Advanced Search (OLGA)

Gene: Tmed4 (transmembrane p24 trafficking protein 4) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Tmed4

Name:

transmembrane p24 trafficking protein 4

RGD ID:

1553401

MGI Page

MGI

Description:

Predicted to be involved in Golgi organization; endoplasmic reticulum to Golgi vesicle-mediated transport; and intracellular protein transport. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in several cellular components, including COPII-coated ER to Golgi transport vesicle; Golgi apparatus; and endoplasmic reticulum-Golgi intermediate compartment. Is expressed in central nervous system and retina. Orthologous to human TMED4 (transmembrane p24 trafficking protein 4).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

1110014L17Rik; AI326346; endoplasmic reticulum stress-response protein 25; ERS25; p24 family protein alpha-3; p24alpha3; p26; RP23-198N14.6; transmembrane emp24 domain-containing protein 4; transmembrane emp24 protein transport domain containing 4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMED4 (transmembrane p24 trafficking protein 4)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Tmed4 (transmembrane p24 trafficking protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmed4 (transmembrane p24 trafficking protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMED4 (transmembrane p24 trafficking protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMED4 (transmembrane p24 trafficking protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmed4 (transmembrane p24 trafficking protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMED4 (transmembrane p24 trafficking protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMED4 (transmembrane p24 trafficking protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmed4 (transmembrane p24 trafficking protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TMED9 (transmembrane p24 trafficking protein 9)	HGNC	OrthoDB
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Tmed4 (transmembrane p24 trafficking protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TMED4 (transmembrane p24 trafficking protein 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmed4 (transmembrane p24 trafficking protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	T08D2.1	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	Y60A3A.9	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	eca	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	p24-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ERP5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tmed4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	6,220,714 - 6,224,837 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	6,220,369 - 6,224,870 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	6,270,714 - 6,274,837 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	6,270,369 - 6,274,870 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	6,170,717 - 6,174,840 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	6,170,717 - 6,174,840 (-)	NCBI		MGSCv36	mm8
Celera	11	6,752,660 - 6,756,791 (-)	NCBI		Celera
Cytogenetic Map	11	A1	NCBI
cM Map	11	3.94	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmed4	Mouse	pleomorphic xanthoastrocytoma		ISO	RGD:1352955	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmed4	Mouse	(+)-schisandrin B	multiple interactions	ISO	RGD:1306319	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TMED4 mRNA]	CTD	PMID:31150632
Tmed4	Mouse	(1->4)-beta-D-glucan	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMED4 mRNA	CTD	PMID:36331819
Tmed4	Mouse	1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane	decreases expression	ISO	RGD:1352955	6480464	o,p'-DDT results in decreased expression of TMED4 mRNA	CTD	PMID:19371625
Tmed4	Mouse	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TMED4 mRNA	CTD	PMID:22206623
Tmed4	Mouse	1,3-dinitrobenzene	decreases expression	ISO	RGD:1306319	6480464	3-dinitrobenzene results in decreased expression of TMED4 mRNA	CTD	PMID:21983209
