Symbol:
Hmcn1
Name:
hemicentin 1
RGD ID:
1564772
Description:
Predicted to enable axon guidance receptor activity. Predicted to be involved in several processes, including actin cytoskeleton organization; basement membrane organization; and homophilic cell adhesion via plasma membrane adhesion molecules. Predicted to act upstream of or within response to bacterium. Predicted to be located in several cellular components, including basement membrane; cell cortex; and muscle tendon junction. Predicted to be active in axon; neuronal cell body; and plasma membrane. Human ortholog(s) of this gene implicated in age related macular degeneration 1. Orthologous to human HMCN1 (hemicentin 1); INTERACTS WITH (+)-schisandrin B; 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
hemicentin-1; LOC289094; RGD1564772; similar to OTTHUMP00000065631
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HMCN1 (hemicentin 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Hmcn1 (hemicentin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hmcn1 (hemicentin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HMCN1 (hemicentin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HMCN1 (hemicentin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hmcn1 (hemicentin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HMCN1 (hemicentin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HMCN1 (hemicentin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hmcn1 (hemicentin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HMCN2 (hemicentin 2) HGNC
Panther
Alliance orthologs 3
Homo sapiens (human):
HMCN1 (hemicentin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Hmcn1 (hemicentin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hmcn1 (hemicentin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
him-4
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
hmcn1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 65,165,532 - 65,634,681 (-) NCBI GRCr8 mRatBN7.2 13 62,615,461 - 63,084,524 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 62,615,461 - 63,084,524 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 65,251,755 - 65,716,143 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 66,522,976 - 66,980,354 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 63,789,725 - 64,243,174 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 67,799,791 - 68,360,664 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 67,799,791 - 68,360,664 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 72,762,698 - 72,782,812 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 13 72,887,371 - 73,322,089 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 65,296,682 - 65,779,372 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 62,569,267 - 63,028,084 (-) NCBI Celera Cytogenetic Map 13 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hmcn1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of HMCN1 mRNA] CTD PMID:31150632 Hmcn1 Rat 1,2-dichloroethane decreases expression ISO RGD:1618686 6480464 ethylene dichloride results in decreased expression of HMCN1 mRNA CTD PMID:28960355 Hmcn1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1618686 6480464 1,2-Dimethylhydrazine results in decreased expression of HMCN1 mRNA CTD PMID:22206623 Hmcn1 Rat 1,3-dinitrobenzene decreases expression EXP 6480464 3-dinitrobenzene results in decreased expression of HMCN1 mRNA CTD PMID:21983209 Hmcn1 Rat 17beta-estradiol multiple interactions ISO RGD:1605323 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of HMCN1 mRNA; [Raloxifene Hydrochloride co-treated more ... CTD PMID:21185374|PMID:30165855 Hmcn1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1618686 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of HMCN1 mRNA CTD PMID:31388691 Hmcn1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1618686 6480464 Tetrachlorodibenzodioxin results in decreased expression of HMCN1 mRNA CTD