Advanced Search (OLGA)

Gene: Hcst (hematopoietic cell signal transducer) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Hcst

Name:

hematopoietic cell signal transducer

RGD ID:

1359238

Description:

Predicted to enable phosphatidylinositol 3-kinase binding activity; protein-macromolecule adaptor activity; and signaling receptor binding activity. Predicted to be involved in natural killer cell mediated cytotoxicity; positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; and protein phosphorylation. Predicted to be located in cell surface. Predicted to be active in plasma membrane. Orthologous to human HCST (hematopoietic cell signal transducer); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Dap10; DNAX-activation protein 10; membrane protein DAP10

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,804,429 - 94,806,661 (-)	NCBI		GRCr8
mRatBN7.2	1	85,676,976 - 85,679,083 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,676,979 - 85,679,012 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	91,092,795 - 91,094,827 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,560,032 - 99,562,065 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,851,060 - 92,853,092 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,879,425 - 88,881,653 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,879,428 - 88,881,460 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,035,099 - 90,037,271 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	85,369,349 - 85,371,383 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	85,447,460 - 85,449,494 (-)	NCBI
Celera	1	80,049,152 - 80,051,187 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcst	Rat	Brugada syndrome 5		ISO	HCST (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brugada syndrome 5	ClinVar	PMID:28492532
Hcst	Rat	hereditary spastic paraplegia 75		ISO	HCST (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia 75	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcst	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Hcst (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of HCST mRNA	CTD	PMID:22206623
Hcst	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of HCST mRNA	CTD	PMID:32741896
Hcst	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of HCST mRNA	CTD	PMID:32741896
Hcst	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	EXP		6480464	2 more ...	CTD	PMID:27291303
Hcst	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of HCST mRNA	CTD	PMID:34747641
Hcst	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Hcst (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
Hcst	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of HCST mRNA	CTD	PMID:22504374
Hcst	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of HCST mRNA	CTD	PMID:31881176
Hcst	Rat	all-trans-retinoic acid	increases expression	ISO	HCST (Homo sapiens)	6480464	Tretinoin results in increased expression of HCST mRNA	CTD	PMID:33167477
Hcst	Rat	alpha-Zearalanol	increases expression	EXP		6480464	Zeranol results in increased expression of HCST mRNA	CTD	PMID:35163327
Hcst	Rat	aristolochic acid A	multiple interactions	EXP		6480464	[aristolochic acid I co-treated with aristolochic acid II] results in increased expression of HCST mRNA	CTD	PMID:23912714
Hcst	Rat	arsenous acid	decreases expression	ISO	HCST (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of HCST mRNA	CTD	PMID:19128835
Hcst	Rat	benzo[a]pyrene	increases expression	ISO	Hcst (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of HCST mRNA	CTD	PMID:22228805
Hcst	Rat	benzo[a]pyrene	increases expression	ISO	HCST (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of HCST mRNA	CTD	PMID:35870112
Hcst	Rat	benzo[a]pyrene diol epoxide I	increases expression	ISO	HCST (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397
Hcst	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	HCST (Homo sapiens)	6480464	Diethylhexyl Phthalate results in increased expression of HCST mRNA	CTD	PMID:28412506
Hcst	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Hcst (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of HCST mRNA	CTD	PMID:33754040