Tmed4	Mouse	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of TMED4 mRNA	CTD	PMID:39298647
Tmed4	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of TMED4 mRNA	CTD	PMID:21570461
Tmed4	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1306319	6480464	Tetrachlorodibenzodioxin results in increased expression of TMED4 mRNA	CTD	PMID:33387578
Tmed4	Mouse	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of TMED4 mRNA	CTD	PMID:39298647
Tmed4	Mouse	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1352955	6480464	bisphenol S results in increased expression of TMED4 protein	CTD	PMID:34186270
Tmed4	Mouse	6-propyl-2-thiouracil	increases expression	ISO	RGD:1306319	6480464	Propylthiouracil results in increased expression of TMED4 mRNA	CTD	PMID:30047161
Tmed4	Mouse	6-propyl-2-thiouracil	decreases expression	ISO	RGD:1306319	6480464	Propylthiouracil results in decreased expression of TMED4 mRNA	CTD	PMID:36843608
Tmed4	Mouse	aconitine	decreases expression	ISO	RGD:1306319	6480464	Aconitine results in decreased expression of TMED4 protein	CTD	PMID:33236894
Tmed4	Mouse	acrylamide	decreases expression	ISO	RGD:1352955	6480464	Acrylamide results in decreased expression of TMED4 mRNA	CTD	PMID:32763439
Tmed4	Mouse	amitrole	increases expression	ISO	RGD:1306319	6480464	Amitrole results in increased expression of TMED4 mRNA	CTD	PMID:30047161
Tmed4	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of TMED4 mRNA	CTD	PMID:22228805
Tmed4	Mouse	benzo[a]pyrene diol epoxide I	increases expression	ISO	RGD:1352955	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of TMED4 mRNA	CTD	PMID:19150397
Tmed4	Mouse	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1352955	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of TMED4 mRNA	CTD	PMID:20018196
Tmed4	Mouse	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of TMED4 mRNA	CTD	PMID:33754040
Tmed4	Mouse	bisphenol A	increases expression	ISO	RGD:1306319	6480464	bisphenol A results in increased expression of TMED4 mRNA	CTD	PMID:25181051\|PMID:30816183
Tmed4	Mouse	bisphenol A	increases expression	ISO	RGD:1352955	6480464	bisphenol A results in increased expression of TMED4 protein	CTD	PMID:34186270\|PMID:37567409
Tmed4	Mouse	bisphenol AF	increases expression	ISO	RGD:1352955	6480464	bisphenol AF results in increased expression of TMED4 protein	CTD	PMID:34186270
Tmed4	Mouse	Bisphenol B	increases expression	ISO	RGD:1352955	6480464	bisphenol B results in increased expression of TMED4 protein	CTD	PMID:34186270
Tmed4	Mouse	cadmium dichloride	increases methylation	ISO	RGD:1306319	6480464	Cadmium Chloride results in increased methylation of TMED4 promoter	CTD	PMID:22457795
Tmed4	Mouse	cadmium dichloride	decreases expression	ISO	RGD:1352955	6480464	Cadmium Chloride results in decreased expression of TMED4 mRNA	CTD	PMID:38568856
Tmed4	Mouse	carbon nanotube	increases expression	EXP		6480464	Nanotubes, Carbon results in increased expression of TMED4 mRNA	CTD	PMID:25620056
Tmed4	Mouse	chlorpyrifos	increases expression	EXP		6480464	Chlorpyrifos results in increased expression of TMED4 mRNA	CTD	PMID:37019170
Tmed4	Mouse	clobetasol	increases expression	EXP		6480464	Clobetasol results in increased expression of TMED4 mRNA	CTD	PMID:27462272
Tmed4	Mouse	clotrimazole	increases expression	ISO	RGD:1306319	6480464	Clotrimazole results in increased expression of TMED4 mRNA	CTD	PMID:30047161
Tmed4	Mouse	copper atom	multiple interactions	ISO	RGD:1352955	6480464	[NSC 689534 binds to Copper] which results in decreased expression of TMED4 mRNA	CTD	PMID:20971185
Tmed4	Mouse	copper(0)	multiple interactions	ISO	RGD:1352955	6480464	[NSC 689534 binds to Copper] which results in decreased expression of TMED4 mRNA	CTD	PMID:20971185
Tmed4	Mouse	copper(II) sulfate	decreases expression	ISO	RGD:1352955	6480464	Copper Sulfate results in decreased expression of TMED4 mRNA	CTD	PMID:19549813
Tmed4	Mouse	CU-O LINKAGE	decreases expression	ISO	RGD:1352955	6480464	cupric oxide results in decreased expression of TMED4 protein	CTD	PMID:25470785
Tmed4	Mouse	cyclosporin A	decreases expression	ISO	RGD:1352955	6480464	Cyclosporine results in decreased expression of TMED4 mRNA	CTD	PMID:25562108
Tmed4	Mouse	Dibutyl phosphate	affects expression	ISO	RGD:1352955	6480464	di-n-butylphosphoric acid affects the expression of TMED4 mRNA	CTD	PMID:37042841
Tmed4	Mouse	diethylstilbestrol	increases expression	ISO	RGD:1306319	6480464	Diethylstilbestrol results in increased expression of TMED4 mRNA	CTD	PMID:17005392
Tmed4	Mouse	diethylstilbestrol	increases expression	ISO	RGD:1352955	6480464	Diethylstilbestrol results in increased expression of TMED4 mRNA	CTD	PMID:36621641
Tmed4	Mouse	disodium selenite	decreases expression	ISO	RGD:1352955	6480464	Sodium Selenite results in decreased expression of TMED4 mRNA	CTD	PMID:18175754
Tmed4	Mouse	dorsomorphin	multiple interactions	ISO	RGD:1352955	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Tmed4	Mouse	doxorubicin	decreases expression	ISO	RGD:1352955	6480464	Doxorubicin results in decreased expression of TMED4 mRNA	CTD	PMID:29803840
Tmed4	Mouse	entinostat	decreases expression	ISO	RGD:1352955	6480464	entinostat results in decreased expression of TMED4 mRNA	CTD	PMID:26272509
Tmed4	Mouse	entinostat	multiple interactions	ISO	RGD:1352955	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Tmed4	Mouse	ethanol	affects splicing	EXP		6480464	Ethanol affects the splicing of TMED4 mRNA	CTD	PMID:30319688
Tmed4	Mouse	folic acid	multiple interactions	EXP		6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TMED4 mRNA	CTD	PMID:22206623
Tmed4	Mouse	folic acid	decreases expression	EXP		6480464	Folic Acid results in decreased expression of TMED4 mRNA	CTD	PMID:25629700
Tmed4	Mouse	hydrogen peroxide	multiple interactions	ISO	RGD:1352955	6480464	[Hydrogen Peroxide co-treated with Theophylline] results in increased expression of TMED4 protein	CTD	PMID:18951874
Tmed4	Mouse	hydrogen peroxide	affects expression	ISO	RGD:1352955	6480464	Hydrogen Peroxide affects the expression of TMED4 mRNA	CTD	PMID:21179406
Tmed4	Mouse	inulin	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TMED4 mRNA	CTD	PMID:36331819
Tmed4	Mouse	ivermectin	decreases expression	ISO	RGD:1352955	6480464	Ivermectin results in decreased expression of TMED4 protein	CTD	PMID:32959892
Tmed4	Mouse	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of TMED4 mRNA	CTD	PMID:21829687
Tmed4	Mouse	methimazole	increases expression	ISO	RGD:1306319	6480464	Methimazole results in increased expression of TMED4 mRNA	CTD	PMID:30047161
Tmed4	Mouse	methyl methanesulfonate	increases expression	ISO	RGD:1352955	6480464	Methyl Methanesulfonate results in increased expression of TMED4 mRNA	CTD	PMID:23649840
Tmed4	Mouse	methylmercury chloride	decreases expression	ISO	RGD:1352955	6480464	methylmercuric chloride results in decreased expression of TMED4 mRNA	CTD	PMID:28001369
Tmed4	Mouse	N-ethyl-N-nitrosourea	increases mutagenesis	EXP		6480464	Ethylnitrosourea results in increased mutagenesis of TMED4 gene; Ethylnitrosourea results in increased mutagenesis of TMED4 more ...	CTD	PMID:27776689
Tmed4	Mouse	paracetamol	increases expression	ISO	RGD:1352955	6480464	Acetaminophen results in increased expression of TMED4 mRNA	CTD	PMID:22230336
Tmed4	Mouse	paracetamol	increases expression	ISO	RGD:1306319	6480464	Acetaminophen results in increased expression of TMED4 mRNA	CTD	PMID:33387578
Tmed4	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMED4 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Tmed4	Mouse	SB 431542	multiple interactions	ISO	RGD:1352955	6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of TMED4 more ...	CTD	PMID:27188386\|PMID:37664457
Tmed4	Mouse	sulfadimethoxine	increases expression	ISO	RGD:1306319	6480464	Sulfadimethoxine results in increased expression of TMED4 mRNA	CTD	PMID:30047161
Tmed4	Mouse	temozolomide	increases expression	ISO	RGD:1352955	6480464	Temozolomide results in increased expression of TMED4 mRNA	CTD	PMID:31758290
Tmed4	Mouse	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of TMED4 mRNA	CTD	PMID:27339419
Tmed4	Mouse	tetrachloromethane	decreases expression	ISO	RGD:1306319	6480464	Carbon Tetrachloride results in decreased expression of TMED4 mRNA	CTD	PMID:31150632
Tmed4	Mouse	tetrachloromethane	multiple interactions	ISO	RGD:1306319	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TMED4 mRNA]	CTD	PMID:31150632
Tmed4	Mouse	tetrahydropalmatine	decreases expression	ISO	RGD:1352955	6480464	tetrahydropalmatine results in decreased expression of TMED4 protein	CTD	PMID:20109541
Tmed4	Mouse	theophylline	multiple interactions	ISO	RGD:1352955	6480464	[Hydrogen Peroxide co-treated with Theophylline] results in increased expression of TMED4 protein	CTD	PMID:18951874
Tmed4	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of TMED4 gene	CTD	PMID:35295148
Tmed4	Mouse	titanium dioxide	increases methylation	EXP		6480464	titanium dioxide results in increased methylation of TMED4 promoter	CTD	PMID:35295148
Tmed4	Mouse	tolcapone	affects binding	ISO	RGD:1306319	6480464	tolcapone binds to TMED4 protein	CTD	PMID:19783845
Tmed4	Mouse	trichostatin A	decreases expression	ISO	RGD:1352955	6480464	trichostatin A results in decreased expression of TMED4 mRNA	CTD	PMID:24935251
Tmed4	Mouse	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of TMED4 mRNA	CTD	PMID:17292431
Tmed4	Mouse	valproic acid	increases expression	ISO	RGD:1352955	6480464	Valproic Acid results in increased expression of TMED4 mRNA	CTD	PMID:23179753\|PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmed4	Mouse	endoplasmic reticulum to Golgi vesicle-mediated transport	involved_in	IBA	PANTHER:PTN000516376\|WB:WBGene00004766\|SGD:S000002129\|SGD:S000005542\|FB:FBgn0264389\|SGD:S000003168\|SGD:S000000005\|SGD:S000004473\|FB:FBgn0029709\|FB:FBgn0069242\|SGD:S000002970\|FB:FBgn0045866	2290270		GO_Central	GO_REF:0000033
Tmed4	Mouse	Golgi organization	involved_in	IBA	PANTHER:PTN000516376\|UniProtKB:Q15363\|MGI:1915831\|RGD:620970\|UniProtKB:Q9BVK6\|UniProtKB:Q9Y3A6	2290270		GO_Central	GO_REF:0000033
Tmed4	Mouse	intracellular protein transport	involved_in	IBA	PANTHER:PTN000516376\|UniProtKB:Q15363\|UniProtKB:P49755\|TAIR:locus:2206520	2290270		GO_Central	GO_REF:0000033
Tmed4	Mouse	positive regulation of canonical NF-kappaB signal transduction	involved_in	ISO	RGD:1352955	9068941	PMID:12761501	UniProt	PMID:12761501
Tmed4	Mouse	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653	2290270		UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmed4	Mouse	COPII-coated ER to Golgi transport vesicle	is_active_in	IBA	PANTHER:PTN000516376\|SGD:S000003168\|TAIR:locus:2201098\|TAIR:locus:2091107\|SGD:S000004473\|SGD:S000000005\|SGD:S000002129	2290270		GO_Central	GO_REF:0000033
Tmed4	Mouse	endoplasmic reticulum	is_active_in	IBA	PANTHER:PTN000516376\|FB:FBgn0264389\|SGD:S000003168\|UniProtKB:Q9BVK6\|UniProtKB:Q57U42\|UniProtKB:Q9Y3Q3\|TAIR:locus:2201098\|UniProtKB:Q13445\|UniProtKB:Q9Y3B3\|UniProtKB:Q57YT0\|UniProtKB:P49755\|TAIR:locus:2091107\|UniProtKB:Q9Y3A6\|MGI:1929269\|UniProtKB:Q15363	2290270		GO_Central	GO_REF:0000033
Tmed4	Mouse	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	2290270		UniProt	GO_REF:0000044
Tmed4	Mouse	endoplasmic reticulum-Golgi intermediate compartment	is_active_in	IBA	PANTHER:PTN000516376\|FB:FBgn0061492\|UniProtKB:Q13445\|UniProtKB:Q9Y3A6\|UniProtKB:Q15363\|UniProtKB:P49755\|MGI:1929269\|UniProtKB:Q9Y3B3\|RGD:620970\|UniProtKB:Q9BVK6\|FB:FBgn0264389\|UniProtKB:Q9Y3Q3	2290270		GO_Central	GO_REF:0000033
Tmed4	Mouse	Golgi apparatus	is_active_in	IBA	PANTHER:PTN000516376\|RGD:620970\|UniProtKB:Q9Y3A6\|TAIR:locus:2091107\|UniProtKB:Q15363\|MGI:1929269\|UniProtKB:Q9BVK6\|FB:FBgn0264389\|UniProtKB:Q9Y3Q3\|UniProtKB:Q57U42\|UniProtKB:Q13445\|FB:FBgn0061492\|RGD:1303327\|TAIR:locus:2201098\|UniProtKB:P49755\|UniProtKB:Q9Y3B3	2290270		GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:10349636	PMID:10922068	PMID:11042159	PMID:11076861	PMID:12477932	PMID:15489334	PMID:15782199	PMID:16141072	PMID:16141073	PMID:16602821	PMID:18326488
PMID:21677750	PMID:21873635	PMID:30418981	PMID:30550785	PMID:31138677

Tmed4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	6,220,714 - 6,224,837 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	6,220,369 - 6,224,870 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	6,270,714 - 6,274,837 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	6,270,369 - 6,274,870 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	6,170,717 - 6,174,840 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	6,170,717 - 6,174,840 (-)	NCBI		MGSCv36	mm8
Celera	11	6,752,660 - 6,756,791 (-)	NCBI		Celera
Cytogenetic Map	11	A1	NCBI
cM Map	11	3.94	NCBI

TMED4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	44,577,894 - 44,582,231 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	44,576,392 - 44,582,287 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	44,617,493 - 44,621,830 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	44,585,287 - 44,588,352 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	44,392,002 - 44,395,067	NCBI
Celera	7	44,717,606 - 44,720,671 (-)	NCBI		Celera
Cytogenetic Map	7	p13	NCBI
HuRef	7	44,503,138 - 44,506,203 (-)	NCBI		HuRef
CHM1_1	7	44,623,158 - 44,626,223 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	44,737,656 - 44,741,987 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	44,658,279 - 44,661,344 (-)	NCBI

Tmed4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	85,338,980 - 85,343,577 (-)	NCBI		GRCr8
mRatBN7.2	14	81,125,049 - 81,129,646 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	81,125,053 - 81,129,631 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	85,525,765 - 85,530,504 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	86,765,848 - 86,770,587 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	83,215,174 - 83,219,913 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	86,390,327 - 86,395,151 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	86,390,338 - 86,395,135 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	87,351,512 - 87,356,335 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	86,997,282 - 87,001,869 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	87,016,423 - 87,021,016 (-)	NCBI
Celera	14	80,007,995 - 80,012,582 (-)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

Tmed4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	7,500,848 - 7,504,310 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955456	7,500,848 - 7,504,310 (+)	NCBI	ChiLan1.0	ChiLan1.0

TMED4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	49,487,406 - 49,494,805 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	97,811,961 - 97,819,543 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	45,289,666 - 45,297,030 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	45,358,692 - 45,366,036 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	45,361,693 - 45,366,395 (-)	Ensembl	panpan1.1		panPan2

TMED4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	16	2,355,451 - 2,357,820 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	14,503,747 - 14,506,117 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	14,503,778 - 14,516,659 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	16	14,135,234 - 14,137,604 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	14,115,849 - 14,118,219 (+)	NCBI		UU_Cfam_GSD_1.0

Tmed4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	100,265,967 - 100,270,922 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	19,477,698 - 19,482,706 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	19,477,698 - 19,482,656 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMED4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	50,699,470 - 50,702,705 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	50,698,819 - 50,702,333 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	55,602,126 - 55,605,640 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMED4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	14,095,120 - 14,099,415 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	14,095,538 - 14,098,321 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666062	8,431,190 - 8,440,353 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmed4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	7,558,717 - 7,562,517 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	7,549,549 - 7,562,517 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tmed4
108 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	682
Count of miRNA genes:	452
Interacting mature miRNAs:	531
Transcripts:	ENSMUST00000004508, ENSMUST00000130621, ENSMUST00000132147
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300599	Cocrb11_m	cocaine related behavior 11 (mouse)			Not determined		11	2670355	36671472	Mouse
26884446	Sklq10_m	skull length QTL 10, 10 week (mouse)					11	3250000	62890826	Mouse
1300661	Lmr6_m	leishmaniasis resistance 6 (mouse)			Not determined		11	1	25976374	Mouse
13208559	Wght10_m	weight 10 (mouse)					11	3950000	88890826	Mouse
13208558	Lgth12_m	body length 12 (mouse)					11	3950000	94890826	Mouse
27095925	Pglq5_m	pelvic girdle length QTL 5, 5 week (mouse)					11	3250000	19750000	Mouse
27226741	Metcl5_m	metatarsal-calcaneal length 5, 5 week (mouse)					11	4650000	46290827	Mouse
1357722	Vtbt11_m	vertebral trabecular bone trait 11 (mouse)			Not determined		11	1	23880487	Mouse
27226735	Metcl16_m	metatarsal-calcaneal length 16, 16 week (mouse)					11	5250000	35090827	Mouse
10044008	Hbnr15_m	Heligmosomoides bakeri nematode resistance 15 (mouse)			Not determined		11	227052	34227232	Mouse
27226798	Scvln18_m	sacral vertebrae length 2, 16 week (mouse)					11	3250000	60690826	Mouse
27095919	Pglq10_m	pelvic girdle length QTL 10, 10 week (mouse)					11	3250000	18450000	Mouse
1300768	Tshp9_m	tooth shape 9 (mouse)			Not determined		11	1	25976374	Mouse
10053676	Eae44a_m	experimental allergic encephalomyelitis susceptibility 44a (mouse)			Not determined		11	4507896	21379532	Mouse
1301765	Skull15_m	skull morphology 15 (mouse)			Not determined		11	1	25976374	Mouse
27095914	Pglq16_m	pelvic girdle length QTL 16, 16 week (mouse)					11	3250000	18150000	Mouse
27095909	Scvln6_m	sacral vertebrae length 2, 5 week (mouse)					11	3250000	44090827	Mouse
27095904	Scvln12_m	sacral vertebrae length 2, 10 week (mouse)					11	3250000	34495048	Mouse
26884453	Sklq16_m	skull length QTL 16, 16 week (mouse)					11	3250000	72690826	Mouse

AI326346

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	6,270,872 - 6,270,956	UniSTS	GRCm38
MGSCv37	11	6,170,875 - 6,170,959	UniSTS	GRCm37
Celera	11	6,752,818 - 6,752,902	UniSTS
Cytogenetic Map	11	A1	UniSTS
Whitehead/MRC_RH	11	32.63	UniSTS

UniSTS:236516

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	6,270,459 - 6,270,690	UniSTS	GRCm38
GRCm38	3	27,013,850 - 27,014,091	UniSTS	GRCm38
MGSCv37	11	6,170,462 - 6,170,693	UniSTS	GRCm37
MGSCv37	3	26,912,772 - 26,913,013	UniSTS	GRCm37
Celera	11	6,752,405 - 6,752,636	UniSTS
Celera	3	26,985,071 - 26,985,313	UniSTS
Cytogenetic Map	11	A1	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_134020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF368921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK003613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK078425	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK158876	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK182125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK184055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK186607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK204643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK211429	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK213586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK213999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK218753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK219991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL607152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC023041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000004508 ⟹ ENSMUSP00000004508

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	6,220,369 - 6,224,870 (-)	Ensembl
GRCm38.p6 Ensembl	11	6,270,369 - 6,274,870 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000130621

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	6,221,661 - 6,224,870 (-)	Ensembl
GRCm38.p6 Ensembl	11	6,271,661 - 6,274,870 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000132147 ⟹ ENSMUSP00000121643

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	6,223,741 - 6,224,865 (-)	Ensembl
GRCm38.p6 Ensembl	11	6,273,741 - 6,274,865 (-)	Ensembl

RefSeq Acc Id:

NM_134020 ⟹ NP_598781

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	6,220,714 - 6,224,837 (-)	NCBI
GRCm38	11	6,270,714 - 6,274,837 (-)	ENTREZGENE
MGSCv37	11	6,170,717 - 6,174,840 (-)	RGD
Celera	11	6,752,660 - 6,756,791 (-)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

CGCAATGGCAGGTGTTGGGGTCGGACCGCTGCAGGGGATGGTGCGATTTGGGCTGCTGGTGCTTACTGTGTGTGCTGCGTGTGCCCGTGGGCTCTATTTCCACATCGGCGAGACTGAGAAGCGCTGCT
TCATCGAGGAAATACCCGACGAGACCATGGTCATCGGCAACTATCGAACTCAGATGTGGGACAAACAGAAAGAGGTGTTCCTGCCGTCGACCCCCGGCCTGGGCATGCATGTAGAGGTGAAGGACCCG
GACGGCAAGGTTGTACTGTCCCGGCAATACGGCTCCGAGGGCCGTTTCACGTTCACATCCCACACACCCGGTGACCATCAGATTTGTCTTCACTCCAACTCCACCAGAATGGCTCTCTTCGCTGGAGG
CAAACTGCGTGTACACTTGGACATCCAGGTTGGAGAGCATGCCAACAACTACCCCGAGATCGCTGCTAAGGATAAGTTAACAGAGCTCCAGCTTCGAGCTCGCCAGTTGCTTGACCAGGTGGAACAGA
TCCAGAAGGAGCAGGATTATCAGAGGTATCGTGAAGAGCGCTTCCGTCTGACCAGTGAGAGCACCAACCAGAGGGTCCTGTGGTGGTCCATCGCCCAGACCGTTATCCTCATCCTCACTGGCATCTGG
CAGATGCGTCACCTCAAGAGCTTCTTTGAGGCCAAGAAGCTGGTGTAGGGGTCTCGCCCTATAACCTTCCCCTTTTACCTCAATTATTTGATAATTTCCCCACCCAGCCCCTCATCCACCTGGAATTT
GAGGAGGAGAAATGAAAAAACAGTGTGTCACTGGTGTCACACTGGCATCATGGCACTGGCGTCATGGCACTAAGCCACTCAGACCAGCTACCTGTGACCCTGGTTCTCCAAGAAGCAGACGTTGGTCT
AAGCCTTCAAGAGCTGCCTTAGGGTTTGGGAGAAGTTGGAATTAACCCAAGGTCAAGTCCTTTCTTTTGCCTCCGAGATGACCAAATGCACTTGTGTCTTCTGTTTGTTGCTTGTTGAGTAAGCAGCT
GGCACGCCTGTGGAGGAGGAGGCCTTGCCTCAACGTTCCTGGGTCAGTCCCGAGTTCTCCCAATGGCTTTGTGAATGTAAATAAGGGCAGTTCAGGGCCCTGAAGGAGTGAGATGTTTTTCTATATTT
TAGAACTATTTTTGGATAAATTATATATTTTCCTTCCTGATTGAATCATCATCACTCCCTGTAACTAGCGAAAACCACCAGTCCAGACCTTATCCATTCTACTCATTCACAGTTTTAAAAACTGCCAT
GCAGTGATTTCGGCACTCTGGGGCCAGACAGCAGCTCCCTGTCAGACGGCCAACAAGAGTTCTCTGGAATGCTTGTGAGTCCGTTCCCACAGGCTCACAGTGTCAGGAGAGAGTGGCAGATGCTCCAG
TTTCACTTAAGCAGTGGTAAACGTTTGAAGGTTCGTTTTTTGTTGGAACTCCGGATGTAGACTAGCCTAGCCTCAGATCCTCCGTGAGTATGCCTACCAAATGTTGTGATTAAAGAGGCAGGCGTCAC
CACACCTGATAAATATTTTCTTCAAGGGAACCAGAGTTTGGTTCTTTATGCAAATTTTTTCCCAATGAAATAAAACATAGTTAACTGTGAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_598781	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH23041	(Get FASTA)	NCBI Sequence Viewer
	AAM20821	(Get FASTA)	NCBI Sequence Viewer
	BAC37268	(Get FASTA)	NCBI Sequence Viewer
	BAE34708	(Get FASTA)	NCBI Sequence Viewer
	EDL40579	(Get FASTA)	NCBI Sequence Viewer
	EDL40580	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000004508
	ENSMUSP00000004508.7
GenBank Protein	Q8R1V4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_598781 ⟸ NM_134020
- Peptide Label:	precursor
- UniProtKB:	Q8R1V4 (UniProtKB/Swiss-Prot), Q3TY55 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAGVGVGPLQGMVRFGLLVLTVCAACARGLYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGK LRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFEAKKLV hide sequence

Ensembl Acc Id:

ENSMUSP00000121643 ⟸ ENSMUST00000132147

Ensembl Acc Id:

ENSMUSP00000004508 ⟸ ENSMUST00000004508

Protein Domains

GOLD

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8R1V4-F1-model_v2	AlphaFold	Q8R1V4	1-227	view protein structure

RGD ID:

6822330

Promoter ID:

MM_KWN:6354

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

OTTMUST00000001525, OTTMUST00000001526, OTTMUST00000001527

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	11	6,174,649 - 6,175,149 (-)	MPROMDB

RGD ID:

8673892

Promoter ID:

EPDNEW_M14976

Type:

initiation region

Name:

Tmed4_1

Description:

Mus musculus transmembrane p24 trafficking protein 4 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	6,274,847 - 6,274,907	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000004394	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000004508	ENTREZGENE
	ENSMUST00000004508.13	UniProtKB/Swiss-Prot
InterPro	GOLD_dom	UniProtKB/Swiss-Prot
	TMP21-related	UniProtKB/Swiss-Prot
KEGG Report	mmu:103694	UniProtKB/Swiss-Prot
MGD	MGI:1915070	ENTREZGENE
NCBI Gene	Tmed4	ENTREZGENE
PANTHER	PTHR22811	UniProtKB/Swiss-Prot
Pfam	EMP24_GP25L	UniProtKB/Swiss-Prot
PhenoGen	Tmed4	PhenoGen
PROSITE	GOLD	UniProtKB/Swiss-Prot
SMART	EMP24_GP25L	UniProtKB/Swiss-Prot
UniProt	Q3TY55	ENTREZGENE
	Q5SVW9_MOUSE	UniProtKB/TrEMBL
	Q8R1V4	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q3TY55	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-08-26	Tmed4	transmembrane p24 trafficking protein 4	1110014L17Rik	RIKEN cDNA 1110014L17 gene	Symbol and/or name updated	27372883	PROVISIONAL
2024-08-21	1110014L17Rik	RIKEN cDNA 1110014L17 gene	Tmed4	transmembrane p24 trafficking protein 4	Symbol and/or name change	5135510	APPROVED
2016-10-04	Tmed4	transmembrane p24 trafficking protein 4		transmembrane emp24 protein transport domain containing 4	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar