo(b)fluoranthene results in increased expression of FCMR mRNA CTD PMID:26377693 FCMR Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of FCMR mRNA CTD PMID:21826169 FCMR Human bisphenol A increases expression ISO RGD:1622299 6480464 bisphenol A results in increased expression of FCMR mRNA CTD PMID:32156529 FCMR Human bisphenol A increases expression ISO RGD:1359282 6480464 bisphenol A results in increased expression of FCMR mRNA CTD PMID:34973380 FCMR Human bisphenol A affects expression ISO RGD:1359282 6480464 bisphenol A affects the expression of FCMR mRNA CTD PMID:25181051 FCMR Human buta-1,3-diene decreases expression ISO RGD:1622299 6480464 1,3-butadiene results in decreased expression of FCMR mRNA CTD PMID:29038090 FCMR Human butan-1-ol multiple interactions EXP 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 FCMR Human cadmium atom decreases expression ISO RGD:1622299 6480464 Cadmium results in decreased expression of FCMR mRNA CTD PMID:26187450 FCMR Human cadmium dichloride decreases methylation ISO RGD:1359282 6480464 Cadmium Chloride results in decreased methylation of FCMR promoter CTD PMID:22457795 FCMR Human carbon nanotube decreases expression ISO RGD:1622299 6480464 Nanotubes, Carbon analog results in decreased expression of FCMR mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681|PMID:25620056 FCMR Human chloroprene decreases expression ISO RGD:1622299 6480464 Chloroprene results in decreased expression of FCMR mRNA CTD PMID:23125180 FCMR Human choline multiple interactions ISO RGD:1622299 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 FCMR Human copper(II) chloride increases expression EXP 6480464 cupric chloride results in increased expression of FCMR mRNA CTD PMID:38568856 FCMR Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of FCMR mRNA; [Coumestrol co-treated with ESR1 more ... CTD PMID:18310284|PMID:19167446 FCMR Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of FCMR mRNA CTD PMID:37042841 FCMR Human dioxygen multiple interactions ISO RGD:1622299 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of FCMR mRNA CTD PMID:30529165 FCMR Human diuron decreases expression ISO RGD:1359282 6480464 Diuron results in decreased expression of FCMR mRNA CTD PMID:21551480|PMID:25152437 FCMR Human diuron decreases expression EXP 6480464 Diuron results in decreased expression of FCMR mRNA CTD PMID:35967413 FCMR Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of FCMR mRNA CTD PMID:29803840 FCMR Human Enterolactone multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of FCMR mRNA CTD PMID:19167446 FCMR Human folic acid multiple interactions ISO RGD:1622299 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 FCMR Human furan increases expression ISO RGD:1359282 6480464 furan results in increased expression of FCMR mRNA CTD PMID:27387713 FCMR Human genistein decreases expression ISO RGD:1622299 6480464 Genistein results in decreased expression of FCMR mRNA CTD PMID:32186404 FCMR Human gentamycin increases expression ISO RGD:1359282 6480464 Gentamicins results in increased expression of FCMR mRNA CTD PMID:33387578 FCMR Human L-methionine multiple interactions ISO RGD:1622299 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 FCMR Human nickel atom increases expression EXP 6480464 Nickel results in increased expression of FCMR mRNA CTD PMID:24768652 FCMR Human nitrates multiple interactions ISO RGD:1622299 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of FCMR more ... CTD PMID:35964746 FCMR Human oxaliplatin multiple interactions ISO RGD:1359282 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FCMR mRNA CTD PMID:25729387 FCMR Human ozone multiple interactions ISO RGD:1622299 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 FCMR Human p-menthan-3-ol increases expression EXP 6480464 Menthol results in increased expression of FCMR mRNA CTD PMID:26760959 FCMR Human paracetamol decreases expression ISO RGD:1359282 6480464 Acetaminophen results in decreased expression of FCMR mRNA CTD PMID:33387578 FCMR Human perfluorohexanesulfonic acid decreases expression ISO RGD:1622299 6480464 perfluorohexanesulfonic acid results in decreased expression of FCMR mRNA CTD PMID:37995155 FCMR