Hcst	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of HCST mRNA	CTD	PMID:25181051
Hcst	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of HCST mRNA	CTD	PMID:30816183 and PMID:32528016
Hcst	Rat	butanal	increases expression	ISO	HCST (Homo sapiens)	6480464	butyraldehyde results in increased expression of HCST mRNA	CTD	PMID:26079696
Hcst	Rat	CGP 52608	multiple interactions	ISO	HCST (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to HCST gene]	CTD	PMID:28238834
Hcst	Rat	choline	multiple interactions	ISO	Hcst (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of HCST mRNA	CTD	PMID:20938992
Hcst	Rat	chromium(6+)	affects expression	ISO	Hcst (Mus musculus)	6480464	chromium hexavalent ion affects the expression of HCST mRNA	CTD	PMID:28472532
Hcst	Rat	cyclosporin A	increases expression	ISO	HCST (Homo sapiens)	6480464	Cyclosporine results in increased expression of HCST mRNA	CTD	PMID:21632981 and PMID:25562108
Hcst	Rat	diarsenic trioxide	decreases expression	ISO	HCST (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of HCST mRNA	CTD	PMID:19128835
Hcst	Rat	diuron	decreases expression	ISO	HCST (Homo sapiens)	6480464	Diuron results in decreased expression of HCST mRNA	CTD	PMID:35967413
Hcst	Rat	fenpyroximate	increases expression	ISO	HCST (Homo sapiens)	6480464	fenpyroximate results in increased expression of HCST mRNA	CTD	PMID:33512557
Hcst	Rat	folic acid	multiple interactions	ISO	Hcst (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of HCST mRNA	CTD	PMID:20938992
Hcst	Rat	genistein	decreases expression	ISO	HCST (Homo sapiens)	6480464	Genistein results in decreased expression of HCST mRNA	CTD	PMID:18847459
Hcst	Rat	glycidol	decreases expression	ISO	Hcst (Mus musculus)	6480464	glycidol results in decreased expression of HCST mRNA	CTD	PMID:33187795
Hcst	Rat	L-methionine	multiple interactions	ISO	Hcst (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of HCST mRNA	CTD	PMID:20938992
Hcst	Rat	lidocaine	increases expression	EXP		6480464	Lidocaine results in increased expression of HCST mRNA	CTD	PMID:35283115
Hcst	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of HCST mRNA	CTD	PMID:22504374
Hcst	Rat	nickel atom	increases expression	ISO	HCST (Homo sapiens)	6480464	Nickel results in increased expression of HCST mRNA	CTD	PMID:24768652 and PMID:25583101
Hcst	Rat	nitrofen	increases expression	EXP		6480464	nitrofen results in increased expression of HCST mRNA	CTD	PMID:33484710
Hcst	Rat	p-menthan-3-ol	decreases expression	ISO	HCST (Homo sapiens)	6480464	Menthol results in decreased expression of HCST mRNA	CTD	PMID:26760959
Hcst	Rat	paracetamol	affects expression	ISO	Hcst (Mus musculus)	6480464	Acetaminophen affects the expression of HCST mRNA	CTD	PMID:17562736
Hcst	Rat	pirinixic acid	increases expression	ISO	Hcst (Mus musculus)	6480464	pirinixic acid results in increased expression of HCST mRNA	CTD	PMID:18445702
Hcst	Rat	propanal	increases expression	ISO	HCST (Homo sapiens)	6480464	propionaldehyde results in increased expression of HCST mRNA	CTD	PMID:26079696
Hcst	Rat	pyrimidifen	increases expression	ISO	HCST (Homo sapiens)	6480464	pyrimidifen results in increased expression of HCST mRNA	CTD	PMID:33512557
Hcst	Rat	rotenone	increases expression	ISO	HCST (Homo sapiens)	6480464	Rotenone results in increased expression of HCST mRNA	CTD	PMID:33512557
Hcst	Rat	silicon dioxide	increases expression	ISO	Hcst (Mus musculus)	6480464	Silicon Dioxide results in increased expression of HCST mRNA	CTD	PMID:29341224
Hcst	Rat	sunitinib	decreases expression	ISO	HCST (Homo sapiens)	6480464	Sunitinib results in decreased expression of HCST mRNA	CTD	PMID:31533062
Hcst	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of HCST mRNA	CTD	PMID:32741896
Hcst	Rat	titanium dioxide	increases expression	ISO	Hcst (Mus musculus)	6480464	titanium dioxide results in increased expression of HCST mRNA	CTD	PMID:23557971
Hcst	Rat	valproic acid	affects expression	ISO	Hcst (Mus musculus)	6480464	Valproic Acid affects the expression of HCST mRNA	CTD	PMID:17292431

