Symbol:
Snapin
Name:
SNAP-associated protein
RGD ID:
1560377
Description:
Predicted to enable SNARE binding activity. Predicted to be involved in several processes, including anterograde synaptic vesicle transport; endosome to lysosome transport; and synaptic vesicle exocytosis. Predicted to act upstream of or within several processes, including lysosomal lumen acidification; terminal button organization; and vesicle organization. Located in secretory granule. Is active in glutamatergic synapse and synaptic vesicle. Orthologous to human SNAPIN (SNAP associated protein); INTERACTS WITH acetamide; bisphenol A; cadmium dichloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
biogenesis of lysosome-related organelles complex 1 subunit 7; BLOC-1 subunit 7; MGC112927; Snapap; SNARE associated protein snapin; SNARE-associated protein Snapin; synaptosomal-associated protein 25-binding protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SNAPIN (SNAP associated protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Snapin (SNAP-associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Snapin (SNAP associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SNAPIN (SNAP associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SNAPIN (SNAP associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Snapin (SNAP associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SNAPIN (SNAP associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SNAPIN (SNAP associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Snapin (SNAP associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SNAPIN (SNAP associated protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Snapin (SNAP-associated protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snapin (SNAP associated protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Snapin
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
snpn-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 178,269,157 - 178,271,746 (-) NCBI GRCr8 mRatBN7.2 2 175,971,575 - 175,974,164 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 175,971,257 - 175,974,231 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 183,111,652 - 183,114,246 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 181,133,916 - 181,136,510 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 175,734,232 - 175,736,824 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 189,878,159 - 189,880,743 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 189,878,168 - 189,880,743 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 209,309,032 - 209,311,616 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 182,762,310 - 182,764,481 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 169,907,172 - 169,909,756 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Snapin Rat (-)-epigallocatechin 3-gallate multiple interactions ISO SNAPIN (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SNAPIN mRNA CTD PMID:22079256 Snapin Rat (1->4)-beta-D-glucan multiple interactions ISO Snapin (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SNAPIN mRNA CTD PMID:36331819 Snapin Rat 1,2-dimethylhydrazine multiple interactions ISO Snapin (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SNAPIN mRNA CTD PMID:22206623 Snapin Rat 17beta-estradiol decreases expression ISO SNAPIN (Homo sapiens) 6480464 Estradiol results in decreased expression of SNAPIN mRNA CTD PMID:23019147 Snapin Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Snapin (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Snapin Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Snapin (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Snapin Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Snapin (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SNAPIN mRNA CTD PMID:21570461 Snapin Rat 2-hydroxypropanoic acid decreases expression ISO SNAPIN (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SNAPIN mRNA CTD PMID:30851411 Snapin Rat 3-methylcholanthrene multiple interactions ISO SNAPIN (Homo sapiens) 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to SNAPIN promoter] CTD PMID:20348232 Snapin Rat 4,4'-sulfonyldiphenol decreases expression ISO Snapin (Mus musculus) 6480464 bisphenol S results in decreased expression of SNAPIN mRNA CTD PMID:37611474 Snapin Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of SNAPIN mRNA CTD PMID:31881176 Snapin Rat acrylamide decreases expression ISO Snapin (Mus musculus) 6480464 Acrylamide results in decreased expression of SNAPIN mRNA CTD PMID:29261810 Snapin Rat aristolochic acid A decreases expression ISO SNAPIN (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SNAPIN mRNA CTD PMID:33212167 Snapin Rat Aroclor 1254 decreases expression ISO Snapin (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of SNAPIN mRNA CTD PMID:23650126 Snapin Rat bis(2-ethylhexyl) phthalate increases expression ISO Snapin (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SNAPIN mRNA CTD PMID:33754040 Snapin Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SNAPIN mRNA CTD PMID:25181051 Snapin Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SNAPIN mRNA CTD PMID:34947998 Snapin Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of SNAPIN mRNA CTD PMID:33453195 Snapin Rat cadmium dichloride decreases expression ISO SNAPIN (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SNAPIN mRNA CTD PMID:38568856 Snapin Rat caffeine affects phosphorylation ISO SNAPIN (Homo sapiens) 6480464 Caffeine affects the phosphorylation of SNAPIN protein CTD PMID:35688186 Snapin Rat carbon nanotube decreases expression ISO Snapin (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Snapin Rat CGP 52608 multiple interactions ISO SNAPIN (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SNAPIN gene] CTD PMID:28238834 Snapin Rat copper(II) sulfate decreases expression ISO SNAPIN (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SNAPIN mRNA CTD PMID:19549813 Snapin Rat cyclosporin A decreases expression ISO SNAPIN (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SNAPIN mRNA CTD PMID:25562108 Snapin Rat Dibutyl phosphate affects expression ISO SNAPIN (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SNAPIN mRNA CTD PMID:37042841 Snapin Rat dioxygen multiple interactions ISO Snapin (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of SNAPIN mRNA CTD PMID:30529165 Snapin Rat doxorubicin decreases expression ISO SNAPIN (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SNAPIN mRNA CTD PMID:29803840 Snapin Rat enzyme inhibitor multiple interactions ISO SNAPIN (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of SNAPIN protein CTD PMID:23301498 Snapin Rat ethanol multiple interactions ISO Snapin (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of SNAPIN mRNA CTD PMID:30319688 Snapin Rat fluoranthene multiple interactions ISO Snapin (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of SNAPIN mRNA CTD PMID:28329830 Snapin Rat folic acid decreases expression ISO Snapin (Mus musculus) 6480464 Folic Acid results in decreased expression of SNAPIN mRNA CTD PMID:25629700 Snapin Rat folic acid multiple interactions ISO Snapin (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SNAPIN mRNA CTD PMID:22206623 Snapin Rat FR900359 decreases phosphorylation ISO SNAPIN (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of SNAPIN protein CTD PMID:37730182 Snapin Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SNAPIN mRNA CTD PMID:22061828 Snapin Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SNAPIN mRNA CTD PMID:33387578 Snapin Rat hexadecanoic acid increases phosphorylation ISO SNAPIN (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of SNAPIN protein CTD PMID:28073184 Snapin Rat hydrogen peroxide affects expression ISO SNAPIN (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of SNAPIN mRNA CTD PMID:20044591 Snapin Rat isoprenaline decreases expression ISO Snapin (Mus musculus) 6480464 Isoproterenol results in decreased expression of SNAPIN mRNA CTD PMID:20003209 Snapin Rat ivermectin decreases expression ISO SNAPIN (Homo sapiens) 6480464 Ivermectin results in decreased expression of SNAPIN protein CTD PMID:32959892 Snapin Rat lipopolysaccharide multiple interactions ISO SNAPIN (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of SNAPIN mRNA CTD PMID:35877022 Snapin Rat methylmercury chloride decreases expression ISO SNAPIN (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SNAPIN mRNA CTD PMID:28001369 Snapin Rat methylmercury chloride decreases expression ISO Snapin (Mus musculus) 6480464 methylmercuric chloride results in decreased expression of SNAPIN mRNA CTD PMID:29261810 Snapin Rat nickel atom decreases expression ISO SNAPIN (Homo sapiens) 6480464 Nickel results in decreased expression of SNAPIN mRNA CTD PMID:23195993 Snapin Rat paracetamol affects expression ISO Snapin (Mus musculus) 6480464 Acetaminophen affects the expression of SNAPIN mRNA CTD PMID:17562736 Snapin Rat PCB138 multiple interactions ISO Snapin (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Snapin Rat perfluorohexanesulfonic acid increases expression ISO Snapin (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of SNAPIN mRNA CTD PMID:37995155 Snapin Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Snapin (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SNAPIN mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of SNAPIN mRNA CTD PMID:36331819 Snapin Rat pirinixic acid multiple interactions ISO SNAPIN (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of SNAPIN mRNA CTD PMID:19710929 Snapin Rat potassium chromate decreases expression ISO SNAPIN (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of SNAPIN mRNA CTD PMID:22079256 Snapin Rat potassium chromate multiple interactions ISO SNAPIN (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SNAPIN mRNA CTD PMID:22079256 Snapin Rat rac-lactic acid decreases expression ISO SNAPIN (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SNAPIN mRNA CTD PMID:30851411 Snapin Rat resveratrol multiple interactions ISO SNAPIN (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of SNAPIN mRNA CTD PMID:23557933 Snapin Rat silicon dioxide decreases expression ISO Snapin (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of SNAPIN mRNA CTD PMID:19073995 Snapin Rat sulforaphane multiple interactions ISO Snapin (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of SNAPIN mRNA CTD PMID:30529165 Snapin Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of SNAPIN mRNA CTD PMID:34492290 Snapin Rat thiram decreases expression ISO SNAPIN (Homo sapiens) 6480464 Thiram results in decreased expression of SNAPIN mRNA CTD PMID:38568856 Snapin Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of SNAPIN mRNA CTD PMID:24136188 Snapin Rat valproic acid affects expression ISO SNAPIN (Homo sapiens) 6480464 Valproic Acid affects the expression of SNAPIN mRNA CTD PMID:25979313 Snapin Rat valproic acid decreases expression ISO Snapin (Mus musculus) 6480464 Valproic Acid results in decreased expression of SNAPIN mRNA CTD PMID:29261810
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) cadmium dichloride (EXP,ISO) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (ISO) fluoranthene (ISO) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) hexadecanoic acid (ISO) hydrogen peroxide (ISO) isoprenaline (ISO) ivermectin (ISO) lipopolysaccharide (ISO) methylmercury chloride (ISO) nickel atom (ISO) paracetamol (ISO) PCB138 (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) potassium chromate (ISO) rac-lactic acid (ISO) resveratrol (ISO) silicon dioxide (ISO) sulforaphane (ISO) thioacetamide (EXP) thiram (ISO) tolcapone (EXP) valproic acid (ISO)
Biological Process
anterograde axonal transport (ISO,ISS) anterograde synaptic vesicle transport (ISO,ISS) autophagosome maturation (ISO) chemical synaptic transmission (ISO) endosome to lysosome transport (IBA,IEA,ISO) establishment of vesicle localization (ISO) exocytosis (IEA) intracellular protein transport (IEA) late endosome to lysosome transport (ISO) lysosomal lumen acidification (ISO) lysosome localization (IBA,IEA,ISO,ISS) lysosome organization (IBA,ISO) negative regulation of neuron projection development (ISO) neuron cellular homeostasis (ISO) neuron projection development (ISS) protein maturation (ISO) protein-containing complex localization (ISO) regulation of synaptic vesicle exocytosis (ISO) retrograde axonal transport (ISO) synaptic vesicle exocytosis (IBA,IEA,ISO) synaptic vesicle fusion to presynaptic active zone membrane (ISO) synaptic vesicle maturation (ISO) synaptic vesicle transport (IBA,IEA,ISO,ISS) terminal button organization (ISO)
Cellular Component
acrosomal vesicle (ISO) axon cytoplasm (IEA) BLOC-1 complex (IBA,IEA,ISO,ISS) BORC complex (IEA,ISO,ISS) cytoplasm (IEA) cytoplasmic vesicle (IEA,ISO) cytosol (IEA,ISO) glutamatergic synapse (IDA) Golgi apparatus (IEA) Golgi membrane (IEA) lysosomal membrane (IEA) lysosome (IEA) manchette (ISO) membrane (IEA) microvesicle (ISO) perinuclear region of cytoplasm (IEA,ISO,ISS) presynapse (IDA) secretory granule (IBA,IDA) synapse (IEA,ISO) synaptic vesicle (IBA,IDA,IEA,IEP,ISO) synaptic vesicle membrane (IEA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
The dystonia-associated protein torsinA modulates synaptic vesicle recycling.
Granata A, etal., J Biol Chem. 2008 Mar 21;283(12):7568-79. doi: 10.1074/jbc.M704097200. Epub 2007 Dec 31.
3.
Snapin: a SNARE-associated protein implicated in synaptic transmission.
Ilardi JM, etal., Nat Neurosci. 1999 Feb;2(2):119-24. doi: 10.1038/5673.
4.
Clusterin interacts with SCLIP (SCG10-like protein) and promotes neurite outgrowth of PC12 cells.
Kang SW, etal., Exp Cell Res. 2005 Oct 1;309(2):305-15.
5.
The TRPM7 ion channel functions in cholinergic synaptic vesicles and affects transmitter release.
Krapivinsky G, etal., Neuron. 2006 Nov 9;52(3):485-96.
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
EBAG9 adds a new layer of control on large dense-core vesicle exocytosis via interaction with Snapin.
Ruder C, etal., Mol Biol Cell. 2005 Mar;16(3):1245-57. Epub 2005 Jan 5.
9.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.
EHD1 is a synaptic protein that modulates exocytosis through binding to snapin.
Wei S, etal., Mol Cell Neurosci. 2010 Dec;45(4):418-29. doi: 10.1016/j.mcn.2010.07.014. Epub 2010 Aug 6.
Snapin Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 178,269,157 - 178,271,746 (-) NCBI GRCr8 mRatBN7.2 2 175,971,575 - 175,974,164 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 175,971,257 - 175,974,231 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 183,111,652 - 183,114,246 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 181,133,916 - 181,136,510 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 175,734,232 - 175,736,824 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 189,878,159 - 189,880,743 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 189,878,168 - 189,880,743 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 209,309,032 - 209,311,616 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 182,762,310 - 182,764,481 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 169,907,172 - 169,909,756 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
SNAPIN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 153,658,654 - 153,661,852 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 153,658,703 - 153,661,852 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 153,631,130 - 153,634,328 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 151,897,824 - 151,900,930 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 150,444,272 - 150,447,378 NCBI Celera 1 126,702,324 - 126,705,505 (+) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 124,994,466 - 124,997,664 (+) NCBI HuRef CHM1_1 1 155,027,119 - 155,030,317 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 152,795,919 - 152,799,117 (+) NCBI T2T-CHM13v2.0
Snapin Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 90,395,333 - 90,398,320 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 90,395,333 - 90,398,340 (-) Ensembl GRCm39 Ensembl GRCm38 3 90,488,026 - 90,491,013 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 90,488,026 - 90,491,033 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 90,291,948 - 90,294,935 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 90,573,961 - 90,576,931 (-) NCBI MGSCv36 mm8 Celera 3 90,525,872 - 90,528,858 (-) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 39.24 NCBI
Snapin Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955545 306,546 - 308,229 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955545 306,546 - 308,229 (+) NCBI ChiLan1.0 ChiLan1.0
SNAPIN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 96,170,659 - 96,173,840 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 95,903,764 - 95,909,036 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 129,014,668 - 129,018,428 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 132,644,319 - 132,647,095 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 132,644,320 - 132,647,095 (+) Ensembl panpan1.1 panPan2
SNAPIN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 43,410,554 - 43,411,929 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 43,410,998 - 43,412,323 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 42,903,507 - 42,904,962 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 43,360,183 - 43,361,638 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 43,358,154 - 43,362,026 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 43,062,261 - 43,063,711 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 43,115,755 - 43,117,214 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 43,399,406 - 43,400,865 (-) NCBI UU_Cfam_GSD_1.0
Snapin Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 24,433,043 - 24,436,084 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 3,462,987 - 3,464,214 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 3,449,585 - 3,464,709 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SNAPIN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 95,984,358 - 95,989,474 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 95,987,524 - 95,989,527 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 104,880,697 - 104,882,699 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SNAPIN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 10,147,577 - 10,150,721 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 10,148,099 - 10,150,641 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 9,524,858 - 9,528,002 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Snapin
.
Predicted Target Of
Count of predictions: 134 Count of miRNA genes: 118 Interacting mature miRNAs: 123 Transcripts: ENSRNOT00000018830 Prediction methods: Miranda Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
RH134098
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 175,971,778 - 175,971,957 (+) MAPPER mRatBN7.2 Rnor_6.0 2 189,878,363 - 189,878,541 NCBI Rnor6.0 Rnor_5.0 2 209,309,236 - 209,309,414 UniSTS Rnor5.0 RGSC_v3.4 2 182,762,514 - 182,762,692 UniSTS RGSC3.4 Celera 2 169,907,376 - 169,907,554 UniSTS RH 3.4 Map 2 1163.1 UniSTS Cytogenetic Map 2 q34 UniSTS
RH141438
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 175,972,384 - 175,972,592 (+) MAPPER mRatBN7.2 Rnor_6.0 2 189,878,969 - 189,879,176 NCBI Rnor6.0 Rnor_5.0 2 209,309,842 - 209,310,049 UniSTS Rnor5.0 RGSC_v3.4 2 182,763,120 - 182,763,327 UniSTS RGSC3.4 Celera 2 169,907,982 - 169,908,189 UniSTS RH 3.4 Map 2 1162.4 UniSTS Cytogenetic Map 2 q34 UniSTS
AA799709
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 2 1168.21 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018830 ⟹ ENSRNOP00000018830
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 175,971,257 - 175,974,231 (-) Ensembl Rnor_6.0 Ensembl 2 189,878,168 - 189,880,743 (-) Ensembl
RefSeq Acc Id:
NM_001025648 ⟹ NP_001020819
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 178,269,157 - 178,271,746 (-) NCBI mRatBN7.2 2 175,971,575 - 175,974,164 (-) NCBI Rnor_6.0 2 189,878,159 - 189,880,330 (-) NCBI Rnor_5.0 2 209,309,032 - 209,311,616 (-) NCBI RGSC_v3.4 2 182,762,310 - 182,764,481 (-) RGD Celera 2 169,907,172 - 169,909,343 (-) NCBI
Sequence:
GTAGAGCTCCGGGAACAAATTGACAACCTAGCTACAGGTGAGTGAGCACCCAAAATACCTAGAATCCCTGATCTCGCTTTCAGGAACTGTTTTCCCAGGTTAGGCTAGGTTTCTGTCACTTGCTTCTC
hide sequence
RefSeq Acc Id:
NM_001170576 ⟹ NP_001164047
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 178,269,157 - 178,271,746 (-) NCBI mRatBN7.2 2 175,971,575 - 175,974,164 (-) NCBI Rnor_6.0 2 189,878,159 - 189,880,743 (-) NCBI Rnor_5.0 2 209,309,032 - 209,311,616 (-) NCBI Celera 2 169,907,172 - 169,909,756 (-) NCBI
Sequence:
GGCTGAGGGCGTCAGGGCAGTTCGCGATGGCCGCGGCTGGTTCCGCTGCCGTGTCTGGGGCCGGGACCCCAGTGGCGGGGCCCACAGGCCGCGACCTCTTTGCCGAGGGGCTCCTGGAGTTCCTGCGA
hide sequence
RefSeq Acc Id:
NP_001020819 ⟸ NM_001025648
- Peptide Label:
isoform 2
- UniProtKB:
Q4KM25 (UniProtKB/TrEMBL)
- Sequence:
MLVAHFLFTELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK
hide sequence
RefSeq Acc Id:
NP_001164047 ⟸ NM_001170576
- Peptide Label:
isoform 1
- UniProtKB:
P60192 (UniProtKB/Swiss-Prot), A6J6M5 (UniProtKB/TrEMBL)
- Sequence:
MAAAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGV
hide sequence
Ensembl Acc Id:
ENSRNOP00000018830 ⟸ ENSRNOT00000018830
RGD ID: 13691503 Promoter ID: EPDNEW_R2028 Type: initiation region Name: Snapin_1 Description: SNAP-associated protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 189,880,737 - 189,880,797 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-08-02
Snapin
SNAP-associated protein
Snapap
SNAP-associated protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Snapap
SNAP-associated protein
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
Snapap
SNAP-associated protein
Symbol and Name status set to provisional
70820 PROVISIONAL