Human pinostrobin increases expression EXP 6480464 pinostrobin results in increased expression of FCMR mRNA CTD PMID:37777166 FCMR Human pioglitazone increases expression EXP 6480464 Pioglitazone results in increased expression of FCMR mRNA CTD PMID:30031879 FCMR Human pirinixic acid decreases expression ISO RGD:1622299 6480464 pirinixic acid results in decreased expression of FCMR mRNA CTD PMID:20813756 FCMR Human pirinixic acid increases expression ISO RGD:1622299 6480464 pirinixic acid results in increased expression of FCMR mRNA CTD PMID:23811191 FCMR Human propionic acid decreases expression EXP 6480464 propionic acid results in decreased expression of FCMR mRNA CTD PMID:31526819 FCMR Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of FCMR mRNA CTD PMID:23557933 FCMR Human S-nitrosoglutathione increases expression EXP 6480464 S-Nitrosoglutathione results in increased expression of FCMR mRNA CTD PMID:38825487 FCMR Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of FCMR mRNA CTD PMID:25895662 FCMR Human sodium fluoride increases expression ISO RGD:1622299 6480464 Sodium Fluoride results in increased expression of FCMR mRNA CTD PMID:27862939 FCMR Human sulforaphane increases expression EXP 6480464 sulforaphane results in increased expression of FCMR mRNA CTD PMID:31838189 FCMR Human tamoxifen multiple interactions EXP 6480464 Tamoxifen inhibits the reaction [EGF protein results in increased expression of FCMR mRNA] CTD PMID:24758408 FCMR Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of FCMR mRNA CTD PMID:31758290 FCMR Human tetrachloromethane decreases expression ISO RGD:1359282 6480464 Carbon Tetrachloride results in decreased expression of FCMR mRNA CTD PMID:31150632 FCMR Human tetraphene increases expression ISO RGD:1622299 6480464 benz(a)anthracene results in increased expression of FCMR mRNA CTD PMID:26377693 FCMR Human thioacetamide increases expression ISO RGD:1359282 6480464 Thioacetamide results in increased expression of FCMR mRNA CTD PMID:34492290 FCMR Human thiram increases expression EXP 6480464 Thiram results in increased expression of FCMR mRNA CTD PMID:38568856 FCMR Human titanium dioxide increases expression ISO RGD:1622299 6480464 titanium dioxide results in increased expression of FCMR mRNA CTD PMID:23557971 FCMR Human titanium dioxide decreases methylation ISO RGD:1622299 6480464 titanium dioxide results in decreased methylation of FCMR gene CTD PMID:35295148 FCMR Human topotecan increases expression ISO RGD:1359282 6480464 Topotecan results in increased expression of FCMR mRNA CTD PMID:25729387 FCMR Human topotecan multiple interactions ISO RGD:1359282 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FCMR mRNA CTD PMID:25729387 FCMR Human trichloroethene increases expression ISO RGD:1359282 6480464 Trichloroethylene results in increased expression of FCMR mRNA CTD PMID:33387578 FCMR Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of FCMR mRNA CTD PMID:37042841 FCMR Human troglitazone increases expression EXP 6480464 troglitazone results in increased expression of FCMR mRNA CTD PMID:19140230 FCMR Human tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of FCMR mRNA CTD PMID:22378314 FCMR Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of FCMR mRNA CTD PMID:24714768
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (ISO) 2-butoxyethanol (ISO) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) alpha-Zearalanol (ISO) amphetamine (ISO) antirheumatic drug (EXP) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) butan-1-ol (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) chloroprene (ISO) choline (ISO) copper(II) chloride (EXP) coumestrol (EXP) Dibutyl phosphate (EXP) dioxygen (ISO) diuron (EXP,ISO) doxorubicin (EXP) Enterolactone (EXP) folic acid (ISO) furan (ISO) genistein (ISO) gentamycin (ISO) L-methionine (ISO) nickel atom (EXP) nitrates (ISO) oxaliplatin (ISO) ozone (ISO) p-menthan-3-ol (EXP) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) pinostrobin (EXP) pioglitazone (EXP) pirinixic acid (ISO) propionic acid (EXP) resveratrol (EXP) S-nitrosoglutathione (EXP) silicon dioxide (EXP) sodium fluoride (ISO) sulforaphane (EXP) tamoxifen (EXP) temozolomide (EXP) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (ISO) thiram (EXP) titanium dioxide (ISO) topotecan (ISO) trichloroethene (ISO) triphenyl phosphate (EXP) troglitazone (EXP) tunicamycin (EXP) zoledronic acid (EXP)
