Epb41l4b (erythrocyte membrane protein band 4.1 like 4B)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Epb41l4b (erythrocyte membrane protein band 4.1 like 4B) Rattus norvegicus

Analyze

Symbol:

Epb41l4b

Name:

erythrocyte membrane protein band 4.1 like 4B

RGD ID:

1562988

Description:

Predicted to enable cytoskeletal protein binding activity. Predicted to be involved in several processes, including actomyosin structure organization; positive regulation of keratinocyte migration; and wound healing. Predicted to be located in apical part of cell; cytosol; and plasma membrane. Predicted to be active in cytoskeleton. Orthologous to human EPB41L4B (erythrocyte membrane protein band 4.1 like 4B); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

band 4.1-like protein 4B; LOC500464; RGD1562988; similar to EHM2

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	71,691,706 - 71,852,583 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	71,694,331 - 71,851,990 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	73,579,659 - 73,742,868 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	75,410,983 - 75,571,368 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	75,383,056 - 75,543,452 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	74,030,950 - 74,192,275 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	74,030,882 - 74,191,167 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	78,259,811 - 78,344,848 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	74,972,597 - 75,059,096 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	70,548,863 - 70,608,478 (-)	NCBI		Celera
Celera	5	70,618,652 - 70,703,659 (-)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxyphenyl retinamide (ISO)

7,12-dimethyltetraphene (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

casticin (ISO)

CGP 52608 (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

elemental selenium (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

glyphosate (EXP)

indometacin (ISO)

lead(0) (ISO)

leflunomide (ISO)

maneb (ISO)

methapyrilene (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

nefazodone (EXP)

nickel atom (ISO)

oxaliplatin (EXP)

paracetamol (ISO)

paraquat (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylephrine (EXP)

potassium chromate (ISO)

progesterone (ISO)

SB 431542 (ISO)

selenium atom (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

topotecan (EXP)

tremolite asbestos (ISO)

trichostatin A (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actomyosin structure organization (IBA,IEA,ISO)

positive regulation of cell adhesion (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of keratinocyte migration (IEA,ISO)

regulation of keratinocyte proliferation (ISO)

wound healing (IEA,ISO)

Cellular Component

apical part of cell (IEA,ISO)

bicellular tight junction (IEA)

cytoplasm (ISO)

cytoskeleton (IBA,IEA)

cytosol (IEA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

cytoskeletal protein binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:22006950	PMID:23664528

Genomics

Comparative Map Data

Epb41l4b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	71,691,706 - 71,852,583 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	71,694,331 - 71,851,990 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	73,579,659 - 73,742,868 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	75,410,983 - 75,571,368 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	75,383,056 - 75,543,452 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	74,030,950 - 74,192,275 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	74,030,882 - 74,191,167 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	78,259,811 - 78,344,848 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	74,972,597 - 75,059,096 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	70,548,863 - 70,608,478 (-)	NCBI		Celera
Celera	5	70,618,652 - 70,703,659 (-)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

EPB41L4B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	109,171,974 - 109,321,059 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	109,171,974 - 109,321,059 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	111,934,254 - 112,083,339 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	110,974,075 - 111,122,842 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	82,433,463 - 82,582,331 (-)	NCBI		Celera
Cytogenetic Map	9	q31.3	NCBI
HuRef	9	81,534,383 - 81,682,900 (-)	NCBI		HuRef
CHM1_1	9	112,080,755 - 112,230,021 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	121,341,055 - 121,490,407 (-)	NCBI		T2T-CHM13v2.0

Epb41l4b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	56,991,977 - 57,143,753 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	56,991,972 - 57,143,437 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	56,991,972 - 57,143,168 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	56,991,972 - 57,143,437 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	57,074,598 - 57,156,028 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	57,089,660 - 57,251,234 (-)	NCBI		MGSCv36	mm8
Celera	4	56,971,790 - 57,053,159 (-)	NCBI		Celera
Cytogenetic Map	4	B3	NCBI
cM Map	4	31.66	NCBI

Epb41l4b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	17,686,882 - 17,823,605 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	17,686,096 - 17,821,884 (+)	NCBI	ChiLan1.0	ChiLan1.0

EPB41L4B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	30,089,255 - 30,239,746 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	80,324,948 - 80,401,283 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	108,496,690 - 108,650,645 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	108,499,267 - 108,604,576 (-)	Ensembl	panpan1.1		panPan2

EPB41L4B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	64,312,716 - 64,439,117 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	64,312,802 - 64,407,412 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	62,713,675 - 62,840,170 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	65,446,475 - 65,573,331 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	65,446,078 - 65,574,026 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	63,965,575 - 64,091,945 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	63,987,800 - 64,114,603 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	64,678,447 - 64,805,309 (-)	NCBI		UU_Cfam_GSD_1.0

Epb41l4b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	179,546,685 - 179,684,395 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936559	3,587,379 - 3,716,883 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936559	3,582,190 - 3,717,407 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EPB41L4B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	250,226,595 - 250,368,846 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	250,226,592 - 250,368,897 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	280,755,888 - 280,879,154 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EPB41L4B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	30,230,214 - 30,381,295 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	30,230,724 - 30,382,212 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	12,303,113 - 12,455,585 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Epb41l4b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	2,221,581 - 2,362,458 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	2,221,600 - 2,361,572 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Epb41l4b
866 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	84
Count of miRNA genes:	67
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000015114
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat

Markers in Region

RH128855

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	71,766,321 - 71,766,515 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	74,105,550 - 74,105,743	NCBI	Rnor6.0
Rnor_5.0	5	78,259,870 - 78,260,063	UniSTS	Rnor5.0
RGSC_v3.4	5	74,972,656 - 74,972,849	UniSTS	RGSC3.4
Celera	5	70,618,711 - 70,618,904	UniSTS
RH 3.4 Map	5	482.1	UniSTS
Cytogenetic Map	5	q24	UniSTS

AU048092

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	71,847,244 - 71,847,396 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	74,186,434 - 74,186,585	NCBI	Rnor6.0
Rnor_5.0	5	78,340,253 - 78,340,404	UniSTS	Rnor5.0
RGSC_v3.4	5	75,054,501 - 75,054,652	UniSTS	RGSC3.4
Celera	5	70,699,152 - 70,699,303	UniSTS
Cytogenetic Map	5	q24	UniSTS

AU049474

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	71,844,376 - 71,844,596 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	74,183,566 - 74,183,785	NCBI	Rnor6.0
Rnor_5.0	5	78,337,385 - 78,337,604	UniSTS	Rnor5.0
RGSC_v3.4	5	75,051,633 - 75,051,852	UniSTS	RGSC3.4
Celera	5	70,696,288 - 70,696,503	UniSTS
Cytogenetic Map	5	q24	UniSTS

MARC_21252-21253:1032892750:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	71,780,900 - 71,781,164 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	74,120,129 - 74,120,392	NCBI	Rnor6.0
Rnor_5.0	5	78,274,449 - 78,274,712	UniSTS	Rnor5.0
RGSC_v3.4	5	74,987,235 - 74,987,498	UniSTS	RGSC3.4
Celera	5	70,633,284 - 70,633,547	UniSTS
Cytogenetic Map	5	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	2	1	1		1			29	12	7	4
Low	1	41	53	40	13	40	7	8	45	23	34	7	7
Below cutoff			3		6		1	3					1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001127565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001401792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017603008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110571	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110572	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110573	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005504513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000088169 ⟹ ENSRNOP00000068924

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	71,766,264 - 71,851,990 (-)	Ensembl
Rnor_6.0 Ensembl	5	74,105,492 - 74,191,167 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000090366 ⟹ ENSRNOP00000072639

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	71,694,331 - 71,851,990 (-)	Ensembl
Rnor_6.0 Ensembl	5	74,030,882 - 74,190,991 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102034 ⟹ ENSRNOP00000088752

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	71,694,331 - 71,851,990 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112787 ⟹ ENSRNOP00000086223

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	71,766,264 - 71,851,990 (-)	Ensembl

RefSeq Acc Id:

NM_001127565 ⟹ NP_001121037

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	71,765,409 - 71,852,583 (-)	NCBI
Rnor_6.0	5	74,105,491 - 74,191,167 (-)	NCBI
Rnor_5.0	5	78,259,811 - 78,344,848 (-)	NCBI
RGSC_v3.4	5	74,972,597 - 75,059,096 (-)	RGD
Celera	5	70,618,652 - 70,703,659 (-)	RGD

Sequence:

show sequence

CCCCCGGCCAGGATGCTGCGGTTCCTGCGCCGGACCTTTGGCCGCCGCTCCATGCAGCGCTACG
CGCGGGGCGCGGCGGGGCGCGGGGCCGCCGGGCTGGGGGACGAGCGCGACGGGGGGCCGCGAGG
GGGCCCGGCCGCCGCCGCCAGCTCCTCCGTGCTGCCCGCCGCGCCCGGGGGTAGCGTGTTCCCG
GCCGGCGGCGGGCCCCTGCTCACCGGCGGCGCGGCTGTGCACATCTCCGCCTCGGGAGCTGCCA
AGGCCACCCTTTACTGCCGTGTCTTCCTGCTCGACGGAACCGAAGTGAGCGTGGACCTGCCGAA
ACATGCCAAAGGCCAGGATTTGTTCGACCAGATTGTGTACCACTTGGACCTGGTGGAAACAGAT
TATTTTGGTCTGCAGTTTCTCGACTCCGCCCAGGTCACGCACTGGCTGGATCACTCGAAACCCA
TAAAGAAGCAGATGAAAGTCGGACCTGCCTACGCTTTGCACTTTCGAGTCAAATACTATTCTTC
AGAACCGAACAACCTTCGAGAGGAATTTACAAGGTACCTGTTTGTTCTACAACTCAGGCATGAC
ATTCTTTCTGGAAAACTGAAGTGCCCCTATGAAACAGCCGTGGAACTAGCTGCCCTCTGTCTGC
AAGCGGAGCTAGGAGAGTGTGAGCTCCCGGAACACACACCGGAGCTTGTGTCTGAGTTTCGGTT
CATCCCAAATCAGACAGAAGCCATGGAGTTCGATATCTTCCAGAGATGGAAAGAGTACAGGGGA
AAGAGCCCTGCCCAGGCGGAACTCTCCTATCTGAACAAAGCGAAGTGGCTGGAAATGTATGGGG
TGGACATGCATGTTGTCAGGGGAAGAGATGGCTGTGAATATTCTCTTGGACTGACCCCGACAGG
CATATTAATCTTTGAAGGAGCTAACAAAATAGGCTTATTCTTTTGGCCTAAGATCACCAAAATG
GACTTTAAAAAGAGCAAACTGACCCTCGTGGTAGTGGAGGATGACGACCAGGGGCGTGAGCAAG
AGCACACCTTCGTGTTCAGGCTGGACAGCGCGCGCACCTGCAAGCACCTGTGGAAGTGCGCTGT
GGAGCACCACGCCTTCTTCCGTCTGCGCACGCCCAGCAACAGCAAGTCCGCCAGATCCGACTTC
ATCCGGCTGGGTTCCCGCTTCCGGTTCAGTGGACGGACAGAATATCAAGCTACACACGGCTCCA
GATTGCGAAGAACCAGCACCTTTGAGAGGAAGCCTAGCAAACGTTACCCTTCCCGGCGACATTC
CACATTCAAAGCGAGCAACCCAGTGATTGCTGCCCAGCTCTGCTCTAAAACAAATCCTGAAGTC
CATAACTACCAGCCTCAGTTTCATCCTAACGTCCACCCCAGCCAGCCCAGGTGGCGCCCTCACT
CCCCAAATGTCAGTAACCATTCCACCTGCAAACAAAACAAGCCGTCTTTTCAGGATGACAGGCC
GCACTGGAAAGCCTCAGCCAGTGGAGATGACGGCCACTTTGACTATGTCCACGACCAGAACCAG
AGGAACTTAGGAGGGGCGTACAGTGTCACATACCGGGACAAACTCATGACCGCACTTTGAGAGA
CTGAAGCCTCTTCTGGTCACCACCATGGTGCCGCTGTATTCCATGAGAAGCGTCCTGGAATCGC
ATGGATGCTTTCGTACAAGTGTCATTAGTGCTTTTGGTGTCTGTGCAAACATTTGAAGATGACT
ACCGTAGATAGCCATGATTTACTGTGGACTGCATTCTCAATAATGAAGTAGCTAAAGGCTCAGG
AATCATTTCGATATGCTGATTTTAAAGCTGAAGTAAAAGTCCCTACCGTCATGTTAGGTACCTG
ATAGTTTGGTTGTTTAACCAGTGGGACCACATAAAGCAAGCCAGCAAACCCAAAGGCTTGGGGA
AACAGCTTAGCACAGAGTACTGTGGTTAGGAATGGAGATTGACAGGGACCAGCCTCCCTTGCTG
TGAGACCTTCGCTAGATCGTTCTCCTTTCTTTGGTTTCATTTCCTCCATGAAAATAATGGGCTG
GGCTAAGTGATCCCCAAGGTCCTTTCTATTCTGTGCTCTGTTAAGATTTTACTTCTCATTCGGG
CTGAGAACACGCATCCAGACTAACTCACCATAAGGGCAAATGTCACACCCCTTCTGTAACAGAA
GCTCAATAAAGATTATAAAACTCAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001401792 ⟹ NP_001388721

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	71,691,706 - 71,852,583 (-)	NCBI

RefSeq Acc Id:

XM_039110571 ⟹ XP_038966499

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	71,691,706 - 71,852,039 (-)	NCBI

RefSeq Acc Id:

XM_039110572 ⟹ XP_038966500

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	71,691,706 - 71,852,039 (-)	NCBI

RefSeq Acc Id:

XM_039110573 ⟹ XP_038966501

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	71,691,706 - 71,852,039 (-)	NCBI

RefSeq Acc Id:

XR_005504513

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	71,742,924 - 71,852,039 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001121037	(Get FASTA)	NCBI Sequence Viewer
	NP_001388721	(Get FASTA)	NCBI Sequence Viewer
	XP_038966499	(Get FASTA)	NCBI Sequence Viewer
	XP_038966500	(Get FASTA)	NCBI Sequence Viewer
	XP_038966501	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66749	(Get FASTA)	NCBI Sequence Viewer
	B2RYE5	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000068924
	ENSRNOP00000072639
	ENSRNOP00000072639.2
	ENSRNOP00000086223.1
	ENSRNOP00000088752
	ENSRNOP00000088752.1

RefSeq Acc Id:	NP_001121037 ⟸ NM_001127565
- Peptide Label:	isoform 2
- UniProtKB:	B2RYE5 (UniProtKB/Swiss-Prot), A0A0G2JU16 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSVLPAAPGGSVFPAGGG PLLTGGAAVHISASGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVETDYFGL QFLDSAQVTHWLDHSKPIKKQMKVGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSG KLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKEYRGKSPA QAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKK SKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPSNSKSARSDFIRLG SRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTNPEVHNYQ PQFHPNVHPSQPRWRPHSPNVSNHSTCKQNKPSFQDDRPHWKASASGDDGHFDYVHDQNQRNLG GAYSVTYRDKLMTAL hide sequence

RefSeq Acc Id:

ENSRNOP00000072639 ⟸ ENSRNOT00000090366

RefSeq Acc Id:

ENSRNOP00000068924 ⟸ ENSRNOT00000088169

RefSeq Acc Id:	XP_038966500 ⟸ XM_039110572
- Peptide Label:	isoform X2
- UniProtKB:	A0A0G2K3H4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038966501 ⟸ XM_039110573
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038966499 ⟸ XM_039110571
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000088752 ⟸ ENSRNOT00000102034

RefSeq Acc Id:

ENSRNOP00000086223 ⟸ ENSRNOT00000112787

RefSeq Acc Id:	NP_001388721 ⟸ NM_001401792
- Peptide Label:	isoform 1
- UniProtKB:	A0A8I6AAH9 (UniProtKB/TrEMBL)

Protein Domains

FERM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RYE5-F1-model_v2	AlphaFold	B2RYE5	1-527	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693756

Promoter ID:

EPDNEW_R4281

Type:

multiple initiation site

Name:

Epb41l4b_1

Description:

erythrocyte membrane protein band 4.1 like 4B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	74,191,118 - 74,191,178	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562988	AgrOrtholog
BioCyc Gene	G2FUF-41212	BioCyc
Ensembl Genes	ENSRNOG00000056550	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000088169	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOT00000090366	ENTREZGENE
	ENSRNOT00000090366.2	UniProtKB/TrEMBL
	ENSRNOT00000102034	ENTREZGENE
	ENSRNOT00000102034.1	UniProtKB/TrEMBL
	ENSRNOT00000112787.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.80.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.30.29.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5599589	IMAGE-MGC_LOAD
InterPro	Band4.1-like4B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Band_41_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ez/rad/moesin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM-adjacent	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM/acyl-CoA-bd_prot_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_central	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_PH-like_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:500464	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188486	IMAGE-MGC_LOAD
NCBI Gene	500464	ENTREZGENE
PANTHER	4.1 G PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR23280:SF18	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	FERM_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_M	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PF08736	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Epb41l4b	PhenoGen
PRINTS	BAND41	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERMFAMILY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	FERM_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000056550	RatGTEx
SMART	B41	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FERM_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM01195	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF47031	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF54236	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JU16	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2K3H4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A1T8_RAT	UniProtKB/TrEMBL
	A0A8I6AAH9	ENTREZGENE, UniProtKB/TrEMBL
	B2RYE5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	RGD1562988	similar to EHM2	RGD1562988_predicted	similar to EHM2 (predicted)	'predicted' is removed	2292626	APPROVED
2008-01-09	RGD1562988_predicted	similar to EHM2 (predicted)	LOC682100	similar to erythrocyte membrane protein band 4.1 like 4B isoform 2	Data merged from RGD:1586984	1643240	APPROVED
2006-11-19	LOC682100	similar to erythrocyte membrane protein band 4.1 like 4B isoform 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-07	RGD1562988_predicted	similar to EHM2 (predicted)	LOC500464	similar to EHM2	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500464	similar to EHM2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar