Symbol:
Cyth4
Name:
cytohesin 4
RGD ID:
1564842
Description:
Predicted to enable guanyl-nucleotide exchange factor activity. Predicted to be involved in regulation of ARF protein signal transduction. Predicted to be located in several cellular components, including centriolar satellite; cytosol; and intercellular bridge. Orthologous to human CYTH4 (cytohesin 4); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cytohesin-4; LOC500906; pleckstrin homology, Sec7 and coiled/coil domains 4; Pscd4; RGD1564842; similar to cytohesin-4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CYTH4 (cytohesin 4) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA
Mus musculus (house mouse):
Cyth4 (cytohesin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cyth4 (cytohesin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CYTH4 (cytohesin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CYTH4 (cytohesin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cyth4 (cytohesin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CYTH4 (cytohesin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CYTH4 (cytohesin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cyth4 (cytohesin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CYTH1 (cytohesin 1) HGNC
OrthoDB
Homo sapiens (human):
CYTH2 (cytohesin 2) HGNC
OrthoDB
Homo sapiens (human):
CYTH3 (cytohesin 3) HGNC
OrthoDB
Homo sapiens (human):
NDUFB8 (NADH:ubiquinone oxidoreductase subunit B8) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CYTH4 (cytohesin 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cyth4 (cytohesin 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cyth4a (cytohesin 4a)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PhylomeDB)
Danio rerio (zebrafish):
cyth4b (cytohesin 4b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PhylomeDB)
Caenorhabditis elegans (roundworm):
grp-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
step
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SYT1
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
cyth4
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 112,032,711 - 112,057,204 (+) NCBI GRCr8 mRatBN7.2 7 110,152,232 - 110,176,726 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 110,152,272 - 110,176,741 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 111,902,464 - 111,926,898 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 114,125,991 - 114,150,429 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 114,093,739 - 114,118,177 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 119,820,521 - 119,845,003 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 119,820,537 - 119,845,003 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 119,809,471 - 119,833,941 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 116,557,797 - 116,582,215 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 106,489,779 - 106,514,242 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cyth4 Rat 1,1-dichloroethene increases expression ISO Cyth4 (Mus musculus) 6480464 vinylidene chloride results in increased expression of CYTH4 mRNA CTD PMID:26682919 Cyth4 Rat 1,2-dimethylhydrazine multiple interactions ISO Cyth4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CYTH4 mRNA CTD PMID:22206623 Cyth4 Rat 1,2-dimethylhydrazine increases expression ISO Cyth4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CYTH4 mRNA CTD PMID:22206623 Cyth4 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CYTH4 mRNA CTD PMID:32741896 Cyth4 Rat 17beta-estradiol increases expression ISO CYTH4 (Homo sapiens) 6480464 Estradiol results in increased expression of CYTH4 mRNA CTD PMID:31614463 Cyth4 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CYTH4 mRNA CTD PMID:32741896 Cyth4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cyth4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CYTH4 mRNA CTD PMID:28922406 Cyth4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CYTH4 mRNA CTD PMID:33387578 and PMID:34747641 Cyth4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Cyth4 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Cyth4 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO Cyth4 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of CYTH4 mRNA CTD PMID:25172293 Cyth4 Rat 4,4'-sulfonyldiphenol increases expression ISO Cyth4 (Mus musculus) 6480464 bisphenol S results in increased expression of CYTH4 mRNA CTD PMID:30951980 Cyth4 Rat 4,4'-sulfonyldiphenol decreases expression ISO Cyth4 (Mus musculus) 6480464 bisphenol S results in decreased expression of CYTH4 mRNA CTD PMID:39298647 Cyth4 Rat 4-hydroxynon-2-enal decreases expression ISO Cyth4 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of CYTH4 mRNA CTD PMID:19191707 Cyth4 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CYTH4 mRNA CTD PMID:31881176 Cyth4 Rat aflatoxin B1 increases methylation ISO CYTH4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CYTH4 intron CTD PMID:30157460 Cyth4 Rat aflatoxin B1 increases expression ISO CYTH4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CYTH4 mRNA CTD PMID:32234424 Cyth4 Rat all-trans-retinoic acid increases expression ISO CYTH4 (Homo sapiens) 6480464 Tretinoin results in increased expression of CYTH4 mRNA CTD PMID:33167477 Cyth4 Rat amphotericin B increases expression ISO CYTH4 (Homo sapiens) 6480464 Amphotericin B analog results in increased expression of CYTH4 mRNA CTD PMID:28534445 Cyth4 Rat antirheumatic drug decreases expression ISO CYTH4 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CYTH4 mRNA CTD PMID:24449571 Cyth4 Rat aristolochic acid A increases expression ISO CYTH4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CYTH4 mRNA CTD PMID:33212167 Cyth4 Rat arsane increases expression ISO CYTH4 (Homo sapiens) 6480464 Arsenic results in increased expression of CYTH4 mRNA CTD PMID:36861143 Cyth4 Rat arsenic atom increases expression ISO CYTH4 (Homo sapiens) 6480464 Arsenic results in increased expression of CYTH4 mRNA CTD PMID:36861143 Cyth4 Rat benzo[a]pyrene decreases expression ISO Cyth4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CYTH4 mRNA CTD PMID:17942131 and PMID:22228805 Cyth4 Rat benzo[a]pyrene increases expression ISO CYTH4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CYTH4 mRNA CTD PMID:32234424 Cyth4 Rat benzo[a]pyrene decreases methylation ISO CYTH4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CYTH4 promoter CTD PMID:27901495 Cyth4 Rat benzo[a]pyrene affects methylation ISO CYTH4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CYTH4 intron CTD PMID:30157460 Cyth4 Rat benzo[a]pyrene increases methylation ISO CYTH4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CYTH4 3' UTR CTD PMID:27901495 Cyth4 Rat benzo[e]pyrene increases methylation ISO CYTH4 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of CYTH4 intron CTD PMID:30157460 Cyth4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CYTH4 mRNA CTD PMID:25181051 and PMID:34947998 Cyth4 Rat bisphenol A increases expression ISO Cyth4 (Mus musculus) 6480464 bisphenol A results in increased expression of CYTH4 mRNA CTD PMID:32156529 and PMID:38701888 Cyth4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CYTH4 mRNA CTD PMID:30816183 and PMID:32528016 Cyth4 Rat bisphenol F increases expression ISO Cyth4 (Mus musculus) 6480464 bisphenol F results in increased expression of CYTH4 mRNA CTD PMID:30951980 Cyth4 Rat butanal increases expression ISO CYTH4 (Homo sapiens) 6480464 butyraldehyde results in increased expression of CYTH4 mRNA CTD PMID:26079696 Cyth4 Rat cadmium dichloride decreases expression ISO CYTH4 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CYTH4 mRNA CTD PMID:38382870 Cyth4 Rat cadmium dichloride increases expression ISO CYTH4 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CYTH4 mRNA CTD PMID:38568856 Cyth4 Rat cannabidiol multiple interactions EXP 6480464 Cannabidiol inhibits the reaction [Ketamine results in decreased expression of CYTH4 mRNA] CTD PMID:31823199 Cyth4 Rat carbon nanotube increases expression ISO Cyth4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:27106021 Cyth4 Rat CGP 52608 multiple interactions ISO CYTH4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CYTH4 gene] CTD PMID:28238834 Cyth4 Rat chloroprene decreases expression ISO Cyth4 (Mus musculus) 6480464 Chloroprene results in decreased expression of CYTH4 mRNA CTD PMID:23125180 Cyth4 Rat choline multiple interactions ISO Cyth4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CYTH4 mRNA CTD PMID:20938992 Cyth4 Rat cisplatin increases expression ISO CYTH4 (Homo sapiens) 6480464 Cisplatin results in increased expression of CYTH4 mRNA CTD PMID:27594783 Cyth4 Rat clothianidin increases expression ISO CYTH4 (Homo sapiens) 6480464 clothianidin results in increased expression of CYTH4 mRNA CTD PMID:31626844 Cyth4 Rat curcumin increases expression ISO CYTH4 (Homo sapiens) 6480464 Curcumin results in increased expression of CYTH4 mRNA CTD PMID:17198877 Cyth4 Rat cyclosporin A decreases expression ISO Cyth4 (Mus musculus) 6480464 Cyclosporine results in decreased expression of CYTH4 mRNA CTD PMID:17942131 Cyth4 Rat diquat decreases expression ISO Cyth4 (Mus musculus) 6480464 Diquat results in decreased expression of CYTH4 mRNA CTD PMID:36851058 Cyth4 Rat ethanol increases expression ISO Cyth4 (Mus musculus) 6480464 Ethanol results in increased expression of CYTH4 mRNA CTD PMID:30319688 Cyth4 Rat fenthion decreases expression ISO Cyth4 (Mus musculus) 6480464 Fenthion results in decreased expression of CYTH4 mRNA CTD PMID:34813904 Cyth4 Rat folic acid multiple interactions ISO Cyth4 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Cyth4 Rat glycidyl methacrylate decreases expression ISO CYTH4 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of CYTH4 protein CTD PMID:36641056 Cyth4 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of CYTH4 mRNA CTD PMID:31823199 Cyth4 Rat ketamine multiple interactions EXP 6480464 Cannabidiol inhibits the reaction [Ketamine results in decreased expression of CYTH4 mRNA] CTD PMID:31823199 Cyth4 Rat L-methionine multiple interactions ISO Cyth4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CYTH4 mRNA CTD PMID:20938992 Cyth4 Rat methapyrilene increases methylation ISO CYTH4 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of CYTH4 intron CTD PMID:30157460 Cyth4 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of CYTH4 mRNA CTD PMID:31378766 Cyth4 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO CYTH4 (Homo sapiens) 6480464 N more ... CTD PMID:12756304 Cyth4 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CYTH4 gene CTD PMID:33148267 Cyth4 Rat N-Nitrosopyrrolidine increases expression ISO CYTH4 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of CYTH4 mRNA CTD PMID:32234424 Cyth4 Rat nickel atom increases expression ISO CYTH4 (Homo sapiens) 6480464 Nickel results in increased expression of CYTH4 mRNA CTD PMID:24768652 Cyth4 Rat ozone multiple interactions ISO Cyth4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CYTH4 mRNA CTD PMID:34911549 Cyth4 Rat paracetamol decreases expression ISO Cyth4 (Mus musculus) 6480464 Acetaminophen results in decreased expression of CYTH4 mRNA CTD PMID:17942131 Cyth4 Rat paracetamol increases expression ISO CYTH4 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CYTH4 mRNA CTD PMID:26690555 Cyth4 Rat PCB138 increases expression EXP 6480464 2 more ... CTD PMID:23829299 Cyth4 Rat pentanal increases expression ISO CYTH4 (Homo sapiens) 6480464 pentanal results in increased expression of CYTH4 mRNA CTD PMID:26079696 Cyth4 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CYTH4 gene CTD PMID:33148267 Cyth4 Rat propanal increases expression ISO CYTH4 (Homo sapiens) 6480464 propionaldehyde results in increased expression of CYTH4 mRNA CTD PMID:26079696 Cyth4 Rat silicon dioxide increases expression ISO CYTH4 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of CYTH4 mRNA CTD PMID:25895662 Cyth4 Rat silicon dioxide increases expression ISO Cyth4 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of CYTH4 mRNA CTD PMID:29341224 Cyth4 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of CYTH4 mRNA CTD PMID:32721576 Cyth4 Rat temozolomide decreases expression ISO CYTH4 (Homo sapiens) 6480464 Temozolomide results in decreased expression of CYTH4 mRNA CTD PMID:31758290 Cyth4 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CYTH4 mRNA CTD PMID:32741896 Cyth4 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CYTH4 mRNA CTD PMID:31150632 Cyth4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CYTH4 mRNA CTD PMID:34492290 Cyth4 Rat Tributyltin oxide decreases expression ISO Cyth4 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of CYTH4 mRNA CTD PMID:17942131 Cyth4 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CYTH4 mRNA CTD PMID:33387578 Cyth4 Rat triphenyl phosphate affects expression ISO CYTH4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CYTH4 mRNA CTD PMID:37042841 Cyth4 Rat triptonide increases expression ISO Cyth4 (Mus musculus) 6480464 triptonide results in increased expression of CYTH4 mRNA CTD PMID:33045310 Cyth4 Rat trovafloxacin increases expression ISO Cyth4 (Mus musculus) 6480464 trovafloxacin results in increased expression of CYTH4 mRNA CTD PMID:35537566
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amphotericin B (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) cannabidiol (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (ISO) choline (ISO) cisplatin (ISO) clothianidin (ISO) curcumin (ISO) cyclosporin A (ISO) diquat (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) glycidyl methacrylate (ISO) ketamine (EXP) L-methionine (ISO) methapyrilene (ISO) methylmercury chloride (EXP) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N,N-diethyl-m-toluamide (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) ozone (ISO) paracetamol (ISO) PCB138 (EXP) pentanal (ISO) permethrin (EXP) propanal (ISO) silicon dioxide (EXP,ISO) temozolomide (ISO) testosterone (EXP) tetrachloromethane (EXP) thioacetamide (EXP) Tributyltin oxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO)
Cyth4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 112,032,711 - 112,057,204 (+) NCBI GRCr8 mRatBN7.2 7 110,152,232 - 110,176,726 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 110,152,272 - 110,176,741 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 111,902,464 - 111,926,898 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 114,125,991 - 114,150,429 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 114,093,739 - 114,118,177 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 119,820,521 - 119,845,003 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 119,820,537 - 119,845,003 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 119,809,471 - 119,833,941 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 116,557,797 - 116,582,215 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 106,489,779 - 106,514,242 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
CYTH4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 37,282,508 - 37,315,341 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 37,282,027 - 37,315,341 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 37,678,549 - 37,711,382 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 36,008,370 - 36,041,328 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 36,002,923 - 36,035,880 NCBI Celera 22 21,479,377 - 21,512,272 (+) NCBI Celera Cytogenetic Map 22 q13.1 NCBI HuRef 22 20,643,760 - 20,676,655 (+) NCBI HuRef CHM1_1 22 37,637,472 - 37,670,270 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 37,743,033 - 37,775,859 (+) NCBI T2T-CHM13v2.0
Cyth4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 78,481,247 - 78,506,219 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 78,481,247 - 78,506,219 (+) Ensembl GRCm39 Ensembl GRCm38 15 78,597,047 - 78,622,019 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 78,597,047 - 78,622,019 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 78,427,477 - 78,452,449 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 78,424,373 - 78,448,141 (+) NCBI MGSCv36 mm8 Celera 15 80,059,894 - 80,084,897 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 37.59 NCBI
Cyth4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 23,745,777 - 23,768,387 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 23,745,797 - 23,774,397 (+) NCBI ChiLan1.0 ChiLan1.0
CYTH4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 47,139,849 - 47,172,838 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 49,828,410 - 49,861,400 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 18,197,307 - 18,230,274 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 36,030,112 - 36,063,113 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 36,040,326 - 36,061,264 (+) Ensembl panpan1.1 panPan2
CYTH4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 27,238,028 - 27,268,759 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 27,239,405 - 27,268,823 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 27,193,046 - 27,223,768 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 28,030,394 - 28,061,112 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 28,030,404 - 28,061,050 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 27,752,171 - 27,782,867 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 28,060,838 - 28,091,563 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 28,238,677 - 28,269,414 (-) NCBI UU_Cfam_GSD_1.0
Cyth4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 10,662,060 - 10,694,093 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 3,679,716 - 3,697,771 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 3,678,299 - 3,703,787 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CYTH4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 10,489,289 - 10,521,735 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 10,491,202 - 10,521,583 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 8,074,091 - 8,104,464 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CYTH4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 19,989,081 - 20,021,545 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 20,001,934 - 20,021,539 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 105,806,480 - 105,839,003 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cyth4
.
Predicted Target Of
Count of predictions: 151 Count of miRNA genes: 127 Interacting mature miRNAs: 134 Transcripts: ENSRNOT00000056221 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
BE107924
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 110,168,724 - 110,168,883 (+) MAPPER mRatBN7.2 Rnor_6.0 7 119,836,987 - 119,837,145 NCBI Rnor6.0 Rnor_5.0 7 119,825,925 - 119,826,083 UniSTS Rnor5.0 RGSC_v3.4 7 116,574,199 - 116,574,357 UniSTS RGSC3.4 Celera 7 106,506,226 - 106,506,384 UniSTS RH 3.4 Map 7 818.3 UniSTS Cytogenetic Map 7 q34 UniSTS
AA893106
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 110,151,351 - 110,151,443 (+) MAPPER mRatBN7.2 Rnor_6.0 7 119,819,616 - 119,819,707 NCBI Rnor6.0 Rnor_5.0 7 119,808,554 - 119,808,645 UniSTS Rnor5.0 RGSC_v3.4 7 116,556,873 - 116,556,964 UniSTS RGSC3.4 Celera 7 106,488,855 - 106,488,946 UniSTS RH 3.4 Map 7 817.2 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000056221 ⟹ ENSRNOP00000053065
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 110,152,276 - 110,176,741 (+) Ensembl Rnor_6.0 Ensembl 7 119,820,540 - 119,845,003 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000077256 ⟹ ENSRNOP00000071361
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 110,152,276 - 110,176,741 (+) Ensembl Rnor_6.0 Ensembl 7 119,820,537 - 119,844,668 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105447 ⟹ ENSRNOP00000076651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 110,152,272 - 110,176,741 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107283 ⟹ ENSRNOP00000091539
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 110,152,276 - 110,160,142 (+) Ensembl
RefSeq Acc Id:
NM_001130577 ⟹ NP_001124049
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,032,782 - 112,057,204 (+) NCBI mRatBN7.2 7 110,152,302 - 110,176,726 (+) NCBI Rnor_6.0 7 119,820,540 - 119,845,003 (+) NCBI Rnor_5.0 7 119,809,471 - 119,833,941 (+) NCBI RGSC_v3.4 7 116,557,797 - 116,582,215 (+) RGD Celera 7 106,489,779 - 106,514,242 (+) RGD
Sequence:
TTGACTGGTCCTGGTGGCTACCCACCAGAGCAGCCTCTGAGCCAGCAAGACAAGCAGCTGGGCCGCCTTCCCCCGGGGGCTTCAGAATGGATGTATGTCATGCAGATACAGCTGAGCTCAGCAGTGGC
hide sequence
RefSeq Acc Id:
NM_001414977 ⟹ NP_001401906
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,032,782 - 112,057,204 (+) NCBI mRatBN7.2 7 110,152,302 - 110,176,726 (+) NCBI
RefSeq Acc Id:
XM_017595057 ⟹ XP_017450546
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,032,756 - 112,057,204 (+) NCBI mRatBN7.2 7 110,152,274 - 110,176,726 (+) NCBI Rnor_6.0 7 119,820,534 - 119,844,988 (+) NCBI
Sequence:
GGGGCCTTGACTGGTCCTGGTGGCTACCCACCAGAGCAGCCTCTGAGCCAGCAAGACAAGCAGCTGGGCCGCCTTCCCCCGGGGGCTTCAGAATGGATGTATGTCATGCAGGGGTCTCTCCAGCAGCC
hide sequence
RefSeq Acc Id:
XM_039079763 ⟹ XP_038935691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,032,711 - 112,057,204 (+) NCBI mRatBN7.2 7 110,152,232 - 110,176,726 (+) NCBI
RefSeq Acc Id:
XM_063264137 ⟹ XP_063120207
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,032,752 - 112,057,204 (+) NCBI
RefSeq Acc Id:
XM_063264138 ⟹ XP_063120208
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,032,768 - 112,057,204 (+) NCBI
RefSeq Acc Id:
XM_063264139 ⟹ XP_063120209
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,032,768 - 112,057,204 (+) NCBI
RefSeq Acc Id:
XM_063264140 ⟹ XP_063120210
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,032,770 - 112,057,204 (+) NCBI
RefSeq Acc Id:
NP_001124049 ⟸ NM_001130577
- Peptide Label:
isoform 2
- UniProtKB:
D3ZHR6 (UniProtKB/TrEMBL), A6HSL5 (UniProtKB/TrEMBL)
- Sequence:
MYVMQIQLSSAVARPGSYSRSNGTGSSYWRTSSRMAQKEKEMCIGRKKFNMDPAKGIQYLTEHKLLTSDVQDIAQFLYKGEGLNKTAIGTYLGEKDPINLQVLQAFVDCHEFANLNLVQALRQFLWSF
hide sequence
RefSeq Acc Id:
XP_017450546 ⟸ XM_017595057
- Peptide Label:
isoform X2
- Sequence:
MYVMQGSLQQPWGTEPNNPPLSPDTAELSSGEARELQQIKWHRKQLLEDIQKLKDEIADVFAQIDCFESTEESRMAQKEKEMCIGRKKFNMDPAKGIQYLTEHKLLTSDVQDIAQFLYKGEGLNKTAI
hide sequence
Ensembl Acc Id:
ENSRNOP00000071361 ⟸ ENSRNOT00000077256
Ensembl Acc Id:
ENSRNOP00000053065 ⟸ ENSRNOT00000056221
RefSeq Acc Id:
XP_038935691 ⟸ XM_039079763
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K0A0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000076651 ⟸ ENSRNOT00000105447
Ensembl Acc Id:
ENSRNOP00000091539 ⟸ ENSRNOT00000107283
RefSeq Acc Id:
NP_001401906 ⟸ NM_001414977
- Peptide Label:
isoform 1
- UniProtKB:
A6HSL4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120207 ⟸ XM_063264137
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063120208 ⟸ XM_063264138
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063120209 ⟸ XM_063264139
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I5ZK46 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120210 ⟸ XM_063264140
- Peptide Label:
isoform X6
RGD ID: 13695467 Promoter ID: EPDNEW_R5991 Type: single initiation site Name: Cyth4_1 Description: cytohesin 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 119,820,566 - 119,820,626 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-11-04
Cyth4
cytohesin 4
Pscd4
pleckstrin homology, Sec7 and coiled/coil domains 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Pscd4
pleckstrin homology, Sec7 and coiled/coil domains 4
RGD1564842_predicted
similar to cytohesin-4 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1564842_predicted
similar to cytohesin-4 (predicted)
LOC500906
similar to cytohesin-4
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC500906
similar to cytohesin-4
Symbol and Name status set to provisional
70820 PROVISIONAL