FCMR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 206,903,317 - 206,923,196 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 206,903,317 - 206,923,247 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 207,076,662 - 207,096,541 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 205,144,354 - 205,161,966 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 180,328,164 - 180,346,901 (-) NCBI Celera Cytogenetic Map 1 q32.1 NCBI HuRef 1 177,774,904 - 177,793,610 (-) NCBI HuRef CHM1_1 1 208,349,195 - 208,367,907 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 206,167,622 - 206,187,486 (-) NCBI T2T-CHM13v2.0
Fcmr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 130,793,514 - 130,808,528 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 130,793,406 - 130,808,528 (+) Ensembl GRCm39 Ensembl GRCm38 1 130,865,777 - 130,880,790 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 130,865,669 - 130,880,791 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 132,762,354 - 132,777,367 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 132,693,323 - 132,708,336 (+) NCBI MGSCv36 mm8 Celera 1 133,488,863 - 133,503,870 (+) NCBI Celera Cytogenetic Map 1 E4 NCBI cM Map 1 56.89 NCBI
Fcmr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 44,889,628 - 44,903,926 (+) NCBI GRCr8 mRatBN7.2 13 42,337,363 - 42,351,706 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 42,337,414 - 42,351,653 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 44,943,942 - 44,958,193 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 46,232,069 - 46,246,326 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 43,487,138 - 43,501,422 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 47,602,701 - 47,617,065 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 47,602,692 - 47,617,064 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 52,691,406 - 52,706,509 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 43,815,827 - 43,830,062 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 43,829,869 - 43,844,104 (+) NCBI Celera 13 42,686,877 - 42,701,122 (+) NCBI Celera Cytogenetic Map 13 q13 NCBI
Fcmr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 42,438,783 - 42,452,163 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 42,438,173 - 42,452,339 (-) NCBI ChiLan1.0 ChiLan1.0
FCMR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 42,452,680 - 42,471,350 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 42,418,609 - 42,437,265 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 182,506,551 - 182,525,249 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 186,786,037 - 186,803,789 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 186,786,147 - 186,803,789 (-) Ensembl panpan1.1 panPan2
FCMR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 6,046,270 - 6,064,063 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 6,048,814 - 6,064,013 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 5,611,371 - 5,628,152 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 5,736,666 - 5,753,451 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 5,735,657 - 5,753,403 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 5,671,067 - 5,687,846 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 5,772,136 - 5,788,910 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 5,811,956 - 5,828,759 (-) NCBI UU_Cfam_GSD_1.0
Fcmr
FCMR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 67,532,083 - 67,546,402 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 67,530,944 - 67,546,441 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 73,987,313 - 74,001,868 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FCMR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 22,435,252 - 22,453,582 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 22,435,339 - 22,447,732 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 23,100,042 - 23,125,491 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fcmr
.
Predicted Target Of
Count of predictions: 2497 Count of miRNA genes: 886 Interacting mature miRNAs: 1067 Transcripts: ENST00000367091, ENST00000420007, ENST00000442471, ENST00000463473, ENST00000474041, ENST00000525793, ENST00000528654, ENST00000529560, ENST00000530505, ENST00000533312 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597378680 GWAS1474754_H triacylglycerol 54:8 measurement QTL GWAS1474754 (human) 0.000003 blood triglyceride amount (VT:0002644) 1 206922206 206922207 Human
D1S2735
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 207,091,891 - 207,092,113 UniSTS GRCh37 Build 36 1 205,158,514 - 205,158,736 RGD NCBI36 Celera 1 180,343,413 - 180,343,635 RGD Cytogenetic Map 1 q32.1 UniSTS HuRef 1 177,790,113 - 177,790,343 UniSTS Marshfield Genetic Map 1 222.84 RGD Marshfield Genetic Map 1 222.84 UniSTS Genethon Genetic Map 1 227.3 UniSTS deCODE Assembly Map 1 209.38 UniSTS GeneMap99-GB4 RH Map 1 682.48 UniSTS NCBI RH Map 1 1793.8 UniSTS
IL24_765
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 207,076,531 - 207,077,359 UniSTS GRCh37 Build 36 1 205,143,154 - 205,143,982 RGD NCBI36 Celera 1 180,328,065 - 180,328,893 RGD HuRef 1 177,774,805 - 177,775,633 UniSTS
SHGC-76250
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 207,076,971 - 207,077,143 UniSTS GRCh37 Build 36 1 205,143,594 - 205,143,766 RGD NCBI36 Celera 1 180,328,505 - 180,328,677 RGD Cytogenetic Map 1 q32 UniSTS Cytogenetic Map 1 q32.1 UniSTS HuRef 1 177,775,245 - 177,775,417 UniSTS TNG Radiation Hybrid Map 1 102070.0 UniSTS GeneMap99-GB4 RH Map 1 682.48 UniSTS NCBI RH Map 1 1791.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2421
2777
2235
4861
1713
2315
3
615
1935
455
2251
7244
6434
45
3632
1
842
1718
1590
172
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000367091 ⟹ ENSP00000356058
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,903,317 - 206,921,941 (-) Ensembl
Ensembl Acc Id:
ENST00000442471 ⟹ ENSP00000404136
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,904,559 - 206,921,998 (-) Ensembl
Ensembl Acc Id:
ENST00000463473 ⟹ ENSP00000436799
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,904,894 - 206,921,941 (-) Ensembl
Ensembl Acc Id:
ENST00000474041
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,904,525 - 206,909,945 (-) Ensembl
Ensembl Acc Id:
ENST00000525793 ⟹ ENSP00000432936
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,912,963 - 206,923,196 (-) Ensembl
Ensembl Acc Id:
ENST00000528654
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,904,714 - 206,921,955 (-) Ensembl
Ensembl Acc Id:
ENST00000529560 ⟹ ENSP00000437331
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,912,973 - 206,923,247 (-) Ensembl
Ensembl Acc Id:
ENST00000530505 ⟹ ENSP00000436316
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,913,801 - 206,921,997 (-) Ensembl
Ensembl Acc Id:
ENST00000533312
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,913,632 - 206,921,941 (-) Ensembl
Ensembl Acc Id:
ENST00000628511 ⟹ ENSP00000485739
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 206,905,019 - 206,921,867 (-) Ensembl
RefSeq Acc Id:
NM_001142473 ⟹ NP_001135945
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI GRCh37 1 207,076,630 - 207,095,378 (-) ENTREZGENE HuRef 1 177,774,904 - 177,793,610 (-) ENTREZGENE CHM1_1 1 208,349,195 - 208,367,907 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
Sequence:
AGATTGTGAAGGGTTCCTGAGTAAGCAGCGTGTCTCCATCCCCCTCTCTAGGGGCTCTTGGATGGACCTTGCACTCTAGAAGGGACAATGGACTTCTGGCTTTGGCCACTTTACTTCCTGCCAGAATA
hide sequence
RefSeq Acc Id:
NM_001193338 ⟹ NP_001180267
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI GRCh37 1 207,076,630 - 207,095,378 (-) ENTREZGENE HuRef 1 177,774,904 - 177,793,610 (-) ENTREZGENE CHM1_1 1 208,349,195 - 208,367,764 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
Sequence:
AGATTGTGAAGGGTTCCTGAGTAAGCAGCGTGTCTCCATCCCCCTCTCTAGGGGCTCTTGGATGGACCTTGCACTCTAGAAGGGACAATGGACTTCTGGCTTTGGCCACTTTACTTCCTGCCAGTATC
hide sequence
RefSeq Acc Id:
NM_001405862 ⟹ NP_001392791
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,923,196 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,187,486 (-) NCBI
RefSeq Acc Id:
NM_001405863 ⟹ NP_001392792
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_001405864 ⟹ NP_001392793
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,923,196 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,187,486 (-) NCBI
RefSeq Acc Id:
NM_001405865 ⟹ NP_001392794
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_001405866 ⟹ NP_001392795
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_001405867 ⟹ NP_001392796
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,923,196 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,187,486 (-) NCBI
RefSeq Acc Id:
NM_001405868 ⟹ NP_001392797
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_001405871 ⟹ NP_001392800
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,923,196 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,187,486 (-) NCBI
RefSeq Acc Id:
NM_001405886 ⟹ NP_001392815
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_001405887 ⟹ NP_001392816
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,923,196 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,187,486 (-) NCBI
RefSeq Acc Id:
NM_001405888 ⟹ NP_001392817
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_001405889 ⟹ NP_001392818
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_001405890 ⟹ NP_001392819
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_001405891 ⟹ NP_001392820
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_001405892 ⟹ NP_001392821
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NM_005449 ⟹ NP_005440
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,921,941 (-) NCBI GRCh37 1 207,076,630 - 207,095,378 (-) ENTREZGENE Build 36 1 205,144,354 - 205,161,966 (-) NCBI Archive HuRef 1 177,774,904 - 177,793,610 (-) ENTREZGENE CHM1_1 1 208,349,195 - 208,367,907 (-) NCBI T2T-CHM13v2.0 1 206,167,622 - 206,186,231 (-) NCBI
Sequence:
AGATTGTGAAGGGTTCCTGAGTAAGCAGCGTGTCTCCATCCCCCTCTCTAGGGGCTCTTGGATG
hide sequence
RefSeq Acc Id:
XM_047434331 ⟹ XP_047290287
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,903,317 - 206,914,094 (-) NCBI
RefSeq Acc Id:
XM_047434334 ⟹ XP_047290290
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 206,909,735 - 206,921,941 (-) NCBI
RefSeq Acc Id:
XM_054339614 ⟹ XP_054195589
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 1 206,167,622 - 206,178,398 (-) NCBI
RefSeq Acc Id:
XM_054339615 ⟹ XP_054195590
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 1 206,174,039 - 206,186,231 (-) NCBI
RefSeq Acc Id:
NP_001135945 ⟸ NM_001142473
- Peptide Label:
isoform b
- UniProtKB:
B7Z497 (UniProtKB/TrEMBL)
- Sequence:
MDFWLWPLYFLPEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALD
hide sequence
RefSeq Acc Id:
NP_005440 ⟸ NM_005449
- Peptide Label:
isoform a precursor
- UniProtKB:
B7Z6Z0 (UniProtKB/Swiss-Prot), A8K7J2 (UniProtKB/Swiss-Prot), D9MWM3 (UniProtKB/Swiss-Prot), O60667 (UniProtKB/Swiss-Prot)
- Sequence:
MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVST
hide sequence
RefSeq Acc Id:
NP_001180267 ⟸ NM_001193338
- Peptide Label:
isoform c precursor
- UniProtKB:
O60667 (UniProtKB/Swiss-Prot)
- Sequence:
MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEP
hide sequence
Ensembl Acc Id:
ENSP00000436799 ⟸ ENST00000463473
Ensembl Acc Id:
ENSP00000436316 ⟸ ENST00000530505
Ensembl Acc Id:
ENSP00000404136 ⟸ ENST00000442471
Ensembl Acc Id:
ENSP00000485739 ⟸ ENST00000628511
Ensembl Acc Id:
ENSP00000356058 ⟸ ENST00000367091
Ensembl Acc Id:
ENSP00000432936 ⟸ ENST00000525793
Ensembl Acc Id:
ENSP00000437331 ⟸ ENST00000529560
RefSeq Acc Id:
XP_047290287 ⟸ XM_047434331
- Peptide Label:
isoform X1
- UniProtKB:
B7Z497 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047290290 ⟸ XM_047434334
- Peptide Label:
isoform X2
RefSeq Acc Id:
NP_001392816 ⟸ NM_001405887
- Peptide Label:
isoform b
- UniProtKB:
B7Z497 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001392793 ⟸ NM_001405864
- Peptide Label:
isoform e precursor
RefSeq Acc Id:
NP_001392800 ⟸ NM_001405871
- Peptide Label:
isoform a precursor
- UniProtKB:
O60667 (UniProtKB/Swiss-Prot), B7Z6Z0 (UniProtKB/Swiss-Prot), A8K7J2 (UniProtKB/Swiss-Prot), D9MWM3 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001392791 ⟸ NM_001405862
- Peptide Label:
isoform d
RefSeq Acc Id:
NP_001392796 ⟸ NM_001405867
- Peptide Label:
isoform g precursor
RefSeq Acc Id:
NP_001392817 ⟸ NM_001405888
- Peptide Label:
isoform j
RefSeq Acc Id:
NP_001392819 ⟸ NM_001405890
- Peptide Label:
isoform l
RefSeq Acc Id:
NP_001392820 ⟸ NM_001405891
- Peptide Label:
isoform m
RefSeq Acc Id:
NP_001392818 ⟸ NM_001405889
- Peptide Label:
isoform k precursor
RefSeq Acc Id:
NP_001392821 ⟸ NM_001405892
- Peptide Label:
isoform n precursor
RefSeq Acc Id:
NP_001392794 ⟸ NM_001405865
- Peptide Label:
isoform e precursor
RefSeq Acc Id:
NP_001392795 ⟸ NM_001405866
- Peptide Label:
isoform f precursor
RefSeq Acc Id:
NP_001392797 ⟸ NM_001405868
- Peptide Label:
isoform g precursor
RefSeq Acc Id:
NP_001392815 ⟸ NM_001405886
- Peptide Label:
isoform h
- UniProtKB:
B7Z497 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001392792 ⟸ NM_001405863
- Peptide Label:
isoform d
RefSeq Acc Id:
XP_054195589 ⟸ XM_054339614
- Peptide Label:
isoform X1
- UniProtKB:
B7Z497 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054195590 ⟸ XM_054339615
- Peptide Label:
isoform X2
RGD ID: 6785536 Promoter ID: HG_KWN:7093 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, HeLa_S3, Lymphoblastoid Transcripts: OTTHUMT00000088678 Position: Human Assembly Chr Position (strand) Source Build 36 1 205,149,441 - 205,149,972 (-) MPROMDB
RGD ID: 6785540 Promoter ID: HG_KWN:7094 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lymphoblastoid Transcripts: OTTHUMT00000088967 Position: Human Assembly Chr Position (strand) Source Build 36 1 205,153,801 - 205,155,047 (-) MPROMDB
RGD ID: 6785537 Promoter ID: HG_KWN:7095 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, Jurkat, K562, Lymphoblastoid Transcripts: NM_001142473, NM_005449 Position: Human Assembly Chr Position (strand) Source Build 36 1 205,161,739 - 205,162,239 (-) MPROMDB
RGD ID: 6850458 Promoter ID: EP73020 Type: initiation region Name: HS_TOSO Description: Regulator of Fas-induced apoptosis. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: NEDO full length human cDNA sequencing project.; Oligo-capping Position: Human Assembly Chr Position (strand) Source Build 36 1 205,161,909 - 205,161,969 EPD
RGD ID: 6785535 Promoter ID: HG_KWN:7096 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, Jurkat, K562, Lymphoblastoid Transcripts: NM_001142472 Position: Human Assembly Chr Position (strand) Source Build 36 1 205,163,106 - 205,163,962 (-) MPROMDB
RGD ID: 6858814 Promoter ID: EPDNEW_H2572 Type: initiation region Name: FCMR_1 Description: Fc fragment of IgM receptor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 206,921,941 - 206,922,001 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-11-08
FCMR
Fc mu receptor
FCMR
Fc fragment of IgM receptor
Symbol and/or name change
19259463 PROVISIONAL
2015-04-28
FCMR
Fc fragment of IgM receptor
FAIM3
Fas apoptotic inhibitory molecule 3
Symbol and/or name change
5135510 APPROVED
