Symbol:
Brcc3
Name:
BRCA1/BRCA2-containing complex, subunit 3
RGD ID:
1557359
MGI Page
MGI
Description:
Enables metal-dependent deubiquitinase activity. Involved in chromatin remodeling; positive regulation of NLRP3 inflammasome complex assembly; and protein K63-linked deubiquitination. Predicted to be located in cytoplasm and nucleoplasm. Predicted to be part of BRCA1-A complex; BRISC complex; and nuclear ubiquitin ligase complex. Is expressed in central nervous system and genitourinary system. Orthologous to human BRCC3 (BRCA1/BRCA2-containing complex subunit 3).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
6.1A protein; BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 3; BRCA1/BRCA2-containing complex subunit 36; BRISC complex subunit BRCC36; C6.1; C6.1A; lys-63-specific deubiquitinase BRCC36; MGC29148
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Gm12598
Gm18884
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 74,460,234 - 74,499,307 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 74,460,234 - 74,497,607 (+) Ensembl GRCm39 Ensembl GRCm38 X 75,416,628 - 75,455,702 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 75,416,628 - 75,454,001 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 72,661,967 - 72,701,040 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 71,669,420 - 71,706,717 (+) NCBI MGSCv36 mm8 Celera X 66,818,616 - 66,858,058 (+) NCBI Celera Cytogenetic Map X A7.3 NCBI cM Map X 38.22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Brcc3 Mouse adrenoleukodystrophy ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Adrenoleukodystrophy ClinVar PMID:10480214|PMID:11748843|PMID:11968085|PMID:16427346|PMID:16601897|PMID:16684786|PMID:19396829|PMID:19846429|PMID:20730588|PMID:22281021|PMID:22382802|PMID:23409742|PMID:23660394|PMID:24365856|PMID:24962355|PMID:26471271|PMID:28492532|PMID:29334594|PMID:9384614 Brcc3 Mouse autistic disorder ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Autism, susceptibility to, X-linked 3 ClinVar PMID:21681106|PMID:30208311 Brcc3 Mouse autosomal hemophilia A ISO RGD:1344323 8554872 ClinVar Annotator: match by term: AUTOSOMAL HEMOPHILIA A ClinVar PMID:31690835 Brcc3 Mouse Barth syndrome ISO RGD:1344323 8554872 ClinVar Annotator: match by term: 3-Methylglutaconic aciduria type 2 ClinVar PMID:10480214|PMID:11748843|PMID:11968085|PMID:16427346|PMID:16601897|PMID:16684786|PMID:19396829|PMID:19846429|PMID:20730588|PMID:22281021|PMID:22382802|PMID:23409742|PMID:23660394|PMID:24365856|PMID:24962355|PMID:26471271|PMID:28492532|PMID:29334594|PMID:9384614 Brcc3 Mouse cerebral creatine deficiency syndrome 1 ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Creatine transporter deficiency ClinVar PMID:10480214|PMID:11748843|PMID:11968085|PMID:16427346|PMID:16601897|PMID:16684786|PMID:19396829|PMID:19846429|PMID:20730588|PMID:22281021|PMID:22382802|PMID:23409742|PMID:23660394|PMID:24365856|PMID:24962355|PMID:26471271|PMID:28492532|PMID:29334594|PMID:9384614 Brcc3 Mouse dyskeratosis congenita ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Dyskeratosis congenita ClinVar PMID:18177777|PMID:28492532 Brcc3 Mouse Emery-Dreifuss muscular dystrophy ISO RGD:1344323 8554872 ClinVar Annotator: match by term: X-linked Emery-Dreifuss muscular dystrophy ClinVar PMID:10480214|PMID:11748843|PMID:11968085|PMID:16427346|PMID:16601897|PMID:16684786|PMID:19396829|PMID:19846429|PMID:20730588|PMID:22281021|PMID:22382802|PMID:23409742|PMID:23660394|PMID:24365856|PMID:24962355|PMID:26471271|PMID:28492532|PMID:29334594|PMID:9384614 Brcc3 Mouse factor VIII deficiency ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Factor 8 deficiency, congenital ClinVar PMID:31690835 Brcc3 Mouse favism ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Anemia, nonspherocytic hemolytic, due to G6PD deficiency ClinVar PMID:18177777|PMID:28492532 Brcc3 Mouse Hereditary Neoplastic Syndromes ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome ClinVar Brcc3 Mouse Hereditary Neoplastic Syndromes ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome ClinVar PMID:25741868 Brcc3 Mouse immunodeficiency 33 ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Immunodeficiency 33 ClinVar PMID:25741868 Brcc3 Mouse paraplegia ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Spastic paraplegia ClinVar PMID:10480214|PMID:11748843|PMID:11968085|PMID:16427346|PMID:16601897|PMID:16684786|PMID:19396829|PMID:19846429|PMID:20730588|PMID:22281021|PMID:22382802|PMID:23409742|PMID:23660394|PMID:24365856|PMID:24962355|PMID:26471271|PMID:28492532|PMID:29334594|PMID:9384614 Brcc3 Mouse periventricular nodular heterotopia ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Heterotopia, periventricular, X-linked dominant ClinVar PMID:10480214|PMID:11748843|PMID:11968085|PMID:16427346|PMID:16601897|PMID:16684786|PMID:19396829|PMID:19846429|PMID:20730588|PMID:22281021|PMID:22382802|PMID:23409742|PMID:23660394|PMID:24365856|PMID:24962355|PMID:26471271|PMID:28492532|PMID:29334594|PMID:9384614 Brcc3 Mouse Splenomegaly ISO RGD:1344323 8554872 ClinVar Annotator: match by term: Splenomegaly ClinVar PMID:25741868
Only show annotations with direct experimental evidence (0 objects hidden)
Brcc3 Mouse (+)-catechin decreases expression ISO RGD:1344323 6480464 Catechin results in decreased expression of BRCC3 mRNA CTD PMID:15465739 Brcc3 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of BRCC3 mRNA CTD PMID:22206623 Brcc3 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of BRCC3 mRNA] CTD PMID:22206623 Brcc3 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of BRCC3 mRNA CTD PMID:17555576 Brcc3 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1344323 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of BRCC3 protein CTD PMID:31675489 Brcc3 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BRCC3 mRNA CTD PMID:19465110 Brcc3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1588543 6480464 Tetrachlorodibenzodioxin results in decreased expression of BRCC3 mRNA CTD PMID:33387578 Brcc3 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BRCC3 mRNA CTD PMID:21570461 Brcc3 Mouse 2,4,6-tribromophenol increases expression ISO RGD:1344323 6480464 2,4,6-tribromophenol results in increased expression of BRCC3 mRNA CTD PMID:31675489 Brcc3 Mouse 3,3',4,4'-tetrachlorobiphenyl multiple interactions EXP 6480464 3,4,3',4'-tetrachlorobiphenyl inhibits the reaction [Dietary Fats results in increased expression of BRCC3 mRNA] CTD PMID:19467301 Brcc3 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1344323 6480464 tetrabromobisphenol A results in decreased expression of BRCC3 protein CTD PMID:31675489 Brcc3 Mouse 3H-1,2-dithiole-3-thione decreases expression ISO RGD:1588543 6480464 1,2-dithiol-3-thione results in decreased expression of BRCC3 mRNA CTD PMID:19162173 Brcc3 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of BRCC3 mRNA CTD PMID:39298647 Brcc3 Mouse acetamide decreases expression ISO RGD:1588543 6480464 acetamide results in decreased expression of BRCC3 mRNA CTD PMID:31881176 Brcc3 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of BRCC3 mRNA CTD PMID:19770486 Brcc3 Mouse aflatoxin B1 decreases methylation ISO RGD:1344323 6480464 Aflatoxin B1 results in decreased methylation of BRCC3 gene CTD PMID:27153756 Brcc3 Mouse amiodarone increases expression ISO RGD:1344323 6480464 Amiodarone results in increased expression of BRCC3 mRNA CTD PMID:19774075 Brcc3 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of BRCC3 mRNA CTD PMID:19770486 Brcc3 Mouse benzo[a]pyrene increases methylation ISO RGD:1344323 6480464 Benzo(a)pyrene results in increased methylation of BRCC3 exon CTD PMID:27901495 Brcc3 Mouse benzo[a]pyrene affects methylation ISO RGD:1344323 6480464 Benzo(a)pyrene affects the methylation of BRCC3 5' UTR; Benzo(a)pyrene affects the methylation of BRCC3 promoter CTD PMID:27901495 Brcc3 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of BRCC3 mRNA CTD PMID:22228805 Brcc3 Mouse benzo[a]pyrene diol epoxide I increases expression ISO RGD:1344323 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of BRCC3 mRNA CTD PMID:26238291 Brcc3 Mouse biphenyl-4-amine multiple interactions ISO RGD:1344323 6480464 TP53 protein inhibits the reaction [4-biphenylamine results in decreased expression of BRCC3 mRNA] CTD PMID:32905825 Brcc3 Mouse biphenyl-4-amine decreases expression ISO RGD:1344323 6480464 4-biphenylamine results in decreased expression of BRCC3 mRNA CTD PMID:32905825 Brcc3 Mouse bisphenol A increases expression ISO RGD:1344323 6480464 bisphenol A results in increased expression of BRCC3 mRNA CTD PMID:22576693 Brcc3 Mouse bisphenol A decreases expression ISO RGD:1344323 6480464 bisphenol A results in decreased expression of BRCC3 protein CTD PMID:31675489 Brcc3 Mouse bisphenol A increases expression ISO RGD:1588543 6480464 bisphenol A results in increased expression of BRCC3 mRNA CTD PMID:32145629 Brcc3 Mouse bisphenol A decreases expression ISO RGD:1588543 6480464 bisphenol A results in decreased expression of BRCC3 mRNA CTD PMID:30816183|PMID:32528016|PMID:34947998 Brcc3 Mouse bisphenol A affects expression ISO RGD:1588543 6480464 bisphenol A affects the expression of BRCC3 mRNA CTD PMID:25181051 Brcc3 Mouse bortezomib decreases expression ISO RGD:1344323 6480464 Bortezomib results in decreased expression of BRCC3 mRNA CTD PMID:20977926 Brcc3 Mouse C60 fullerene decreases expression ISO RGD:1588543 6480464 fullerene C60 results in decreased expression of BRCC3 mRNA CTD PMID:19167457 Brcc3 Mouse cadmium dichloride decreases expression ISO RGD:1588543 6480464 Cadmium Chloride results in decreased expression of BRCC3 mRNA CTD PMID:33453195 Brcc3 Mouse cannabidiol decreases expression ISO RGD:1344323 6480464 Cannabidiol results in decreased expression of BRCC3 mRNA CTD PMID:27932991 Brcc3 Mouse CGP 52608 multiple interactions ISO RGD:1344323 6480464 CGP 52608 promotes the reaction [RORA protein binds to BRCC3 gene] CTD PMID:28238834 Brcc3 Mouse copper(II) sulfate decreases expression ISO RGD:1344323 6480464 Copper Sulfate results in decreased expression of BRCC3 mRNA CTD PMID:19549813 Brcc3 Mouse cyclosporin A decreases expression ISO RGD:1344323 6480464 Cyclosporine results in decreased expression of BRCC3 mRNA CTD PMID:25562108 Brcc3 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of BRCC3 mRNA CTD PMID:17361019|PMID:21266533 Brcc3 Mouse diuron decreases expression ISO RGD:1344323 6480464 Diuron results in decreased expression of BRCC3 mRNA CTD PMID:35967413 Brcc3 Mouse endosulfan increases expression ISO RGD:1588543 6480464 Endosulfan results in increased expression of BRCC3 mRNA CTD PMID:29391264 Brcc3 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of BRCC3 mRNA CTD PMID:30319688 Brcc3 Mouse fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of BRCC3 mRNA CTD PMID:21318169 Brcc3 Mouse fenofibrate multiple interactions EXP 6480464 [PPARA protein affects the susceptibility to Fenofibrate] which affects the expression of BRCC3 mRNA CTD PMID:21318169 Brcc3 Mouse flavonoids decreases expression ISO RGD:1344323 6480464 Flavonoids results in decreased expression of BRCC3 mRNA CTD PMID:15465739 Brcc3 Mouse folic acid multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of BRCC3 mRNA] CTD PMID:22206623 Brcc3 Mouse formaldehyde decreases expression ISO RGD:1344323 6480464 Formaldehyde results in decreased expression of BRCC3 mRNA CTD PMID:23649840 Brcc3 Mouse gallic acid decreases expression ISO RGD:1344323 6480464 Gallic Acid results in decreased expression of BRCC3 mRNA CTD PMID:34408198 Brcc3 Mouse gentamycin decreases expression ISO RGD:1588543 6480464 Gentamicins results in decreased expression of BRCC3 mRNA CTD PMID:33387578 Brcc3 Mouse ivermectin decreases expression ISO RGD:1344323 6480464 Ivermectin results in decreased expression of BRCC3 protein CTD PMID:32959892 Brcc3 Mouse methapyrilene decreases expression ISO RGD:1588543 6480464 Methapyrilene results in decreased expression of BRCC3 mRNA CTD PMID:30467583 Brcc3 Mouse methylmercury chloride decreases expression ISO RGD:1344323 6480464 methylmercuric chloride results in decreased expression of BRCC3 mRNA CTD PMID:28001369 Brcc3 Mouse nickel sulfate decreases expression ISO RGD:1344323 6480464 nickel sulfate results in decreased expression of BRCC3 mRNA CTD PMID:22714537 Brcc3 Mouse O-methyleugenol affects expression ISO RGD:1588543 6480464 methyleugenol affects the expression of BRCC3 mRNA CTD PMID:26011634 Brcc3 Mouse ochratoxin A decreases expression ISO RGD:1588543 6480464 ochratoxin A results in decreased expression of BRCC3 mRNA CTD PMID:23358140 Brcc3 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of BRCC3 mRNA CTD PMID:17562736 Brcc3 Mouse paracetamol decreases expression ISO RGD:1588543 6480464 Acetaminophen results in decreased expression of BRCC3 mRNA CTD PMID:33387578 Brcc3 Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of BRCC3 mRNA CTD PMID:23892564 Brcc3 Mouse perfluorohexanesulfonic acid increases expression EXP 6480464 perfluorohexanesulfonic acid results in increased expression of BRCC3 mRNA CTD PMID:37995155 Brcc3 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of BRCC3 mRNA CTD PMID:23091169 Brcc3 Mouse piroxicam decreases expression ISO RGD:1344323 6480464 Piroxicam results in decreased expression of BRCC3 mRNA CTD PMID:21858171 Brcc3 Mouse potassium chromate decreases expression ISO RGD:1344323 6480464 potassium chromate(VI) results in decreased expression of BRCC3 mRNA CTD PMID:22714537 Brcc3 Mouse pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:1588543 6480464 Pregnenolone Carbonitrile results in decreased expression of BRCC3 mRNA CTD PMID:19162173 Brcc3 Mouse promethazine decreases expression ISO RGD:1588543 6480464 Promethazine results in decreased expression of BRCC3 mRNA CTD PMID:26011634 Brcc3 Mouse resveratrol decreases expression ISO RGD:1588543 6480464 resveratrol results in decreased expression of BRCC3 mRNA CTD PMID:25905778 Brcc3 Mouse resveratrol multiple interactions ISO RGD:1344323 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of BRCC3 mRNA CTD PMID:23557933 Brcc3 Mouse SB 431542 multiple interactions ISO RGD:1344323 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of BRCC3 more ... CTD PMID:37664457 Brcc3 Mouse silicon dioxide decreases expression ISO RGD:1344323 6480464 Silicon Dioxide results in decreased expression of BRCC3 mRNA CTD PMID:34973136 Brcc3 Mouse sodium arsenite decreases expression ISO RGD:1344323 6480464 sodium arsenite results in decreased expression of BRCC3 mRNA CTD PMID:38568856 Brcc3 Mouse sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of BRCC3 mRNA CTD PMID:22155349 Brcc3 Mouse sunitinib decreases expression ISO RGD:1344323 6480464 Sunitinib results in decreased expression of BRCC3 mRNA CTD PMID:31533062 Brcc3 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of BRCC3 mRNA CTD PMID:17555576 Brcc3 Mouse thioacetamide affects expression ISO RGD:1588543 6480464 Thioacetamide affects the expression of BRCC3 mRNA CTD PMID:26011634 Brcc3 Mouse thiram decreases expression ISO RGD:1344323 6480464 Thiram results in decreased expression of BRCC3 mRNA CTD PMID:38568856 Brcc3 Mouse titanium dioxide increases expression ISO RGD:1344323 6480464 titanium dioxide results in increased expression of BRCC3 mRNA CTD PMID:34973136 Brcc3 Mouse torcetrapib increases expression ISO RGD:1344323 6480464 torcetrapib results in increased expression of BRCC3 mRNA CTD PMID:23228038 Brcc3 Mouse triphenyl phosphate affects expression ISO RGD:1344323 6480464 triphenyl phosphate affects the expression of BRCC3 mRNA CTD PMID:37042841 Brcc3 Mouse urethane decreases expression ISO RGD:1344323 6480464 Urethane results in decreased expression of BRCC3 mRNA CTD PMID:28818685
(+)-catechin (ISO) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',4,4'-tetrachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (EXP) acetamide (ISO) aflatoxin B1 (EXP,ISO) amiodarone (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) biphenyl-4-amine (ISO) bisphenol A (ISO) bortezomib (ISO) C60 fullerene (ISO) cadmium dichloride (ISO) cannabidiol (ISO) CGP 52608 (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dibutyl phthalate (EXP) diuron (ISO) endosulfan (ISO) ethanol (EXP) fenofibrate (EXP) flavonoids (ISO) folic acid (EXP) formaldehyde (ISO) gallic acid (ISO) gentamycin (ISO) ivermectin (ISO) methapyrilene (ISO) methylmercury chloride (ISO) nickel sulfate (ISO) O-methyleugenol (ISO) ochratoxin A (ISO) paracetamol (EXP,ISO) pentachlorophenol (EXP) perfluorohexanesulfonic acid (EXP) phenobarbital (EXP) piroxicam (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) promethazine (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sunitinib (ISO) tamoxifen (EXP) thioacetamide (ISO) thiram (ISO) titanium dioxide (ISO) torcetrapib (ISO) triphenyl phosphate (ISO) urethane (ISO)
1.
H2A-DUBbing the mammalian epigenome: expanding frontiers for histone H2A deubiquitinating enzymes in cell biology and physiology.
Belle JI and Nijnik A, Int J Biochem Cell Biol. 2014 May;50:161-74. doi: 10.1016/j.biocel.2014.03.004. Epub 2014 Mar 16.
2.
Mouse brain organization revealed through direct genome-scale TF expression analysis.
Gray PA, etal., Science 2004 Dec 24;306(5705):2255-7.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
miR-3940-5p associated with genetic damage in workers exposed to hexavalent chromium.
Li Y, etal., Toxicol Lett. 2014 Aug 17;229(1):319-26. doi: 10.1016/j.toxlet.2014.06.033. Epub 2014 Jun 25.
5.
MGDs mouse GO annotations
MGD data from the GO Consortium
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
Push back to respond better: regulatory inhibition of the DNA double-strand break response.
Panier S and Durocher D, Nat Rev Mol Cell Biol. 2013 Oct;14(10):661-72. doi: 10.1038/nrm3659. Epub 2013 Sep 4.
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Identification of genes differentially expressed in mouse fetuses from streptozotocin-induced diabetic pregnancy by cDNA subtraction.
Sato N, etal., Endocr J. 2008 May;55(2):317-23. Epub 2008 Mar 7.
Brcc3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 74,460,234 - 74,499,307 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 74,460,234 - 74,497,607 (+) Ensembl GRCm39 Ensembl GRCm38 X 75,416,628 - 75,455,702 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 75,416,628 - 75,454,001 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 72,661,967 - 72,701,040 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 71,669,420 - 71,706,717 (+) NCBI MGSCv36 mm8 Celera X 66,818,616 - 66,858,058 (+) NCBI Celera Cytogenetic Map X A7.3 NCBI cM Map X 38.22 NCBI
BRCC3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 155,071,508 - 155,123,077 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 155,071,420 - 155,123,077 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 154,299,783 - 154,351,352 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 153,952,904 - 154,004,543 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 153,863,504 - 153,915,052 NCBI Celera X 154,458,427 - 154,510,104 (+) NCBI Celera Cytogenetic Map X q28 NCBI HuRef X 142,845,949 - 142,896,583 (+) NCBI HuRef CHM1_1 X 154,211,322 - 154,263,032 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 153,307,916 - 153,359,479 (+) NCBI T2T-CHM13v2.0
Brcc3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 2,073,927 - 2,076,469 (+) NCBI GRCr8 mRatBN7.2 9 1,986,942 - 1,989,484 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 1,986,575 - 1,991,080 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 2,421,214 - 2,423,760 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 7,770,588 - 7,773,134 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,726,439 - 6,728,985 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 9,863,380 - 9,865,920 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 9,863,404 - 9,865,920 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 8,864,902 - 8,867,442 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 6,530,917 - 6,533,459 (-) NCBI Celera Cytogenetic Map 9 q11 NCBI
Brcc3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955594 554,081 - 613,661 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955594 551,407 - 613,772 (-) NCBI ChiLan1.0 ChiLan1.0
BRCC3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 155,049,262 - 155,097,994 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 155,052,870 - 155,104,458 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 144,550,320 - 144,592,795 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 154,389,179 - 154,431,616 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 154,389,283 - 154,428,669 (+) Ensembl panpan1.1 panPan2
BRCC3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 123,081,262 - 123,143,509 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 123,081,050 - 123,140,133 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 108,074,648 - 108,136,853 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 126,208,828 - 126,271,057 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 126,173,490 - 126,271,057 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 121,956,711 - 122,018,913 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 124,479,132 - 124,541,327 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 124,199,851 - 124,262,068 (+) NCBI UU_Cfam_GSD_1.0
Brcc3
BRCC3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 125,383,414 - 125,439,082 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 125,383,392 - 125,439,082 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 142,991,891 - 143,046,729 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BRCC3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 129,358,759 - 129,406,293 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 129,358,862 - 129,403,352 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 67,336,845 - 67,385,677 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Brcc3
.
Predicted Target Of
Count of predictions: 2260 Count of miRNA genes: 760 Interacting mature miRNAs: 973 Transcripts: ENSMUST00000033544, ENSMUST00000114074, ENSMUST00000118428, ENSMUST00000124321, ENSMUST00000133781, ENSMUST00000151938, ENSMUST00000152228 Prediction methods: Miranda, Pita, Rnahybrid Result types: miRGate_prediction
4141630 Gct6_m granulosa cell tumorigenesis 6 (mouse) Not determined 47179121 129764756 Mouse 13464140 Hdlq108_m HDL QTL 108 (mouse) X 57771960 91771960 Mouse 25314311 Syncl3_m synaptonemal complex length 3 (mouse) X 51988877 89743606 Mouse 13824980 Ferq1_m genetic fertility QTL 1 (mouse) X 54045360 148782996 Mouse 4142200 Rtwq1_m reduced testis weight QTL 1 (mouse) Not determined 41477060 75477203 Mouse 1300794 Spha2_m sperm head anomaly 2 (mouse) Not determined X 39921498 86260137 Mouse 12879918 Shm4_m sperm head morphology 4 (mouse) X 72072050 102062720 Mouse 25314318 Sccor2_m synaptonemal complex length to mean MLH1 count ratio 2 (mouse) X 70543606 96543606 Mouse 1357433 Dbts2_m diabetes 2 (mouse) Not determined X 7226295 150107038 Mouse 1301278 Bdln1_m body length 1 (mouse) Not determined X 41702106 75702218 Mouse 1300702 Fcsa4_m femoral cross-sectional area 4 (mouse) Not determined X 46027444 80027567 Mouse 25314316 Mlh1fc3_m MLH1 foci count 3 (mouse) X 61343606 89843606 Mouse 10412108 Desp5_m despair 5 (mouse) Not determined X 54722351 88722351 Mouse 1357730 Hstx1_m hybrid sterility, X chromosome 1 (mouse) Not determined X 71453852 77600812 Mouse 13208567 Bmiq12_m body mass index QTL 12 (mouse) X 35263653 77043606 Mouse 4141665 Mhysq2_m male hybrid sterility QTL 2 (mouse) Not determined 71453852 139203212 Mouse
px-70e7
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 75,423,166 - 75,423,271 UniSTS GRCm38 MGSCv37 X 72,668,505 - 72,668,610 UniSTS GRCm37 Celera X 66,825,154 - 66,825,259 UniSTS Cytogenetic Map X A7.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000033544 ⟹ ENSMUSP00000033544
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 74,460,234 - 74,497,607 (+) Ensembl GRCm38.p6 Ensembl X 75,416,628 - 75,454,001 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000114074 ⟹ ENSMUSP00000109708
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 74,460,316 - 74,495,314 (+) Ensembl GRCm38.p6 Ensembl X 75,416,710 - 75,451,708 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000118428 ⟹ ENSMUSP00000114057
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 74,460,303 - 74,495,591 (+) Ensembl GRCm38.p6 Ensembl X 75,416,697 - 75,451,985 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000124321
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 74,477,584 - 74,494,830 (+) Ensembl GRCm38.p6 Ensembl X 75,433,978 - 75,451,224 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000133781 ⟹ ENSMUSP00000123031
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 74,460,322 - 74,481,597 (+) Ensembl GRCm38.p6 Ensembl X 75,416,716 - 75,437,991 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000151938
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 74,460,306 - 74,494,338 (+) Ensembl GRCm38.p6 Ensembl X 75,416,700 - 75,450,732 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000152228 ⟹ ENSMUSP00000127772
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 74,460,913 - 74,479,081 (+) Ensembl GRCm38.p6 Ensembl X 75,417,307 - 75,435,475 (+) Ensembl
RefSeq Acc Id:
NM_001166457 ⟹ NP_001159929
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 74,460,234 - 74,497,607 (+) NCBI GRCm38 X 75,416,628 - 75,454,001 (+) NCBI MGSCv37 X 72,661,967 - 72,701,040 (+) RGD Celera X 66,818,616 - 66,858,058 (+) RGD cM Map X ENTREZGENE
Sequence:
GCGGAGCCTCAAGCTAAGGGCTGGTCGCTGCGTCTGAGCGCCGGGTTGGACGAGCCGCTGTGCGCCCTTGGCGGACGTGAGCGGAAAGAAGATGGCGGTGCAGGTGGTGCAAGCTGTGCAGGCGGTTC
hide sequence
RefSeq Acc Id:
NM_001166459 ⟹ NP_001159931
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 74,460,234 - 74,499,307 (+) NCBI GRCm38 X 75,416,628 - 75,455,701 (+) NCBI MGSCv37 X 72,661,967 - 72,701,040 (+) RGD Celera X 66,818,616 - 66,858,058 (+) RGD cM Map X ENTREZGENE
Sequence:
GCGGAGCCTCAAGCTAAGGGCTGGTCGCTGCGTCTGAGCGCCGGGTTGGACGAGCCGCTGTGCGCCCTTGGCGGACGTGAGCGGAAAGAAGATGGCGGTGCAGGTGGTGCAAGCTGTGCAGGCGGTTC
hide sequence
RefSeq Acc Id:
NM_001358736 ⟹ NP_001345665
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 74,460,234 - 74,499,307 (+) NCBI GRCm38 X 75,416,628 - 75,455,701 (+) NCBI
Sequence:
GCGGAGCCTCAAGCTAAGGGCTGGTCGCTGCGTCTGAGCGCCGGGTTGGACGAGCCGCTGTGCG
hide sequence
RefSeq Acc Id:
NM_001358737 ⟹ NP_001345666
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 74,460,234 - 74,497,607 (+) NCBI GRCm38 X 75,416,628 - 75,454,001 (+) NCBI
Sequence:
GCGGAGCCTCAAGCTAAGGGCTGGTCGCTGCGTCTGAGCGCCGGGTTGGACGAGCCGCTGTGCGCCCTTGGCGGACGTGAGCGGAAAGAAGATGGCGGTGCAGGTGGTGCAAGCTGTGCAGGCGGTTC
hide sequence
RefSeq Acc Id:
NM_145956 ⟹ NP_666068
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 74,460,234 - 74,497,607 (+) NCBI GRCm38 X 75,416,628 - 75,454,001 (+) NCBI MGSCv37 X 72,661,967 - 72,701,040 (+) RGD Celera X 66,818,616 - 66,858,058 (+) RGD cM Map X ENTREZGENE
Sequence:
GCGGAGCCTCAAGCTAAGGGCTGGTCGCTGCGTCTGAGCGCCGGGTTGGACGAGCCGCTGTGCG
hide sequence
RefSeq Acc Id:
NP_666068 ⟸ NM_145956
- UniProtKB:
Q3UDZ4 (UniProtKB/Swiss-Prot), A8Y5K0 (UniProtKB/Swiss-Prot), A3KGA9 (UniProtKB/Swiss-Prot), Q9D025 (UniProtKB/Swiss-Prot), P46737 (UniProtKB/Swiss-Prot)
- Sequence:
MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHIT
hide sequence
RefSeq Acc Id:
NP_001159931 ⟸ NM_001166459
- UniProtKB:
Q3UDZ4 (UniProtKB/Swiss-Prot), A8Y5K0 (UniProtKB/Swiss-Prot), A3KGA9 (UniProtKB/Swiss-Prot), Q9D025 (UniProtKB/Swiss-Prot), P46737 (UniProtKB/Swiss-Prot)
- Sequence:
MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQE
hide sequence
RefSeq Acc Id:
NP_001159929 ⟸ NM_001166457
- UniProtKB:
Q3UDZ4 (UniProtKB/Swiss-Prot), A8Y5K0 (UniProtKB/Swiss-Prot), A3KGA9 (UniProtKB/Swiss-Prot), Q9D025 (UniProtKB/Swiss-Prot), P46737 (UniProtKB/Swiss-Prot)
- Sequence:
MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHIT
hide sequence
RefSeq Acc Id:
NP_001345665 ⟸ NM_001358736
- UniProtKB:
Q3UDZ4 (UniProtKB/Swiss-Prot), P46737 (UniProtKB/Swiss-Prot), A8Y5K0 (UniProtKB/Swiss-Prot), A3KGA9 (UniProtKB/Swiss-Prot), Q9D025 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001345666 ⟸ NM_001358737
- UniProtKB:
Q3UDZ4 (UniProtKB/Swiss-Prot), P46737 (UniProtKB/Swiss-Prot), A8Y5K0 (UniProtKB/Swiss-Prot), A3KGA9 (UniProtKB/Swiss-Prot), Q9D025 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000114057 ⟸ ENSMUST00000118428
Ensembl Acc Id:
ENSMUSP00000127772 ⟸ ENSMUST00000152228
Ensembl Acc Id:
ENSMUSP00000033544 ⟸ ENSMUST00000033544
Ensembl Acc Id:
ENSMUSP00000123031 ⟸ ENSMUST00000133781
Ensembl Acc Id:
ENSMUSP00000109708 ⟸ ENSMUST00000114074
RGD ID: 6845537 Promoter ID: MM_KWN:60890 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000033544, ENSMUST00000114074, ENSMUST00000114081, ENSMUST00000118428, NM_001039373, NM_001166459, NM_145956, OTTMUST00000049307, OTTMUST00000049310, OTTMUST00000049311, OTTMUST00000049313, OTTMUST00000049314, OTTMUST00000049316, OTTMUST00000054728, OTTMUST00000072977 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 X 72,661,626 - 72,662,126 (+) MPROMDB
RGD ID: 13680824 Promoter ID: EPDNEW_M24561 Type: multiple initiation site Name: Brcc3_1 Description: Mus musculus BRCA1/BRCA2-containing complex, subunit 3 , transcriptvariant 5, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 X 75,416,700 - 75,416,760 EPDNEW