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcst	Rat	natural killer cell mediated cytotoxicity	involved_in	ISO	HCST (Homo sapiens)	1624291	PMID:16582911	RGD	PMID:16582911
Hcst	Rat	natural killer cell mediated cytotoxicity	involved_in	IEA	UniProtKB:Q9UBK5 and ensembl:ENSP00000246551	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcst	Rat	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	involved_in	IBA	PANTHER:PTN000484054 and UniProtKB:Q9UBK5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Hcst	Rat	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	involved_in	IEA	InterPro:IPR009861	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Hcst	Rat	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	involved_in	ISO	HCST (Homo sapiens)	1624291	PMID:10426994	RGD	PMID:10426994
Hcst	Rat	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	involved_in	IEA	UniProtKB:Q9UBK5 and ensembl:ENSP00000246551	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcst	Rat	protein phosphorylation	involved_in	ISO	HCST (Homo sapiens)	1624291	UniProtKB:P27986 more ...	RGD	PMID:10528161
Hcst	Rat	regulation of immune response	involved_in	IEA	InterPro:IPR009861	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcst	Rat	cell surface	located_in	ISO	HCST (Homo sapiens)	1624291	PMID:10426994 and PMID:15294961	RGD	PMID:10426994 and PMID:15294961
Hcst	Rat	cell surface	located_in	IEA	UniProtKB:Q9UBK5 and ensembl:ENSP00000246551	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcst	Rat	cell surface	located_in	ISS	UniProtKB:Q9UBK5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Hcst	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Hcst	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Hcst	Rat	membrane	located_in	IEA	InterPro:IPR009861	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Hcst	Rat	plasma membrane	is_active_in	ISO	HCST (Homo sapiens)	1624291	PMID:15894612	RGD	PMID:15894612
Hcst	Rat	plasma membrane	is_active_in	IEA	UniProtKB:Q9UBK5 and ensembl:ENSP00000246551	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcst	Rat	phosphatidylinositol 3-kinase binding	enables	IEA	InterPro:IPR009861	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Hcst	Rat	phosphatidylinositol 3-kinase binding	enables	IBA	PANTHER:PTN000484054 and UniProtKB:Q9UBK5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Hcst	Rat	phosphatidylinositol 3-kinase binding	enables	ISO	HCST (Homo sapiens)	1624291	PMID:10426994	RGD	PMID:10426994
Hcst	Rat	phosphatidylinositol 3-kinase binding	enables	IEA	UniProtKB:Q9UBK5 and ensembl:ENSP00000246551	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcst	Rat	protein binding	enables	ISO	HCST (Homo sapiens)	1624291	UniProtKB:A0A0K2S4Q6 more ...	RGD	PMID:10426994 more ...
Hcst	Rat	protein binding	enables	ISO	Hcst (Mus musculus)	1624291	PR:O54709-1 more ...	RGD	PMID:12426565 more ...
Hcst	Rat	protein-macromolecule adaptor activity	enables	ISO	HCST (Homo sapiens)	1624291	PMID:16582911	RGD	PMID:16582911
Hcst	Rat	protein-macromolecule adaptor activity	enables	IEA	UniProtKB:Q9UBK5 and ensembl:ENSP00000246551	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcst	Rat	signaling receptor binding	enables	IEA	InterPro:IPR009861	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Hcst	Rat	signaling receptor binding	enables	IBA	PANTHER:PTN000484054 and UniProtKB:Q9UBK5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Hcst	Rat	signaling receptor binding	enables	IEA	UniProtKB:Q9UBK5 and ensembl:ENSP00000246551	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcst	Rat	signaling receptor binding	enables	ISO	HCST (Homo sapiens)	1624291	UniProtKB:O54709-1 more ...	RGD	PMID:15294961

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10426994	PMID:10528161	PMID:15294961	PMID:22084441

Hcst
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,804,429 - 94,806,661 (-)	NCBI		GRCr8
mRatBN7.2	1	85,676,976 - 85,679,083 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,676,979 - 85,679,012 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	91,092,795 - 91,094,827 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,560,032 - 99,562,065 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,851,060 - 92,853,092 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,879,425 - 88,881,653 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,879,428 - 88,881,460 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,035,099 - 90,037,271 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	85,369,349 - 85,371,383 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	85,447,460 - 85,449,494 (-)	NCBI
Celera	1	80,049,152 - 80,051,187 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

HCST
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,902,529 - 35,904,377 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,902,529 - 35,904,377 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	36,393,431 - 36,395,279 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	41,085,222 - 41,087,013 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	41,085,221 - 41,087,013	NCBI
Celera	19	33,107,573 - 33,109,364 (+)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	32,898,627 - 32,900,418 (+)	NCBI		HuRef
CHM1_1	19	36,394,675 - 36,396,466 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	38,448,294 - 38,450,142 (+)	NCBI		T2T-CHM13v2.0

Hcst
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,117,137 - 30,119,279 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,117,137 - 30,119,279 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	30,417,712 - 30,419,854 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,417,712 - 30,419,854 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	31,202,731 - 31,204,873 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,126,566 - 30,128,506 (-)	NCBI		MGSCv36	mm8
Celera	7	25,009,424 - 25,011,566 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	17.45	NCBI

HCST
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,897,740 - 41,902,675 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,884,029 - 43,887,476 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,817,826 - 32,821,149 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	41,567,234 - 41,570,544 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	41,568,739 - 41,570,544 (+)	Ensembl	panpan1.1		panPan2

HCST
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	116,760,605 - 116,763,355 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	116,760,714 - 116,762,024 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,166,169 - 116,169,228 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	117,363,784 - 117,366,843 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	117,363,893 - 117,365,203 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	116,927,340 - 116,930,399 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	116,550,872 - 116,553,931 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	117,606,637 - 117,609,694 (-)	NCBI		UU_Cfam_GSD_1.0

Hcst
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	11,181,369 - 11,185,007 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	460,986 - 462,269 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	460,890 - 462,354 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HCST
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	45,304,744 - 45,309,048 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,707,447 - 40,711,722 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	6	q21	NCBI

HCST
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,810,874 - 30,816,547 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666073	8,605,509 - 8,609,341 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Hcst
10 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	30
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000028287
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	43	90	91	90	59	25	59	6	210	90	70	45	58	31


RefSeq Transcripts	NM_001005900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY247020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028287 ⟹ ENSRNOP00000028287

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	85,676,979 - 85,679,012 (-)	Ensembl
Rnor_6.0 Ensembl	1	88,879,428 - 88,881,460 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094390 ⟹ ENSRNOP00000083918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	85,676,982 - 85,679,012 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119105 ⟹ ENSRNOP00000078119

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	85,676,979 - 85,678,941 (-)	Ensembl

RefSeq Acc Id:

NM_001005900 ⟹ NP_001005900

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,804,429 - 94,806,463 (-)	NCBI
mRatBN7.2	1	85,676,978 - 85,679,012 (-)	NCBI
Rnor_6.0	1	88,879,427 - 88,881,460 (-)	NCBI
Rnor_5.0	1	90,035,099 - 90,037,271 (-)	NCBI
RGSC_v3.4	1	85,369,349 - 85,371,383 (-)	RGD
Celera	1	80,049,152 - 80,051,187 (-)	RGD

Sequence:

show sequence

GCCTCTCTGCTGCTCCTCTACTGTTCTGAAGATCACAATTTTGACCAGATCCTTTCAAGTCCCAGCCCAGCATGGCCCCTCCAGGTCACCTCCTGTTCCTGTTCCTGCTCCCAGTGGCCGCAAGTCAG
ACAAACGAAGGTTCCTGCTCCGGATGTGGGCCTCTGTCCCTGCCACTCCTGGCAGGCCTGGTGGCTGCAGATGCGGTCATGTCACTTCTAATAGTGGGGGTGGTGTTTGTATGTATGCGCCTACACAG
CAGGCCTGCCCAAGAAGATGGTCGAGTCTACATCAACATGCCTGGGAGAGGCTGACAGCTGCACCTTCCACTTTTGTCTTCCAACCATCCTCGATCGCATGAGGGTGGGGTAGGGAGCGTGGGAATGC
ATTTTCTTCCGGACTAGAATAAAGCATTCAAATACCTCTAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006228785 ⟹ XP_006228847

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,804,429 - 94,806,661 (-)	NCBI
mRatBN7.2	1	85,676,976 - 85,679,083 (-)	NCBI
Rnor_6.0	1	88,879,425 - 88,881,653 (-)	NCBI
Rnor_5.0	1	90,035,099 - 90,037,271 (-)	NCBI

Sequence:

show sequence

CTCTAACCTATTTCCATAATCTCCCTGGTGCCCACACCATGGCCCTTTCGCCACTCCACCGAGA
TAATCTCGGAAGCTTCTCAGGGCTCTGACTCCCCCATATTTGTTCTCCAAAGGAAGTCTTGAGGACACACATGCACCCACACAGGAAGTAGGTGGTGTTGTCACCATCGGAGTGATATCTGTCCTAGC
TGCCTCTCTGCTGCTCCTCTACTGTTCTGAAGATCACAATTTTGACCAGATCCTTTCAAGTCCCAGCCCAGCATGGCCCCTCCAGGTCACCTCCTGTTCCTGTTCCTGCTCCCAGTGGCCGCAAGTCA
GACAAACGAAGGTTCCTGCTCCGGATGTGGGCCTCTGTCCCTGCCACTCCTGGCAGGCCTGGTGGCTGCAGATGCGGTCATGTCACTTCTAATAGTGGGGGTGGTGTTTGTATGTATGCGCCTACACA
GCAGGCCTGCCCAAGATGGTCGAGTCTACATCAACATGCCTGGGAGAGGCTGACAGCTGCACCTTCCACTTTTGTCTTCCAACCATCCTCGATCGCATGAGGGTGGGGTAGGGAGCGTGGGAATGCAT
TTTCTTCCGGACTAGAATAAAGCATTCAAATACCTCTAGA

hide sequence


Protein RefSeqs	NP_001005900	(Get FASTA)	NCBI Sequence Viewer
	XP_006228847	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP79986	(Get FASTA)	NCBI Sequence Viewer
	EDM07762	(Get FASTA)	NCBI Sequence Viewer
	EDM07763	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028287
	ENSRNOP00000028287.4
GenBank Protein	Q6X9T8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001005900 ⟸ NM_001005900
- Peptide Label:	precursor
- UniProtKB:	Q6X9T8 (UniProtKB/Swiss-Prot), A6J9X2 (UniProtKB/TrEMBL), A0A8I5Y9X6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPPGHLLFLFLLPVAASQTNEGSCSGCGPLSLPLLAGLVAADAVMSLLIVGVVFVCMRLHSRPAQEDGRVYINMPGRG hide sequence

RefSeq Acc Id:	XP_006228847 ⟸ XM_006228785
- Peptide Label:	isoform X1
- UniProtKB:	A6J9X1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPPGHLLFLFLLPVAASQTNEGSCSGCGPLSLPLLAGLVAADAVMSLLIVGVVFVCMRLHSRPAQDGRVYINMPGRG hide sequence

Ensembl Acc Id:

ENSRNOP00000028287 ⟸ ENSRNOT00000028287

Ensembl Acc Id:

ENSRNOP00000078119 ⟸ ENSRNOT00000119105

Ensembl Acc Id:

ENSRNOP00000083918 ⟸ ENSRNOT00000094390

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6X9T8-F1-model_v2	AlphaFold	Q6X9T8	1-79	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13689913

Promoter ID:

EPDNEW_R438

Type:

initiation region

Name:

Hcst_1

Description:

hematopoietic cell signal transducer

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	88,881,445 - 88,881,505	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-60112	BioCyc
Ensembl Genes	ENSRNOG00000020849	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000028287	ENTREZGENE
	ENSRNOT00000028287.5	UniProtKB/Swiss-Prot
InterPro	HCST	UniProtKB/Swiss-Prot
KEGG Report	rno:474146	UniProtKB/Swiss-Prot
NCBI Gene	474146	ENTREZGENE
PANTHER	HEMATOPOIETIC CELL SIGNAL TRANSDUCER	UniProtKB/Swiss-Prot
	PTHR21409	UniProtKB/Swiss-Prot
Pfam	DAP10	UniProtKB/Swiss-Prot
PhenoGen	Hcst	PhenoGen
RatGTEx	ENSRNOG00000020849	RatGTEx
UniProt	A0A8I5Y9X6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZWR2_RAT	UniProtKB/TrEMBL
	A6J9X1	ENTREZGENE, UniProtKB/TrEMBL
	A6J9X2	ENTREZGENE, UniProtKB/TrEMBL
	HCST_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-11-17	Hcst	hematopoietic cell signal transducer			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Hcst	hematopoietic cell signal transducer			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar