Symbol:
Atg101
Name:
autophagy related 101
RGD ID:
1359310
Description:
Predicted to enable identical protein binding activity and protein kinase binding activity. Predicted to be involved in autophagosome assembly; negative regulation of cell population proliferation; and positive regulation of autophagy. Predicted to be part of Atg1/ULK1 kinase complex. Predicted to be active in phagophore assembly site. Orthologous to human ATG101 (autophagy related 101); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; endosulfan.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
autophagy-related protein 101; MGC94201; RGD1359310; similar to RIKEN cDNA 9430023L20
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ATG101 (autophagy related 101) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Atg101 (autophagy related 101) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Atg101 (autophagy related 101) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ATG101 (autophagy related 101) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ATG101 (autophagy related 101) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Atg101 (autophagy related 101) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ATG101 (autophagy related 101) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ATG101 (autophagy related 101) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Atg101 (autophagy related 101) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CD81 (CD81 molecule) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Atg101 (autophagy related 101)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ATG101 (autophagy related 101)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
atg101 (autophagy related 101)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Atg101
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
epg-9
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
atg101
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 134,277,223 - 134,286,387 (+) NCBI GRCr8 mRatBN7.2 7 132,398,477 - 132,407,643 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 132,398,483 - 132,407,633 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,200,027 - 134,209,527 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 136,429,543 - 136,439,043 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 136,339,980 - 136,348,905 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 142,929,381 - 142,938,559 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 142,929,400 - 142,938,554 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 140,730,251 - 140,739,416 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 140,029,813 - 140,038,925 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 140,106,249 - 140,115,362 (+) NCBI Celera 7 128,863,838 - 128,872,961 (+) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Atg101 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1552128 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ATG101 mRNA CTD PMID:36331819 Atg101 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1552128 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ATG101 mRNA CTD PMID:22206623 Atg101 Rat 17beta-estradiol increases expression ISO RGD:1552128 6480464 Estradiol results in increased expression of ATG101 mRNA CTD PMID:39298647 Atg101 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:1602213 6480464 Dihydrotestosterone results in increased expression of ATG101 mRNA CTD PMID:29581250 Atg101 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1552128 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of ATG101 mRNA CTD PMID:31388691 Atg101 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ATG101 mRNA CTD PMID:33387578 Atg101 Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1602213 6480464 Lactic Acid results in decreased expression of ATG101 mRNA CTD PMID:30851411 Atg101 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1552128 6480464 bisphenol S results in decreased expression of ATG101 mRNA CTD PMID:39298647 Atg101 Rat aflatoxin B1 decreases methylation ISO RGD:1602213 6480464 Aflatoxin B1 results in decreased methylation of ATG101 intron CTD PMID:30157460 Atg101 Rat aristolochic acid A increases expression ISO RGD:1602213 6480464 aristolochic acid I results in increased expression of ATG101 mRNA CTD PMID:33212167 Atg101 Rat arsane affects methylation ISO RGD:1602213 6480464 Arsenic affects the methylation of ATG101 gene CTD PMID:25304211 Atg101 Rat arsenic atom affects methylation ISO RGD:1602213 6480464 Arsenic affects the methylation of