PMID:21889950 Hmcn1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HMCN1 mRNA CTD PMID:32109520 Hmcn1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1618686 6480464 bisphenol S results in increased expression of HMCN1 mRNA CTD PMID:30951980 Hmcn1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1618686 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of HMCN1 mRNA CTD PMID:30951980 Hmcn1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of HMCN1 mRNA CTD PMID:31881176 Hmcn1 Rat aflatoxin B1 decreases methylation ISO RGD:1605323 6480464 Aflatoxin B1 results in decreased methylation of HMCN1 gene CTD PMID:27153756 Hmcn1 Rat aflatoxin B1 increases methylation ISO RGD:1605323 6480464 Aflatoxin B1 results in increased methylation of HMCN1 intron CTD PMID:30157460 Hmcn1 Rat all-trans-retinoic acid multiple interactions ISO RGD:1618686 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of HMCN1 mRNA; [bisphenol S co-treated more ... CTD PMID:30951980 Hmcn1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of HMCN1 mRNA CTD PMID:35163327 Hmcn1 Rat aristolochic acid A decreases expression ISO RGD:1605323 6480464 aristolochic acid I results in decreased expression of HMCN1 mRNA CTD PMID:33212167 Hmcn1 Rat arsane decreases expression ISO RGD:1618686 6480464 Arsenic results in decreased expression of HMCN1 mRNA CTD PMID:19654921 Hmcn1 Rat arsane multiple interactions ISO RGD:1618686 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased secretion of HMCN1 more ... CTD PMID:37527016 Hmcn1 Rat arsenic atom decreases expression ISO RGD:1618686 6480464 Arsenic results in decreased expression of HMCN1 mRNA CTD PMID:19654921 Hmcn1 Rat arsenic atom multiple interactions ISO RGD:1618686 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased secretion of HMCN1 more ... CTD PMID:37527016 Hmcn1 Rat benzo[a]pyrene decreases expression ISO RGD:1618686 6480464 Benzo(a)pyrene results in decreased expression of HMCN1 mRNA CTD PMID:21569818 Hmcn1 Rat benzo[a]pyrene decreases expression ISO RGD:1605323 6480464 Benzo(a)pyrene results in decreased expression of HMCN1 mRNA CTD PMID:32234424 Hmcn1 Rat benzo[a]pyrene increases methylation ISO RGD:1618686 6480464 Benzo(a)pyrene results in increased methylation of HMCN1 intron CTD PMID:27901495 Hmcn1 Rat benzo[a]pyrene affects methylation ISO RGD:1605323 6480464 Benzo(a)pyrene affects the methylation of HMCN1 intron CTD PMID:30157460 Hmcn1 Rat benzo[a]pyrene increases methylation ISO RGD:1605323 6480464 Benzo(a)pyrene results in increased methylation of HMCN1 promoter CTD PMID:27901495 Hmcn1 Rat benzo[a]pyrene increases expression ISO RGD:1618686 6480464 Benzo(a)pyrene results in increased expression of HMCN1 mRNA CTD PMID:32417428 Hmcn1 Rat benzo[a]pyrene multiple interactions ISO RGD:1618686 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Hmcn1 Rat benzo[a]pyrene affects expression ISO RGD:1605323 6480464 Benzo(a)pyrene affects the expression of HMCN1 mRNA CTD PMID:21714911 Hmcn1 Rat benzo[b]fluoranthene multiple interactions ISO RGD:1618686 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Hmcn1 Rat benzo[e]pyrene increases methylation ISO RGD:1605323 6480464 benzo(e)pyrene results in increased methylation of HMCN1 intron CTD PMID:30157460 Hmcn1 Rat Benzo[k]fluoranthene decreases expression ISO RGD:1618686 6480464 benzo(k)fluoranthene results in decreased expression of HMCN1 mRNA CTD PMID:26377693 Hmcn1 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1618686 6480464 Diethylhexyl Phthalate results in increased expression of HMCN1 mRNA CTD PMID:28085963 Hmcn1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HMCN1 mRNA CTD PMID:25181051|PMID:34947998 Hmcn1 Rat bisphenol A decreases expression ISO RGD:1605323 6480464 bisphenol A results in decreased expression of HMCN1 mRNA CTD PMID:36232920 Hmcn1 Rat bisphenol A decreases expression ISO RGD:1618686 6480464 bisphenol A results in decreased expression of HMCN1 mRNA CTD PMID:38074096 Hmcn1 Rat bisphenol A affects methylation ISO RGD:1605323 6480464 bisphenol A affects the methylation of HMCN1 gene CTD PMID:31601247 Hmcn1 Rat bisphenol A increases expression ISO RGD:1618686 6480464 bisphenol A results in increased expression of HMCN1 mRNA CTD PMID:30245210|PMID:30951980 Hmcn1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HMCN1 mRNA CTD PMID:30816183 Hmcn1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of HMCN1 gene CTD PMID:28505145 Hmcn1 Rat bisphenol F multiple interactions ISO RGD:1618686 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of HMCN1 mRNA CTD PMID:30951980 Hmcn1 Rat bisphenol F decreases expression ISO RGD:1618686 6480464 bisphenol F results in decreased expression of HMCN1 mRNA CTD PMID:38685157 Hmcn1 Rat bisphenol F increases expression ISO RGD:1618686 6480464 bisphenol F results in increased expression of HMCN1 mRNA CTD PMID:30951980 Hmcn1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of HMCN1 mRNA CTD PMID:33453195 Hmcn1 Rat calcitriol increases expression ISO RGD:1605323 6480464 Calcitriol results in increased expression of HMCN1 mRNA CTD PMID:16002434 Hmcn1 Rat carbon nanotube decreases expression ISO RGD:1618686 6480464 Nanotubes, Carbon analog results in decreased expression of HMCN1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Hmcn1 Rat CGP 52608 multiple interactions ISO RGD:1605323 6480464 CGP 52608 promotes the reaction [RORA protein binds to HMCN1 gene] CTD PMID:28238834 Hmcn1 Rat chloroprene decreases expression ISO RGD:1618686 6480464 Chloroprene results in decreased expression of HMCN1 mRNA CTD PMID:23125180 Hmcn1 Rat choline multiple interactions ISO RGD:1618686 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Hmcn1 Rat chrysene multiple interactions ISO RGD:1618686 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Hmcn1 Rat cisplatin increases response to substance ISO RGD:1605323 6480464 HMCN1 mRNA results in increased susceptibility to Cisplatin CTD PMID:25199881 Hmcn1 Rat daidzein multiple interactions ISO RGD:1605323 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with more ... CTD PMID:27424125 Hmcn1 Rat daidzein 7-O-beta-D-glucoside multiple interactions ISO RGD:1605323 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with more ... CTD PMID:27424125 Hmcn1 Rat dexamethasone decreases expression ISO RGD:1605323 6480464 Dexamethasone results in decreased expression of HMCN1 mRNA CTD PMID:25047013 Hmcn1 Rat dioxygen multiple interactions ISO RGD:1618686 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of HMCN1 mRNA CTD PMID:30529165 Hmcn1 Rat diquat decreases expression ISO RGD:1618686 6480464 Diquat results in decreased expression of HMCN1 mRNA CTD PMID:36851058 Hmcn1 Rat dorsomorphin multiple interactions ISO RGD:1605323 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Hmcn1 Rat doxorubicin increases response to substance ISO RGD:1605323 6480464 HMCN1 mRNA results in increased susceptibility to Doxorubicin CTD PMID:25199881 Hmcn1 Rat ethanol increases expression ISO RGD:1605323 6480464 Ethanol results in increased expression of HMCN1 mRNA CTD PMID:31059573 Hmcn1 Rat folic acid multiple interactions ISO RGD:1618686 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Hmcn1 Rat genistein multiple interactions ISO RGD:1605323 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with more ... CTD PMID:27424125 Hmcn1 Rat genistein increases expression ISO RGD:1618686 6480464 Genistein results in increased expression of HMCN1 mRNA CTD PMID:32186404 Hmcn1 Rat genistein 7-O-beta-D-glucoside multiple interactions ISO RGD:1605323 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with more ... CTD PMID:27424125 Hmcn1 Rat glycitein multiple interactions ISO RGD:1605323 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with more ... CTD PMID:27424125 Hmcn1 Rat glycitin multiple interactions ISO RGD:1605323 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with more ... CTD PMID:27424125 Hmcn1 Rat L-methionine multiple interactions ISO RGD:1618686 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Hmcn1 Rat Lasiocarpine decreases expression ISO RGD:1605323 6480464 lasiocarpine results in decreased expression of HMCN1 mRNA CTD PMID:32234424 Hmcn1 Rat methapyrilene increases methylation ISO RGD:1605323 6480464 Methapyrilene results in increased methylation of HMCN1 intron CTD PMID:30157460 Hmcn1 Rat methotrexate increases response to substance ISO RGD:1605323 6480464 HMCN1 mRNA results in increased susceptibility to Methotrexate CTD PMID:25199881 Hmcn1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of HMCN1 gene CTD PMID:35440735 Hmcn1 Rat methylmercury chloride decreases expression ISO RGD:1605323 6480464 methylmercuric chloride results in decreased expression of HMCN1 mRNA CTD PMID:28001369 Hmcn1 Rat mono(2-ethylhexyl) phthalate decreases expression ISO RGD:1605323 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of HMCN1 mRNA CTD PMID:36695872 Hmcn1 Rat nickel atom decreases expression ISO RGD:1605323 6480464 Nickel results in decreased expression of HMCN1 mRNA CTD PMID:24768652|PMID:25583101 Hmcn1 Rat O-methyleugenol decreases expression ISO RGD:1605323 6480464 methyleugenol results in decreased expression of HMCN1 mRNA CTD PMID:32234424 Hmcn1 Rat ochratoxin A increases expression ISO RGD:1605323 6480464 ochratoxin A results in increased expression of HMCN1 mRNA CTD PMID:30559759 Hmcn1 Rat ozone multiple interactions ISO RGD:1618686 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:27106289|PMID:34911549 Hmcn1 Rat ozone decreases expression ISO RGD:1618686 6480464 Ozone results in decreased expression of HMCN1 mRNA CTD PMID:33026818 Hmcn1 Rat paclitaxel increases response to substance ISO RGD:1605323 6480464 HMCN1 mRNA results in increased susceptibility to Paclitaxel CTD PMID:25199881 Hmcn1 Rat paracetamol increases expression ISO RGD:1605323 6480464 Acetaminophen results in increased expression of HMCN1 mRNA CTD PMID:26690555 Hmcn1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of HMCN1 mRNA CTD PMID:33387578 Hmcn1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of HMCN1 mRNA CTD PMID:32680482 Hmcn1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of HMCN1 mRNA CTD PMID:35163327 Hmcn1 Rat progesterone decreases expression ISO RGD:1605323 6480464 Progesterone results in decreased expression of HMCN1 mRNA CTD PMID:21795739 Hmcn1 Rat raloxifene multiple interactions ISO RGD:1605323 6480464 [Raloxifene Hydrochloride co-treated with Estradiol] results in increased expression of HMCN1 mRNA CTD PMID:21185374 Hmcn1 Rat SB 431542 multiple interactions ISO RGD:1605323 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Hmcn1 Rat sodium arsenite increases expression ISO RGD:1605323 6480464 sodium arsenite results in increased expression of HMCN1 mRNA CTD PMID:38568856 Hmcn1 Rat sodium arsenite multiple interactions ISO RGD:1618686 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased secretion of HMCN1 more ... CTD PMID:37527016 Hmcn1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of HMCN1 mRNA] CTD PMID:31150632 Hmcn1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of HMCN1 mRNA CTD PMID:31150632 Hmcn1 Rat tetraphene multiple interactions ISO RGD:1618686 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Hmcn1 Rat topotecan increases response to substance ISO RGD:1605323 6480464 HMCN1 mRNA results in increased susceptibility to Topotecan CTD PMID:25199881 Hmcn1 Rat trichostatin A increases expression ISO RGD:1605323 6480464 trichostatin A results in increased expression of HMCN1 mRNA CTD PMID:24935251|PMID:26272509 Hmcn1 Rat trichostatin A multiple interactions ISO RGD:1605323 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Hmcn1 Rat triclosan decreases expression ISO RGD:1605323 6480464 Triclosan results in decreased expression of HMCN1 mRNA CTD PMID:30510588 Hmcn1 Rat trimellitic anhydride decreases expression ISO RGD:1618686 6480464 trimellitic anhydride results in decreased expression of HMCN1 mRNA CTD PMID:19042947 Hmcn1 Rat triptonide increases expression ISO RGD:1618686 6480464 triptonide results in increased expression of HMCN1 mRNA CTD PMID:33045310 Hmcn1 Rat valproic acid affects expression ISO RGD:1605323 6480464 Valproic Acid affects the expression of HMCN1 mRNA CTD PMID:25979313 Hmcn1 Rat valproic acid decreases expression ISO RGD:1605323 6480464 Valproic Acid results in decreased expression of HMCN1 mRNA CTD PMID:28001369 Hmcn1 Rat valproic acid multiple interactions ISO RGD:1605323 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Hmcn1 Rat valproic acid increases expression ISO RGD:1605323 6480464 Valproic Acid results in increased expression of HMCN1 mRNA CTD PMID:24383497|PMID:24935251|PMID:26272509 Hmcn1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of HMCN1 mRNA CTD PMID:23555832 Hmcn1 Rat vincristine increases response to substance ISO RGD:1605323 6480464 HMCN1 mRNA results in increased susceptibility to Vincristine CTD PMID:25199881 Hmcn1 Rat xylitol increases expression ISO RGD:1605323 6480464 Xylitol results in increased expression of HMCN1 mRNA CTD PMID:32275922 Hmcn1 Rat zoledronic acid decreases expression ISO RGD:1605323 6480464 zoledronic acid results in decreased expression of HMCN1 mRNA CTD PMID:24714768
(+)-schisandrin B (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) Benzo[k]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (ISO) choline (ISO) chrysene (ISO) cisplatin (ISO) daidzein (ISO) daidzein 7-O-beta-D-glucoside (ISO) dexamethasone (ISO) dioxygen (ISO) diquat (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) folic acid (ISO) genistein (ISO) genistein 7-O-beta-D-glucoside (ISO) glycitein (ISO) glycitin (ISO) L-methionine (ISO) Lasiocarpine (ISO) methapyrilene (ISO) methotrexate (ISO) methoxychlor (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) nickel atom (ISO) O-methyleugenol (ISO) ochratoxin A (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctanoic acid (EXP) progesterone (ISO) raloxifene (ISO) SB 431542 (ISO) sodium arsenite (ISO) tetrachloromethane (EXP) tetraphene (ISO) topotecan (ISO) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) xylitol (ISO) zoledronic acid (ISO)
Hmcn1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 65,165,532 - 65,634,681 (-) NCBI GRCr8 mRatBN7.2 13 62,615,461 - 63,084,524 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 62,615,461 - 63,084,524 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 65,251,755 - 65,716,143 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 66,522,976 - 66,980,354 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 63,789,725 - 64,243,174 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 67,799,791 - 68,360,664 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 67,799,791 - 68,360,664 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 72,762,698 - 72,782,812 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 13 72,887,371 - 73,322,089 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 65,296,682 - 65,779,372 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 62,569,267 - 63,028,084 (-) NCBI Celera Cytogenetic Map 13 q21 NCBI
HMCN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 185,734,391 - 186,190,949 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 185,734,391 - 186,190,949 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 185,703,523 - 186,160,081 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 183,970,306 - 184,426,708 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 158,814,385 - 159,270,786 (+) NCBI Celera Cytogenetic Map 1 q25.3-q31.1 NCBI HuRef 1 156,938,491 - 157,394,637 (+) NCBI HuRef CHM1_1 1 187,122,845 - 187,579,213 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 185,089,079 - 185,545,614 (+) NCBI T2T-CHM13v2.0
Hmcn1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 150,438,251 - 150,869,568 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 150,438,275 - 150,869,186 (-) Ensembl GRCm39 Ensembl GRCm38 1 150,562,500 - 150,993,652 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 150,562,524 - 150,993,435 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 150,488,170 - 150,802,827 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 152,635,966 - 152,755,653 (-) NCBI MGSCv36 mm8 Celera 1 153,006,498 - 153,437,575 (-) NCBI Celera Cytogenetic Map 1 G1 NCBI cM Map 1 63.84 NCBI
Hmcn1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 24,229,973 - 24,622,314 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 24,229,666 - 24,623,341 (+) NCBI ChiLan1.0 ChiLan1.0
HMCN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 63,529,719 - 63,992,614 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 63,211,135 - 63,673,640 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 161,254,948 - 161,717,526 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 165,407,909 - 165,870,219 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 165,522,384 - 165,869,148 (+) Ensembl panpan1.1 panPan2
HMCN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 18,798,802 - 19,254,847 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 18,798,796 - 19,253,786 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 18,318,234 - 18,776,558 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 18,532,233 - 18,990,765 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 18,532,242 - 18,990,049 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 18,440,588 - 18,897,706 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 18,548,519 - 19,007,053 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 18,679,642 - 19,137,567 (+) NCBI UU_Cfam_GSD_1.0
Hmcn1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 86,365,905 - 86,743,041 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 4,213,631 - 4,589,464 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 4,212,713 - 4,494,469 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HMCN1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 126,850,313 - 127,342,685 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 126,850,208 - 127,342,696 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 139,722,309 - 139,770,641 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HMCN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 43,230,265 - 43,677,315 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 43,231,328 - 43,554,097 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 44,419,653 - 44,876,647 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hmcn1
.
Predicted Target Of
Count of predictions: 119 Count of miRNA genes: 69 Interacting mature miRNAs: 71 Transcripts: ENSRNOT00000030971 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 2303028 Bp329 Blood pressure QTL 329 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 58497872 73485113 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat
D13Got234
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 13 65,213,411 - 65,213,677 (+) Marker Load Pipeline mRatBN7.2 13 62,663,372 - 62,663,638 (+) MAPPER mRatBN7.2 Rnor_6.0 13 67,948,041 - 67,948,306 NCBI Rnor6.0 Rnor_5.0 13 72,909,200 - 72,909,465 UniSTS Rnor5.0 RGSC_v3.4 13 65,346,001 - 65,346,266 UniSTS RGSC3.4 Celera 13 62,617,160 - 62,617,425 UniSTS Cytogenetic Map 13 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030971 ⟹ ENSRNOP00000033710
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 62,616,476 - 63,084,524 (-) Ensembl Rnor_6.0 Ensembl 13 67,799,791 - 68,360,664 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076697 ⟹ ENSRNOP00000068149
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 13 67,799,791 - 67,926,222 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076776 ⟹ ENSRNOP00000067981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 62,641,251 - 62,977,282 (-) Ensembl Rnor_6.0 Ensembl 13 67,926,219 - 68,253,251 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093469
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 62,615,461 - 63,084,524 (-) Ensembl Rnor_6.0 Ensembl 13 67,799,800 - 68,360,552 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093666 ⟹ ENSRNOP00000076253
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 13 67,800,968 - 67,819,835 (-) Ensembl
RefSeq Acc Id:
NM_001271292 ⟹ NP_001258221
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,165,532 - 65,634,519 (-) NCBI mRatBN7.2 13 62,615,461 - 63,084,524 (-) NCBI Rnor_6.0 13 67,799,791 - 68,360,664 (-) NCBI Rnor_5.0 13 72,762,698 - 72,782,812 (-) NCBI Rnor_5.0 13 72,887,371 - 73,322,089 (-) NCBI Celera 13 62,569,267 - 63,028,084 (-) NCBI
Sequence:
AGTCGCTGGCCTGGAGCGCGGCGGCGGCGGAGGCGGCACCGCAGGCTCGCAGCGTCCCCGGGGCATGGACCCGGCGCTCTGCCGGCACTCGGCTACTCGCAGCTCCCTGCACGCGGCCGCCTAGAGCC
hide sequence
RefSeq Acc Id:
XM_039090456 ⟹ XP_038946384
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,165,532 - 65,575,754 (-) NCBI mRatBN7.2 13 62,615,461 - 63,026,663 (-) NCBI
RefSeq Acc Id:
XM_039090457 ⟹ XP_038946385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,165,532 - 65,634,681 (-) NCBI mRatBN7.2 13 62,615,461 - 63,084,515 (-) NCBI
RefSeq Acc Id:
XM_039090458 ⟹ XP_038946386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,165,532 - 65,634,681 (-) NCBI mRatBN7.2 13 62,615,461 - 63,084,515 (-) NCBI
RefSeq Acc Id:
XM_039090459 ⟹ XP_038946387
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,165,532 - 65,575,754 (-) NCBI mRatBN7.2 13 62,615,461 - 63,026,663 (-) NCBI
RefSeq Acc Id:
XM_039090460 ⟹ XP_038946388
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,165,532 - 65,414,498 (-) NCBI mRatBN7.2 13 62,615,461 - 62,891,492 (-) NCBI
RefSeq Acc Id:
XM_039090461 ⟹ XP_038946389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,262,279 - 65,634,681 (-) NCBI mRatBN7.2 13 62,712,246 - 63,084,515 (-) NCBI
RefSeq Acc Id:
NP_001258221 ⟸ NM_001271292
- Peptide Label:
precursor
- UniProtKB:
F1M4Q3 (UniProtKB/TrEMBL)
- Sequence:
MIAQELVHTVFLVALFHSSLAGVGTPQSESRAEEIPEGASTLAFVFDVTGSMYDDLVQVIEGASKILETSLKRPKRPLYNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPEMSVGAIKI
hide sequence
Ensembl Acc Id:
ENSRNOP00000076253 ⟸ ENSRNOT00000093666
Ensembl Acc Id:
ENSRNOP00000033710 ⟸ ENSRNOT00000030971
Ensembl Acc Id:
ENSRNOP00000068149 ⟸ ENSRNOT00000076697
Ensembl Acc Id:
ENSRNOP00000067981 ⟸ ENSRNOT00000076776
RefSeq Acc Id:
XP_038946385 ⟸ XM_039090457
- Peptide Label:
isoform X2
- UniProtKB:
F1M4Q3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946386 ⟸ XM_039090458
- Peptide Label:
isoform X3
- UniProtKB:
F1M4Q3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946387 ⟸ XM_039090459
- Peptide Label:
isoform X4
- UniProtKB:
F1M4Q3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946384 ⟸ XM_039090456
- Peptide Label:
isoform X1
- UniProtKB:
F1M4Q3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946388 ⟸ XM_039090460
- Peptide Label:
isoform X5
- UniProtKB:
F1M4Q3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946389 ⟸ XM_039090461
- Peptide Label:
isoform X6
RGD ID: 13698883 Promoter ID: EPDNEW_R9406 Type: single initiation site Name: Hmcn1_1 Description: hemicentin 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 68,360,660 - 68,360,720 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Hmcn1
hemicentin 1
Hmcn1_predicted
hemicentin 1 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Hmcn1_predicted
hemicentin 1 (predicted)
RGD1564772_predicted
similar to OTTHUMP00000065631 (predicted)
Symbol and Name updated
1299863 APPROVED
2006-03-07
RGD1564772_predicted
similar to OTTHUMP00000065631 (predicted)
LOC289094
similar to OTTHUMP00000065631
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC289094
similar to OTTHUMP00000065631
Symbol and Name status set to provisional
70820 PROVISIONAL