ATG101 gene CTD PMID:25304211 Atg101 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1552128 6480464 Diethylhexyl Phthalate results in increased expression of ATG101 mRNA CTD PMID:34319233 Atg101 Rat bisphenol A affects expression ISO RGD:1602213 6480464 bisphenol A affects the expression of ATG101 mRNA CTD PMID:30903817 Atg101 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ATG101 gene CTD PMID:28505145 Atg101 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ATG101 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016|PMID:34947998 Atg101 Rat copper atom multiple interactions ISO RGD:1602213 6480464 [Disulfiram binds to Copper] which results in decreased expression of ATG101 mRNA CTD PMID:24690739 Atg101 Rat copper(0) multiple interactions ISO RGD:1602213 6480464 [Disulfiram binds to Copper] which results in decreased expression of ATG101 mRNA CTD PMID:24690739 Atg101 Rat copper(II) sulfate increases expression ISO RGD:1602213 6480464 Copper Sulfate results in increased expression of ATG101 mRNA CTD PMID:19549813 Atg101 Rat cyclosporin A increases expression ISO RGD:1602213 6480464 Cyclosporine results in increased expression of ATG101 mRNA CTD PMID:20106945 Atg101 Rat diazinon increases methylation ISO RGD:1602213 6480464 Diazinon results in increased methylation of ATG101 gene CTD PMID:22964155 Atg101 Rat Dibutyl phosphate affects expression ISO RGD:1602213 6480464 di-n-butylphosphoric acid affects the expression of ATG101 mRNA CTD PMID:37042841 Atg101 Rat dieldrin increases response to substance ISO RGD:1602213 6480464 ATG101 gene mutant form results in increased susceptibility to Dieldrin CTD PMID:32421776 Atg101 Rat disulfiram multiple interactions ISO RGD:1602213 6480464 [Disulfiram binds to Copper] which results in decreased expression of ATG101 mRNA CTD PMID:24690739 Atg101 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ATG101 mRNA CTD PMID:29391264 Atg101 Rat ethanol increases expression ISO RGD:1552128 6480464 Ethanol results in increased expression of ATG101 mRNA CTD PMID:30319688 Atg101 Rat fenthion decreases expression ISO RGD:1552128 6480464 Fenthion results in decreased expression of ATG101 mRNA CTD PMID:34813904 Atg101 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ATG101 mRNA CTD PMID:24136188 Atg101 Rat folic acid multiple interactions ISO RGD:1552128 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ATG101 mRNA CTD PMID:22206623 Atg101 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ATG101 mRNA CTD PMID:33387578 Atg101 Rat methidathion decreases expression ISO RGD:1552128 6480464 methidathion results in decreased expression of ATG101 mRNA CTD PMID:34813904 Atg101 Rat nitrates multiple interactions ISO RGD:1552128 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ATG101 more ... CTD PMID:35964746 Atg101 Rat paracetamol increases expression ISO RGD:1602213 6480464 Acetaminophen results in increased expression of ATG101 mRNA CTD PMID:29067470 Atg101 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1552128 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ATG101 mRNA CTD PMID:36331819 Atg101 Rat rac-lactic acid decreases expression ISO RGD:1602213 6480464 Lactic Acid results in decreased expression of ATG101 mRNA CTD PMID:30851411 Atg101 Rat resveratrol increases expression ISO RGD:1552128 6480464 resveratrol results in increased expression of ATG101 protein CTD PMID:25505154 Atg101 Rat sodium arsenite increases expression ISO RGD:1602213 6480464 sodium arsenite results in increased expression of ATG101 mRNA CTD PMID:38568856 Atg101 Rat sunitinib increases expression ISO RGD:1602213 6480464 Sunitinib results in increased expression of ATG101 mRNA CTD PMID:31533062 Atg101 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ATG101 mRNA CTD PMID:31150632 Atg101 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ATG101 mRNA CTD PMID:34492290 Atg101 Rat thiram increases expression ISO RGD:1602213 6480464 Thiram results in increased expression of ATG101 mRNA CTD PMID:38568856 Atg101 Rat trichostatin A affects expression ISO RGD:1602213 6480464 trichostatin A affects the expression of ATG101 mRNA CTD PMID:28542535 Atg101 Rat triptonide increases expression ISO RGD:1552128 6480464 triptonide results in increased expression of ATG101 mRNA CTD PMID:33045310 Atg101 Rat trovafloxacin increases expression ISO RGD:1602213 6480464 trovafloxacin results in increased expression of ATG101 mRNA CTD PMID:33609687 Atg101 Rat valproic acid increases expression ISO RGD:1602213 6480464 Valproic Acid results in increased expression of ATG101 mRNA CTD PMID:23179753|PMID:29154799 Atg101 Rat valproic acid affects expression ISO RGD:1602213 6480464 Valproic Acid affects the expression of ATG101 mRNA CTD PMID:25979313 Atg101 Rat zinc atom multiple interactions ISO RGD:1602213 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of ATG101 mRNA CTD PMID:18593933 Atg101 Rat zinc(0) multiple interactions ISO RGD:1602213 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of ATG101 mRNA CTD PMID:18593933
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dieldrin (ISO) disulfiram (ISO) endosulfan (EXP) ethanol (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) gentamycin (EXP) methidathion (ISO) nitrates (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) rac-lactic acid (ISO) resveratrol (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP) thioacetamide (EXP) thiram (ISO) trichostatin A (ISO) triptonide (ISO) trovafloxacin (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Atg101 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 134,277,223 - 134,286,387 (+) NCBI GRCr8 mRatBN7.2 7 132,398,477 - 132,407,643 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 132,398,483 - 132,407,633 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,200,027 - 134,209,527 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 136,429,543 - 136,439,043 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 136,339,980 - 136,348,905 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 142,929,381 - 142,938,559 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 142,929,400 - 142,938,554 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 140,730,251 - 140,739,416 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 140,029,813 - 140,038,925 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 140,106,249 - 140,115,362 (+) NCBI Celera 7 128,863,838 - 128,872,961 (+) NCBI Celera Cytogenetic Map 7 q36 NCBI
ATG101 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 52,065,300 - 52,077,495 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 52,069,246 - 52,077,495 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 52,463,762 - 52,471,279 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 50,750,025 - 50,757,546 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 51,266,432 - 51,273,953 (+) NCBI Celera Cytogenetic Map 12 q13.13 NCBI HuRef 12 49,496,921 - 49,504,446 (+) NCBI HuRef CHM1_1 12 52,430,002 - 52,437,523 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 52,028,879 - 52,041,075 (+) NCBI T2T-CHM13v2.0
Atg101 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 101,182,182 - 101,188,855 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 101,182,153 - 101,188,826 (+) Ensembl GRCm39 Ensembl GRCm38 15 101,284,301 - 101,290,947 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 101,284,272 - 101,290,945 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 101,114,732 - 101,121,365 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 101,112,335 - 101,118,968 (+) NCBI MGSCv36 mm8 Celera 15 103,432,360 - 103,438,993 (+) NCBI Celera Cytogenetic Map 15 F1 NCBI cM Map 15 56.67 NCBI
Atg101 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955547 2,436,895 - 2,446,849 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955547 2,436,974 - 2,446,849 (+) NCBI ChiLan1.0 ChiLan1.0
ATG101 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 42,118,333 - 42,126,618 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 42,115,096 - 42,123,381 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 36,685,897 - 36,693,613 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 37,462,533 - 37,470,277 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 37,462,533 - 37,470,062 (-) Ensembl panpan1.1 panPan2
ATG101 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 2,931,595 - 2,934,914 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 2,931,893 - 2,935,123 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 43,317,316 - 43,324,391 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 2,928,791 - 2,935,881 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 2,928,794 - 2,935,861 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 2,945,425 - 2,950,072 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 2,931,788 - 2,938,961 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 43,715,530 - 43,722,606 (+) NCBI UU_Cfam_GSD_1.0
Atg101 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 63,638,844 - 63,646,743 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 9,518,074 - 9,526,961 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 9,518,128 - 9,525,986 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ATG101
ATG101 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 48,243,200 - 48,251,129 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 48,243,216 - 48,251,371 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 197,841,049 - 197,849,553 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Atg101
.
Predicted Target Of
Count of predictions: 265 Count of miRNA genes: 174 Interacting mature miRNAs: 204 Transcripts: ENSRNOT00000010194 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH142906
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 132,407,514 - 132,407,617 (+) MAPPER mRatBN7.2 Rnor_6.0 7 142,938,431 - 142,938,533 NCBI Rnor6.0 Rnor_5.0 7 140,739,288 - 140,739,390 UniSTS Rnor5.0 RGSC_v3.4 7 140,038,805 - 140,038,907 UniSTS RGSC3.4 Celera 7 128,872,833 - 128,872,935 UniSTS RH 3.4 Map 7 1075.3 UniSTS Cytogenetic Map 7 q36 UniSTS
RH139413
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 132,407,219 - 132,407,456 (+) MAPPER mRatBN7.2 Rnor_6.0 7 142,938,136 - 142,938,372 NCBI Rnor6.0 Rnor_5.0 7 140,738,993 - 140,739,229 UniSTS Rnor5.0 RGSC_v3.4 7 140,038,510 - 140,038,746 UniSTS RGSC3.4 Celera 7 128,872,538 - 128,872,774 UniSTS RH 3.4 Map 7 1063.4 UniSTS Cytogenetic Map 7 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010194 ⟹ ENSRNOP00000010195
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 132,398,483 - 132,407,633 (+) Ensembl Rnor_6.0 Ensembl 7 142,929,439 - 142,938,551 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087415 ⟹ ENSRNOP00000071030
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 132,398,493 - 132,407,595 (+) Ensembl Rnor_6.0 Ensembl 7 142,929,400 - 142,938,554 (+) Ensembl
RefSeq Acc Id:
NM_001007659 ⟹ NP_001007660
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 134,277,245 - 134,286,387 (+) NCBI mRatBN7.2 7 132,398,501 - 132,407,643 (+) NCBI Rnor_6.0 7 142,929,417 - 142,938,559 (+) NCBI Rnor_5.0 7 140,730,251 - 140,739,416 (+) NCBI RGSC_v3.4 7 140,029,813 - 140,038,925 (+) RGD Celera 7 128,863,838 - 128,872,961 (+) NCBI
Sequence:
CGCCGCTCAGGCGGAGGGAGCGGTGGACTGGACGGGCGTCTGTAGCGTTTGGACCCCGTCCTCATCTTCTGCGCTGCTGCCCCGAGACGGCGCGAGGTCTCGGGCGGTGACCCTGACGTCTTGTCCGA
hide sequence
RefSeq Acc Id:
NM_001271114 ⟹ NP_001258043
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 134,277,245 - 134,286,387 (+) NCBI mRatBN7.2 7 132,398,501 - 132,407,643 (+) NCBI Rnor_6.0 7 142,929,417 - 142,938,559 (+) NCBI Rnor_5.0 7 140,730,251 - 140,739,416 (+) NCBI Celera 7 128,863,838 - 128,872,961 (+) NCBI
Sequence:
CGCCGCTCAGGCGGAGGGAGCGGTGGACTGGACGGGCGTCTGTAGCGTTTGGACCCCGTCCTCA
hide sequence
RefSeq Acc Id:
XM_006242324 ⟹ XP_006242386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 134,277,223 - 134,286,379 (+) NCBI mRatBN7.2 7 132,398,477 - 132,407,636 (+) NCBI Rnor_6.0 7 142,929,381 - 142,938,556 (+) NCBI Rnor_5.0 7 140,730,251 - 140,739,416 (+) NCBI
Sequence:
AGCCTTCCTCCGGCCGCGCAAAACTTCCGGTCCGCGCGCCGCTCAGGCGGAGGGAGCGGTGGAC
hide sequence
RefSeq Acc Id:
NP_001007660 ⟸ NM_001007659
- Peptide Label:
isoform 1
- UniProtKB:
A0A8L2Q495 (UniProtKB/TrEMBL), A0A8L2R4A7 (UniProtKB/TrEMBL)
- Sequence:
MNASLTSLGLRTGNLEAWPLADPKGWPLRGVKRLVSRLCSSSSCRMNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGIQDVDCDFIDFTYVRVSSEELDRALRKVVGEF
hide sequence
RefSeq Acc Id:
NP_001258043 ⟸ NM_001271114
- Peptide Label:
isoform 2
- UniProtKB:
Q6AY69 (UniProtKB/Swiss-Prot), A6KCP1 (UniProtKB/TrEMBL), A0A8L2R4A7 (UniProtKB/TrEMBL)
- Sequence:
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGIQDVDCDFIDFTY
hide sequence
RefSeq Acc Id:
XP_006242386 ⟸ XM_006242324
- Peptide Label:
isoform X1
- UniProtKB:
Q6AY69 (UniProtKB/Swiss-Prot), A6KCP1 (UniProtKB/TrEMBL), A0A8L2R4A7 (UniProtKB/TrEMBL)
- Sequence:
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGIQDVDCDFIDFTY
hide sequence
Ensembl Acc Id:
ENSRNOP00000071030 ⟸ ENSRNOT00000087415
Ensembl Acc Id:
ENSRNOP00000010195 ⟸ ENSRNOT00000010194
RGD ID: 13695668 Promoter ID: EPDNEW_R6193 Type: multiple initiation site Name: Atg101_1 Description: autophagy related 101 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 142,929,416 - 142,929,476 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-11-13
Atg101
autophagy related 101
RGD1359310
similar to RIKEN cDNA 9430023L20
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
RGD1359310
similar to RIKEN cDNA 9430023L20
MGC94201
Symbol updated
1299863 APPROVED
2005-07-29
MGC94201
similar to RIKEN cDNA 9430023L20
Symbol and Name status set to provisional
70820 PROVISIONAL
