Symbol:
BRD2
Name:
bromodomain containing 2
RGD ID:
1350574
HGNC Page
HGNC:1103
Description:
Enables several functions, including chromatin binding activity; histone reader activity; and lysine-acetylated histone binding activity. Involved in several processes, including chromatin looping; nucleosome assembly; and positive regulation of T-helper 17 cell lineage commitment. Located in nuclear speck. Is active in chromatin. Implicated in B-cell lymphoma; B-lymphoblastic leukemia/lymphoma; juvenile myoclonic epilepsy; and photosensitivity disease. Biomarker of melanoma.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
BRD2 intronic transcript 1; BRD2-IT1; bromodomain-containing 2; bromodomain-containing protein 2; D6S113E; DKFZp686N0336; female sterile homeotic-related gene 1; FLJ31942; FSH; FSHRG1; FSRG1; KIAA9001; NAT; O27.1.1; really interesting new gene 3 protein; RING3; RNF3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Brd2 (bromodomain containing 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB
Rattus norvegicus (Norway rat):
Brd2 (bromodomain containing 2) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB
Chinchilla lanigera (long-tailed chinchilla):
Brd2 (bromodomain containing 2) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
BRD2 (bromodomain containing 2) NCBI
Ortholog
Canis lupus familiaris (dog):
BRD2 (bromodomain containing 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, PhylomeDB
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Brd2 (bromodomain containing 2) NCBI
Ortholog
Sus scrofa (pig):
BRD2 (bromodomain containing 2) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther
Chlorocebus sabaeus (green monkey):
BRD2 (bromodomain containing 2) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Brd2 (bromodomain containing 2) NCBI
Ortholog
Other homologs 2
Sus scrofa (pig):
SLA-DMA (SLA-DM alpha chain) HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Brd2 (bromodomain containing 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Brd2 (bromodomain containing 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
brd2a (bromodomain containing 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
brd2b (bromodomain containing 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
BDF1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
bet-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
fs(1)h
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
tbrd-1
Alliance
DIOPT (Ensembl Compara|InParanoid|PANTHER)
Xenopus laevis (African clawed frog):
brd2.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
brd2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 32,968,594 - 32,981,505 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 32,968,594 - 32,981,505 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 32,936,371 - 32,949,282 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 33,044,415 - 33,057,059 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 33,044,414 - 33,057,059 NCBI Celera 6 34,485,349 - 34,498,195 (+) NCBI Celera Cytogenetic Map 6 p21.32 NCBI HuRef 6 32,678,978 - 32,691,818 (+) NCBI HuRef CHM1_1 6 32,937,242 - 32,950,091 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 32,789,953 - 32,802,871 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
BRD2 Human (+)-schisandrin B multiple interactions ISO Brd2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BRD2 mRNA] CTD PMID:31150632 BRD2 Human (1->4)-beta-D-glucan multiple interactions ISO Brd2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of BRD2 mRNA CTD PMID:36331819 BRD2 Human (S)-nicotine increases expression ISO Brd2 (Mus musculus) 6480464 Nicotine results in increased expression of BRD2 mRNA CTD PMID:33640489 BRD2 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of BRD2 mRNA CTD PMID:11179685 BRD2 Human 17beta-estradiol increases expression ISO Brd2 (Mus musculus) 6480464 Estradiol results in increased expression of BRD2 mRNA CTD PMID:39298647 BRD2 Human 17beta-estradiol multiple interactions EXP 6480464 3 more ... CTD PMID:11179685 BRD2 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 Tetrachlorodibenzodioxin inhibits the reaction [Estradiol results in increased expression of BRD2 mRNA] CTD PMID:11179685 BRD2 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Brd2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of BRD2 mRNA CTD PMID:33387578 BRD2 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Brd2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BRD2 mRNA CTD PMID:34747641 BRD2 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Brd2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BRD2 mRNA CTD PMID:20702594 and PMID:21570461 BRD2 Human 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Brd2 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 BRD2 Human 2,4-dinitrotoluene affects expression ISO Brd2 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of BRD2 mRNA CTD PMID:21346803 BRD2 Human 2-hydroxypropanoic acid increases expression EXP 6480464 Lactic Acid results in increased expression of BRD2 mRNA CTD PMID:30851411 BRD2 Human 3,3'-diindolylmethane multiple interactions EXP 6480464 3 and 3'-diindolylmethane inhibits the reaction [Estradiol results in increased expression of BRD2 mRNA] CTD PMID:11179685 BRD2 Human 4,4'-sulfonyldiphenol increases expression ISO Brd2 (Mus musculus) 6480464 bisphenol S results in increased expression of BRD2 mRNA CTD PMID:39298647 BRD2 Human 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide multiple interactions EXP 6480464 BRD2 mutant form inhibits the reaction [6-chloro-2 more ... CTD PMID:26212199 BRD2 Human 6-propyl-2-thiouracil decreases expression ISO Brd2 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of BRD2 mRNA CTD PMID:22504374 and PMID:30047161 BRD2 Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of BRD2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of BRD2 mRNA CTD PMID:32699268 BRD2 Human acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of BRD2 mRNA CTD PMID:32763439 BRD2 Human afimoxifene decreases response to substance EXP 6480464 BRD2 results in decreased susceptibility to afimoxifene CTD PMID:21233418 BRD2 Human aflatoxin B1 increases expression ISO Brd2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of BRD2 mRNA CTD PMID:19770486 BRD2 Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of BRD2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of BRD2 mRNA CTD PMID:32699268 BRD2 Human amitrole decreases expression ISO Brd2 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of BRD2 mRNA CTD PMID:30047161 BRD2 Human amphetamine decreases expression ISO Brd2 (Rattus norvegicus) 6480464 Amphetamine results in decreased expression of BRD2 mRNA CTD PMID:30779732 BRD2 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of BRD2 mRNA CTD PMID:33212167 BRD2 Human azoxystrobin increases expression EXP 6480464 azoxystrobin results in increased expression of BRD2 mRNA CTD PMID:33512557 BRD2 Human benzatropine multiple interactions EXP 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of BRD2 protein CTD PMID:34122009 BRD2 Human benzo[a]pyrene increases expression ISO Brd2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BRD2 mRNA CTD PMID:19770486 and PMID:20504355 BRD2 Human benzo[a]pyrene diol epoxide I increases expression EXP 6480464 7 more ... CTD PMID:19150397 BRD2 Human Benzo[k]fluoranthene decreases expression ISO Brd2 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of BRD2 mRNA CTD PMID:26377693 BRD2 Human bisphenol A increases expression ISO Brd2 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of BRD2 mRNA CTD PMID:25181051 more ... BRD2 Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of BRD2 gene CTD PMID:31601247 BRD2 Human bisphenol A decreases expression ISO Brd2 (Mus musculus) 6480464 bisphenol A results in decreased expression of BRD2 mRNA CTD PMID:33221593 BRD2 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of BRD2 mRNA CTD PMID:30903817 BRD2 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BRD2 mRNA CTD PMID:29275510 BRD2 Human bisphenol A increases methylation ISO Brd2 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of BRD2 gene CTD PMID:28505145 BRD2 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of BRD2 mRNA CTD PMID:25596134 BRD2 Human caffeine decreases phosphorylation EXP 6480464 Caffeine results in decreased phosphorylation of BRD2 protein CTD PMID:35688186 BRD2 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to BRD2 gene] CTD PMID:28238834 BRD2 Human chloroacetaldehyde affects expression EXP 6480464 chloroacetaldehyde affects the expression of BRD2 mRNA CTD PMID:25596134 BRD2 Human chloropicrin increases expression EXP 6480464 chloropicrin results in increased expression of BRD2 mRNA CTD PMID:26352163 BRD2 Human cidofovir anhydrous decreases expression EXP 6480464 Cidofovir results in decreased expression of BRD2 mRNA CTD PMID:25596134 BRD2 Human cisplatin decreases expression ISO Brd2 (Mus musculus) 6480464 Cisplatin results in decreased expression of BRD2 mRNA CTD PMID:21151649 BRD2 Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of BRD2 mRNA CTD PMID:25596134 BRD2 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of BRD2 mRNA CTD PMID:19561079 and PMID:38498338 BRD2 Human clodronic acid decreases expression EXP 6480464 Clodronic Acid results in decreased expression of BRD2 mRNA CTD PMID:25596134 BRD2 Human clofibrate multiple interactions ISO Brd2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of BRD2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of BRD2 mRNA] CTD PMID:17585979 BRD2 Human cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of BRD2 mRNA CTD PMID:19320972 BRD2 Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of BRD2 mRNA CTD PMID:19549813 BRD2 Human coumarin increases phosphorylation EXP 6480464 coumarin results in increased phosphorylation of BRD2 protein CTD PMID:35688186 BRD2 Human Cuprizon multiple interactions EXP 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of BRD2 protein CTD PMID:34122009 BRD2 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of BRD2 mRNA CTD PMID:25562108 and PMID:25596134 BRD2 Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of BRD2 mRNA CTD PMID:38568856 BRD2 Human deguelin increases expression EXP 6480464 deguelin results in increased expression of BRD2 mRNA CTD PMID:33512557 BRD2 Human diazinon increases methylation EXP 6480464 Diazinon results in increased methylation of BRD2 gene CTD PMID:22964155 BRD2 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of BRD2 mRNA CTD PMID:37042841 BRD2 Human diethyl malate increases expression EXP 6480464 diethyl malate results in increased expression of BRD2 mRNA CTD PMID:38498338 BRD2 Human diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of BRD2 mRNA CTD PMID:36621641 BRD2 Human dioxygen decreases expression EXP 6480464 Oxygen deficiency results in decreased expression of BRD2 mRNA CTD PMID:25596134 BRD2 Human dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of BRD2 CTD PMID:27292261 BRD2 Human doxorubicin decreases expression ISO Brd2 (Mus musculus) 6480464 Doxorubicin results in decreased expression of BRD2 mRNA CTD PMID:19277126 BRD2 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of BRD2 mRNA CTD PMID:29803840 BRD2 Human elemental selenium multiple interactions EXP 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of BRD2 mRNA CTD PMID:19244175 BRD2 Human elemental selenium increases expression EXP 6480464 Selenium results in increased expression of BRD2 mRNA CTD PMID:19244175 BRD2 Human epoxiconazole increases expression ISO Brd2 (Mus musculus) 6480464 epoxiconazole results in increased expression of BRD2 mRNA CTD PMID:35436446 BRD2 Human ethanol multiple interactions ISO Brd2 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of BRD2 mRNA CTD PMID:30319688 BRD2 Human fenofibrate decreases expression ISO Brd2 (Rattus norvegicus) 6480464 Fenofibrate results in decreased expression of BRD2 mRNA CTD PMID:25596134 BRD2 Human fenthion increases expression ISO Brd2 (Mus musculus) 6480464 Fenthion results in increased expression of BRD2 mRNA CTD PMID:34813904 BRD2 Human flutamide increases expression ISO Brd2 (Rattus norvegicus) 6480464 Flutamide results in increased expression of BRD2 mRNA CTD PMID:24136188 BRD2 Human folic acid increases expression ISO Brd2 (Mus musculus) 6480464 Folic Acid results in increased expression of BRD2 mRNA CTD PMID:25629700 BRD2 Human FR900359 affects phosphorylation EXP 6480464 FR900359 affects the phosphorylation of BRD2 protein CTD PMID:37730182 BRD2 Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of BRD2 gene CTD PMID:31601247 BRD2 Human furan increases expression ISO Brd2 (Mus musculus) 6480464 furan results in increased expression of BRD2 mRNA CTD PMID:24183702 BRD2 Human gentamycin decreases expression ISO Brd2 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of BRD2 mRNA CTD PMID:22061828 BRD2 Human gentamycin increases expression ISO Brd2 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of BRD2 mRNA CTD PMID:33387578 BRD2 Human ifosfamide decreases expression EXP 6480464 Ifosfamide results in decreased expression of BRD2 mRNA CTD PMID:25596134 BRD2 Human inulin multiple interactions ISO Brd2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of BRD2 mRNA CTD PMID:36331819 BRD2 Human iron dichloride increases expression EXP 6480464 ferrous chloride results in increased expression of BRD2 mRNA CTD PMID:35984750 BRD2 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of BRD2 protein CTD PMID:32959892 BRD2 Human leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of BRD2 mRNA CTD PMID:28988120 BRD2 Human lipopolysaccharide increases expression ISO Brd2 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of BRD2 mRNA and Lipopolysaccharides results in increased expression of BRD2 protein CTD PMID:26349765 BRD2 Human metformin affects expression ISO Brd2 (Rattus norvegicus) 6480464 Metformin affects the expression of BRD2 mRNA CTD PMID:25596134 BRD2 Human methamphetamine increases expression ISO Brd2 (Mus musculus) 6480464 Methamphetamine results in increased expression of BRD2 mRNA CTD PMID:26307267 BRD2 Human methapyrilene increases expression ISO Brd2 (Rattus norvegicus) 6480464 Methapyrilene results in increased expression of BRD2 mRNA CTD PMID:30467583 BRD2 Human methimazole decreases expression ISO Brd2 (Rattus norvegicus) 6480464 Methimazole results in decreased expression of BRD2 mRNA CTD PMID:22504374 and PMID:30047161 BRD2 Human methotrexate affects expression ISO Brd2 (Mus musculus) 6480464 Methotrexate affects the expression of BRD2 mRNA CTD PMID:18502557 BRD2 Human methyl methanesulfonate increases expression EXP 6480464 Methyl Methanesulfonate results in increased expression of BRD2 mRNA CTD PMID:23649840 BRD2 Human methylisothiazolinone increases expression EXP 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of BRD2 mRNA CTD PMID:31629900 BRD2 Human methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of BRD2 mRNA CTD PMID:28001369 BRD2 Human N-(6-acetamidohexyl)acetamide multiple interactions ISO Brd2 (Mus musculus) 6480464 hexamethylene bisacetamide inhibits the reaction [BRD2 protein binds to SRM promoter] CTD PMID:26941288 BRD2 Human N-methylformamide increases expression ISO Brd2 (Mus musculus) 6480464 methylformamide analog results in increased expression of BRD2 mRNA and methylformamide results in increased expression of BRD2 mRNA CTD PMID:17040096 BRD2 Human nickel sulfate decreases expression EXP 6480464 nickel sulfate results in decreased expression of BRD2 mRNA CTD PMID:18651567 BRD2 Human nicotine increases expression ISO Brd2 (Mus musculus) 6480464 Nicotine results in increased expression of BRD2 mRNA CTD PMID:33640489 BRD2 Human nitrates multiple interactions ISO Brd2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BRD2 mRNA CTD PMID:35964746 BRD2 Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of BRD2 mRNA more ... CTD PMID:32699268 BRD2 Human paracetamol multiple interactions ISO Brd2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of BRD2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of BRD2 mRNA] CTD PMID:17585979 BRD2 Human paracetamol increases expression ISO Brd2 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of BRD2 mRNA CTD PMID:33387578 BRD2 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of BRD2 mRNA CTD PMID:21420995 more ... BRD2 Human paracetamol affects expression ISO Brd2 (Mus musculus) 6480464 Acetaminophen affects the expression of BRD2 mRNA CTD PMID:17562736 BRD2 Human pentachlorophenol increases expression ISO Brd2 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of BRD2 mRNA CTD PMID:23892564 BRD2 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Brd2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of BRD2 mRNA more ... CTD PMID:36331819 BRD2 Human phenobarbital decreases expression ISO Brd2 (Mus musculus) 6480464 Phenobarbital results in decreased expression of BRD2 mRNA CTD PMID:19270015 BRD2 Human phenobarbital affects expression ISO Brd2 (Mus musculus) 6480464 Phenobarbital affects the expression of BRD2 mRNA CTD PMID:23091169 BRD2 Human picoxystrobin increases expression EXP 6480464 picoxystrobin results in increased expression of BRD2 mRNA CTD PMID:33512557 BRD2 Human pirinixic acid increases expression ISO Brd2 (Mus musculus) 6480464 pirinixic acid results in increased expression of BRD2 mRNA CTD PMID:16985257 BRD2 Human propiconazole decreases expression ISO Brd2 (Rattus norvegicus) 6480464 propiconazole results in decreased expression of BRD2 mRNA CTD PMID:30047161 BRD2 Human pyrimidines decreases splicing EXP 6480464 Pyrimidines results in decreased splicing of BRD2 mRNA CTD PMID:25281741 BRD2 Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of BRD2 mRNA CTD PMID:21632981 BRD2 Human quinazolines decreases splicing EXP 6480464 Quinazolines results in decreased splicing of BRD2 mRNA CTD PMID:25281741 BRD2 Human rac-lactic acid increases expression EXP 6480464 Lactic Acid results in increased expression of BRD2 mRNA CTD PMID:30851411 BRD2 Human selenium atom multiple interactions EXP 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of BRD2 mRNA CTD PMID:19244175 BRD2 Human selenium atom increases expression EXP 6480464 Selenium results in increased expression of BRD2 mRNA CTD PMID:19244175 BRD2 Human silicon dioxide increases expression ISO Brd2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of BRD2 mRNA CTD PMID:19073995 BRD2 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of BRD2 mRNA CTD PMID:38568856 BRD2 Human sodium fluoride increases expression ISO Brd2 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of BRD2 mRNA CTD PMID:27862939 BRD2 Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of BRD2 mRNA CTD PMID:31758290 BRD2 Human testosterone enanthate affects expression EXP 6480464 testosterone enanthate affects the expression of BRD2 mRNA CTD PMID:17440010 BRD2 Human tetrachloromethane multiple interactions ISO Brd2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BRD2 mRNA] CTD PMID:31150632 BRD2 Human tetrachloromethane increases expression ISO Brd2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of BRD2 mRNA CTD PMID:31919559 BRD2 Human tetrachloromethane increases expression ISO Brd2 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of BRD2 mRNA CTD PMID:31150632 BRD2 Human thioacetamide increases expression ISO Brd2 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of BRD2 mRNA CTD PMID:34492290 BRD2 Human thiram increases expression EXP 6480464 Thiram results in increased expression of BRD2 mRNA CTD PMID:38568856 BRD2 Human titanium dioxide increases methylation ISO Brd2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of BRD2 promoter CTD PMID:35295148 BRD2 Human titanium dioxide decreases methylation ISO Brd2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of BRD2 gene and titanium dioxide results in decreased methylation of BRD2 promoter CTD PMID:35295148 BRD2 Human trichloroethene decreases expression ISO Brd2 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of BRD2 mRNA CTD PMID:33387578 BRD2 Human trichostatin A multiple interactions ISO Brd2 (Mus musculus) 6480464 trichostatin A inhibits the reaction [IL3 protein promotes the reaction [BRD2 protein binds to CISH promoter]] CTD PMID:25769527 BRD2 Human trichostatin A affects localization ISO Brd2 (Mus musculus) 6480464 trichostatin A affects the localization of BRD2 protein CTD PMID:25769527 BRD2 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of BRD2 mRNA CTD PMID:37042841 BRD2 Human triptonide increases expression ISO Brd2 (Mus musculus) 6480464 triptonide results in increased expression of BRD2 mRNA CTD PMID:33045310 BRD2 Human triticonazole decreases expression ISO Brd2 (Rattus norvegicus) 6480464 triticonazole results in decreased expression of BRD2 mRNA CTD PMID:36084822 BRD2 Human trovafloxacin increases expression ISO Brd2 (Mus musculus) 6480464 trovafloxacin results in increased expression of BRD2 mRNA CTD PMID:35537566 BRD2 Human tungsten decreases expression ISO Brd2 (Mus musculus) 6480464 Tungsten results in decreased expression of BRD2 mRNA CTD PMID:30912803 BRD2 Human tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of BRD2 mRNA CTD PMID:22378314 BRD2 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of BRD2 mRNA CTD PMID:29154799 BRD2 Human valproic acid affects localization ISO Brd2 (Mus musculus) 6480464 Valproic Acid affects the localization of BRD2 protein CTD PMID:25769527 BRD2 Human vinclozolin affects expression ISO Brd2 (Rattus norvegicus) 6480464 vinclozolin affects the expression of BRD2 mRNA CTD PMID:19015723 BRD2 Human vitamin E multiple interactions EXP 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of BRD2 mRNA CTD PMID:19244175 BRD2 Human vitamin E decreases expression EXP 6480464 Vitamin E results in decreased expression of BRD2 mRNA CTD PMID:19244175 BRD2 Human vitamin E increases expression EXP 6480464 Vitamin E results in increased expression of BRD2 mRNA CTD PMID:19244175
(+)-schisandrin B (ISO) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (ISO) 2-hydroxypropanoic acid (EXP) 3,3'-diindolylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (EXP) 6-propyl-2-thiouracil (ISO) acrolein (EXP) acrylamide (EXP) afimoxifene (EXP) aflatoxin B1 (ISO) alpha-pinene (EXP) amitrole (ISO) amphetamine (ISO) aristolochic acid A (EXP) azoxystrobin (EXP) benzatropine (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (EXP) Benzo[k]fluoranthene (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP) caffeine (EXP) CGP 52608 (EXP) chloroacetaldehyde (EXP) chloropicrin (EXP) cidofovir anhydrous (EXP) cisplatin (EXP,ISO) clodronic acid (EXP) clofibrate (ISO) cobalt dichloride (EXP) copper(II) sulfate (EXP) coumarin (EXP) Cuprizon (EXP) cyclosporin A (EXP) DDE (EXP) deguelin (EXP) diazinon (EXP) Dibutyl phosphate (EXP) diethyl malate (EXP) diethylstilbestrol (EXP) dioxygen (EXP) doxorubicin (EXP,ISO) elemental selenium (EXP) epoxiconazole (ISO) ethanol (ISO) fenofibrate (ISO) fenthion (ISO) flutamide (ISO) folic acid (ISO) FR900359 (EXP) fulvestrant (EXP) furan (ISO) gentamycin (ISO) ifosfamide (EXP) inulin (ISO) iron dichloride (EXP) ivermectin (EXP) leflunomide (EXP) lipopolysaccharide (ISO) metformin (ISO) methamphetamine (ISO) methapyrilene (ISO) methimazole (ISO) methotrexate (ISO) methyl methanesulfonate (EXP) methylisothiazolinone (EXP) methylmercury chloride (EXP) N-(6-acetamidohexyl)acetamide (ISO) N-methylformamide (ISO) nickel sulfate (EXP) nicotine (ISO) nitrates (ISO) ozone (EXP) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) picoxystrobin (EXP) pirinixic acid (ISO) propiconazole (ISO) pyrimidines (EXP) quercetin (EXP) quinazolines (EXP) rac-lactic acid (EXP) selenium atom (EXP) silicon dioxide (ISO) sodium arsenite (EXP) sodium fluoride (ISO) temozolomide (EXP) testosterone enanthate (EXP) tetrachloromethane (ISO) thioacetamide (ISO) thiram (EXP) titanium dioxide (ISO) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (EXP) triptonide (ISO) triticonazole (ISO) trovafloxacin (ISO) tungsten (ISO) tunicamycin (EXP) valproic acid (EXP,ISO) vinclozolin (ISO) vitamin E (EXP)
1.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
2.
E mu-BRD2 transgenic mice develop B-cell lymphoma and leukemia.
Greenwald RJ, etal., Blood. 2004 Feb 15;103(4):1475-84. Epub 2003 Oct 16.
3.
Association of BRD2 polymorphisms with photoparoxysmal response.
Lorenz S, etal., Neurosci Lett. 2006 May 29;400(1-2):135-9. Epub 2006 Mar 3.
4.
BRD2 (RING3) is a probable major susceptibility gene for common juvenile myoclonic epilepsy.
Pal DK, etal., Am J Hum Genet 2003 Aug;73(2):261-70. Epub 2003 Jun 25.
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
The bromodomain: From epigenome reader to druggable target.
Sanchez R, etal., Biochim Biophys Acta. 2014 Aug;1839(8):676-685. doi: 10.1016/j.bbagrm.2014.03.011. Epub 2014 Mar 28.
7.
BRD4 sustains melanoma proliferation and represents a new target for epigenetic therapy.
Segura MF, etal., Cancer Res. 2013 Oct 15;73(20):6264-76. doi: 10.1158/0008-5472.CAN-13-0122-T. Epub 2013 Aug 15.
8.
Brd2 disruption in mice causes severe obesity without Type 2 diabetes.
Wang F, etal., Biochem J. 2009 Dec 14;425(1):71-83. doi: 10.1042/BJ20090928.
BRD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 32,968,594 - 32,981,505 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 32,968,594 - 32,981,505 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 32,936,371 - 32,949,282 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 33,044,415 - 33,057,059 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 33,044,414 - 33,057,059 NCBI Celera 6 34,485,349 - 34,498,195 (+) NCBI Celera Cytogenetic Map 6 p21.32 NCBI HuRef 6 32,678,978 - 32,691,818 (+) NCBI HuRef CHM1_1 6 32,937,242 - 32,950,091 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 32,789,953 - 32,802,871 (+) NCBI T2T-CHM13v2.0
Brd2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 34,330,993 - 34,341,581 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 34,330,997 - 34,341,608 (-) Ensembl GRCm39 Ensembl GRCm38 17 34,112,019 - 34,122,814 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 34,112,023 - 34,122,634 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 34,248,964 - 34,258,692 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 33,722,473 - 33,730,354 (-) NCBI MGSCv36 mm8 Celera 17 36,864,043 - 36,873,770 (-) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 17.98 NCBI
Brd2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 4,728,282 - 4,737,286 (+) NCBI GRCr8 mRatBN7.2 20 4,727,078 - 4,735,389 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 4,728,151 - 4,735,388 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 5,480,415 - 5,487,612 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 4,842,158 - 4,849,355 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 5,323,436 - 5,330,635 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 3,910,555 - 3,921,074 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,262,120 - 5,269,337 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 3,910,555 - 3,917,426 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,323,184 - 7,330,398 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 4,864,606 - 4,871,813 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 4,864,832 - 4,872,040 (+) NCBI Celera 20 6,328,831 - 6,336,038 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
Brd2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 1,584,479 - 1,592,826 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 1,584,890 - 1,592,486 (+) NCBI ChiLan1.0 ChiLan1.0
BRD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 47,443,604 - 47,456,467 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 43,315,229 - 43,328,092 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 32,538,130 - 32,550,823 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 33,657,488 - 33,666,054 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 33,657,648 - 33,666,031 (+) Ensembl panpan1.1 panPan2
BRD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 2,534,034 - 2,546,029 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 2,534,034 - 2,546,029 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 2,615,604 - 2,627,599 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 2,864,982 - 2,876,982 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 2,864,927 - 2,876,950 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 2,533,065 - 2,545,060 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 2,614,613 - 2,626,605 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 2,689,162 - 2,701,159 (+) NCBI UU_Cfam_GSD_1.0
Brd2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 38,145,455 - 38,153,085 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 25,807,163 - 25,818,899 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 25,807,179 - 25,818,914 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BRD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 25,150,564 - 25,162,584 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 25,096,579 - 25,162,591 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 29,463,191 - 29,529,204 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BRD2
Brd2
.
Predicted Target Of
Count of predictions: 7785 Count of miRNA genes: 1129 Interacting mature miRNAs: 1442 Transcripts: ENST00000374825, ENST00000374831, ENST00000395287, ENST00000395289, ENST00000443797, ENST00000449025, ENST00000449085, ENST00000456339, ENST00000463639, ENST00000464592, ENST00000469132, ENST00000481259, ENST00000482838, ENST00000482914, ENST00000495733, ENST00000496118, ENST00000580234, ENST00000581002, ENST00000584808, ENST00000606059, ENST00000607833 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597432349 GWAS1528423_H protein measurement QTL GWAS1528423 (human) 8e-17 protein measurement 6 32975975 32975976 Human 597452377 GWAS1548451_H streptococcus seropositivity QTL GWAS1548451 (human) 2e-09 streptococcus seropositivity 6 32978545 32978546 Human 597045726 GWAS1141800_H hemoglobin measurement QTL GWAS1141800 (human) 2e-08 hemoglobin measurement hemoglobin measurement (CMO:0000508) 6 32977753 32977754 Human 597061854 GWAS1157928_H tonsillectomy risk measurement QTL GWAS1157928 (human) 0.0000004 tonsillectomy risk measurement 6 32977921 32977922 Human 597454930 GWAS1551004_H streptococcus seropositivity QTL GWAS1551004 (human) 2e-18 streptococcus seropositivity 6 32978545 32978546 Human 597431187 GWAS1527261_H protein measurement QTL GWAS1527261 (human) 2e-17 protein measurement 6 32978829 32978830 Human 597156101 GWAS1252175_H sarcoidosis QTL GWAS1252175 (human) 3e-08 sarcoidosis 6 32968664 32968665 Human 597511432 GWAS1607506_H triglyceride measurement QTL GWAS1607506 (human) 1e-36 triglyceride measurement blood triglyceride level (CMO:0000118) 6 32979739 32979740 Human 597162625 GWAS1258699_H dihomo-linoleate 20:2n6 measurement QTL GWAS1258699 (human) 0.000005 dihomo-linoleate 20:2n6 measurement 6 32978179 32978180 Human 597389068 GWAS1485142_H susceptibility to Mycobacterium tuberculosis infection measurement QTL GWAS1485142 (human) 8e-09 susceptibility to Mycobacterium tuberculosis infection measurement 6 32978545 32978546 Human 407081172 GWAS730148_H inflammatory bowel disease QTL GWAS730148 (human) 5e-11 inflammatory bowel disease 6 32981027 32981028 Human 597614279 GWAS1671139_H acute tonsillitis QTL GWAS1671139 (human) 4e-11 acute tonsillitis 6 32977086 32977087 Human 1358857 MULTSCL19_H Multiple sclerosis susceptibility QTL 19 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 1358839 MULTSCL5_H Multiple sclerosis susceptibility QTL 5 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 407081184 GWAS730160_H inflammatory bowel disease QTL GWAS730160 (human) 9e-10 inflammatory bowel disease 6 32981027 32981028 Human 597163699 GWAS1259773_H lipid measurement QTL GWAS1259773 (human) 0.000003 lipid measurement blood lipid measurement (CMO:0000050) 6 32978179 32978180 Human 597206846 GWAS1302920_H protein measurement QTL GWAS1302920 (human) 3e-10 protein measurement 6 32978252 32978253 Human 597105853 GWAS1201927_H protein measurement QTL GWAS1201927 (human) 2e-08 protein measurement 6 32978252 32978253 Human 407080104 GWAS729080_H Crohn's disease QTL GWAS729080 (human) 5e-09 intestine integrity trait (VT:0010554) 6 32981027 32981028 Human 1298431 RA11_H Rheumatoid arthritis QTL 11 (human) 0.0000024 Joint/bone inflammation rheumatoid arthritis 6 19911883 40191709 Human 597498033 GWAS1594107_H triglyceride measurement QTL GWAS1594107 (human) 3e-27 triglyceride measurement blood triglyceride level (CMO:0000118) 6 32979739 32979740 Human 407080367 GWAS729343_H Crohn's disease QTL GWAS729343 (human) 0.000003 intestine integrity trait (VT:0010554) 6 32981027 32981028 Human 597105376 GWAS1201450_H protein measurement QTL GWAS1201450 (human) 3e-09 protein measurement 6 32978252 32978253 Human 407080377 GWAS729353_H Crohn's disease QTL GWAS729353 (human) 0.0000003 intestine integrity trait (VT:0010554) 6 32981027 32981028 Human 597430247 GWAS1526321_H protein measurement QTL GWAS1526321 (human) 2e-24 protein measurement 6 32975975 32975976 Human 407080383 GWAS729359_H ulcerative colitis QTL GWAS729359 (human) 2e-08 inflammatory bowel disease 6 32981027 32981028 Human
G67884
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,943,866 - 32,944,082 UniSTS GRCh37 Build 36 6 33,051,844 - 33,052,060 RGD NCBI36 Celera 6 34,492,777 - 34,492,993 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,686,400 - 32,686,616 UniSTS
D6S2656
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,942,958 - 32,943,257 UniSTS GRCh37 Build 36 6 33,050,936 - 33,051,235 RGD NCBI36 Celera 6 34,491,869 - 34,492,168 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,685,490 - 32,685,791 UniSTS
RING3-CA
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,942,887 - 32,943,119 UniSTS GRCh37 Build 36 6 33,050,865 - 33,051,097 RGD NCBI36 Celera 6 34,491,798 - 34,492,030 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,685,419 - 32,685,653 UniSTS
A008D22
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,949,128 - 32,949,242 UniSTS GRCh37 Build 36 6 33,057,106 - 33,057,220 RGD NCBI36 Celera 6 34,498,041 - 34,498,155 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,691,664 - 32,691,778 UniSTS GeneMap99-GB4 RH Map 6 120.09 UniSTS NCBI RH Map 6 509.1 UniSTS
RH18121
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,948,650 - 32,948,847 UniSTS GRCh37 Build 36 6 33,056,628 - 33,056,825 RGD NCBI36 Celera 6 34,497,563 - 34,497,760 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,691,186 - 32,691,383 UniSTS GeneMap99-GB4 RH Map 6 119.82 UniSTS
NIB1722
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,948,957 - 32,949,057 UniSTS GRCh37 Build 36 6 33,056,935 - 33,057,035 RGD NCBI36 Celera 6 34,497,870 - 34,497,970 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,691,493 - 32,691,593 UniSTS GeneMap99-GB4 RH Map 6 119.43 UniSTS Whitehead-RH Map 6 179.7 UniSTS NCBI RH Map 6 509.1 UniSTS
STS-T87864
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,943,826 - 32,944,139 UniSTS GRCh37 Build 36 6 33,051,804 - 33,052,117 RGD NCBI36 Celera 6 34,492,737 - 34,493,050 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,686,360 - 32,686,673 UniSTS GeneMap99-GB4 RH Map 19 41.45 UniSTS NCBI RH Map 19 10.0 UniSTS
SGC31960
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,945,705 - 32,945,950 UniSTS GRCh37 Build 36 6 33,053,683 - 33,053,928 RGD NCBI36 Celera 6 34,494,616 - 34,494,861 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,688,239 - 32,688,484 UniSTS GeneMap99-GB4 RH Map 6 119.82 UniSTS GeneMap99-GB4 RH Map 6 145.45 UniSTS Whitehead-RH Map 6 179.7 UniSTS NCBI RH Map 6 509.1 UniSTS
D6S1894
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,948,615 - 32,948,727 UniSTS GRCh37 Build 36 6 33,056,593 - 33,056,705 RGD NCBI36 Celera 6 34,497,528 - 34,497,640 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,691,151 - 32,691,263 UniSTS
M2_2_23
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,942,960 - 32,943,256 UniSTS GRCh37 Build 36 6 33,050,938 - 33,051,234 RGD NCBI36 Celera 6 34,491,871 - 34,492,167 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,685,492 - 32,685,790 UniSTS
CGCb250
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,944,039 - 32,944,179 UniSTS GRCh37 Build 36 6 33,052,017 - 33,052,157 RGD NCBI36 Celera 6 34,492,950 - 34,493,090 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,686,573 - 32,686,713 UniSTS
CGCb278
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,939,721 - 32,939,834 UniSTS GRCh37 Build 36 6 33,047,699 - 33,047,812 RGD NCBI36 Celera 6 34,488,632 - 34,488,745 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,682,253 - 32,682,366 UniSTS
CGCb369
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,945,912 - 32,946,017 UniSTS GRCh37 Build 36 6 33,053,890 - 33,053,995 RGD NCBI36 Celera 6 34,494,823 - 34,494,928 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,688,446 - 32,688,551 UniSTS
CGCb535
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,942,226 - 32,942,396 UniSTS GRCh37 Build 36 6 33,050,204 - 33,050,374 RGD NCBI36 Celera 6 34,491,137 - 34,491,307 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,684,758 - 32,684,928 UniSTS
CGCb688
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,943,096 - 32,943,257 UniSTS GRCh37 Build 36 6 33,051,074 - 33,051,235 RGD NCBI36 Celera 6 34,492,007 - 34,492,168 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,685,630 - 32,685,791 UniSTS
CGCb741
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,943,901 - 32,944,056 UniSTS GRCh37 Build 36 6 33,051,879 - 33,052,034 RGD NCBI36 Celera 6 34,492,812 - 34,492,967 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,686,435 - 32,686,590 UniSTS
CGCb781
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,946,063 - 32,946,199 UniSTS GRCh37 Build 36 6 33,054,041 - 33,054,177 RGD NCBI36 Celera 6 34,494,974 - 34,495,110 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,688,597 - 32,688,733 UniSTS
CGCb787
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,936,138 - 32,936,283 UniSTS GRCh37 Build 36 6 33,044,116 - 33,044,261 RGD NCBI36 Celera 6 34,485,050 - 34,485,195 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,678,679 - 32,678,824 UniSTS
CGCb908
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,944,686 - 32,944,810 UniSTS GRCh37 Build 36 6 33,052,664 - 33,052,788 RGD NCBI36 Celera 6 34,493,597 - 34,493,721 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,687,220 - 32,687,344 UniSTS
CGCbi2
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,941,825 - 32,942,269 UniSTS GRCh37 Build 36 6 33,049,803 - 33,050,247 RGD NCBI36 Celera 6 34,490,736 - 34,491,180 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,684,357 - 32,684,801 UniSTS
CGCbi4-2
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,943,473 - 32,943,846 UniSTS GRCh37 Build 36 6 33,051,451 - 33,051,824 RGD NCBI36 Celera 6 34,492,384 - 34,492,757 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,686,007 - 32,686,380 UniSTS
CGCbpr
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,936,192 - 32,936,479 UniSTS GRCh37 Build 36 6 33,044,170 - 33,044,457 RGD NCBI36 Celera 6 34,485,104 - 34,485,391 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,678,733 - 32,679,020 UniSTS
CGCbx13
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,948,325 - 32,948,669 UniSTS GRCh37 Build 36 6 33,056,303 - 33,056,647 RGD NCBI36 Celera 6 34,497,238 - 34,497,582 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,690,861 - 32,691,205 UniSTS
CGCbx3
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,942,221 - 32,942,381 UniSTS GRCh37 Build 36 6 33,050,199 - 33,050,359 RGD NCBI36 Celera 6 34,491,132 - 34,491,292 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,684,753 - 32,684,913 UniSTS
CGCbx4
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,943,115 - 32,943,346 UniSTS GRCh37 Build 36 6 33,051,093 - 33,051,324 RGD NCBI36 Celera 6 34,492,026 - 34,492,257 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,685,649 - 32,685,880 UniSTS
CGCbx9
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,945,486 - 32,945,848 UniSTS GRCh37 Build 36 6 33,053,464 - 33,053,826 RGD NCBI36 Celera 6 34,494,397 - 34,494,759 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,688,020 - 32,688,382 UniSTS
BRD2_3857
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,948,364 - 32,949,215 UniSTS GRCh37 Build 36 6 33,056,342 - 33,057,193 RGD NCBI36 Celera 6 34,497,277 - 34,498,128 RGD HuRef 6 32,690,900 - 32,691,751 UniSTS
RING3CA
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,942,887 - 32,943,119 UniSTS GRCh37 GRCh37 6 32,942,887 - 32,943,126 UniSTS GRCh37 GRCh37 6 32,942,902 - 32,943,119 UniSTS GRCh37 Build 36 6 33,050,865 - 33,051,104 RGD NCBI36 Celera 6 34,491,798 - 34,492,030 UniSTS Celera 6 34,491,798 - 34,492,037 RGD Celera 6 34,491,813 - 34,492,030 UniSTS HuRef 6 32,685,434 - 32,685,653 UniSTS HuRef 6 32,685,419 - 32,685,660 UniSTS HuRef 6 32,685,419 - 32,685,653 UniSTS
RH79050
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,943,231 - 32,943,915 UniSTS GRCh37 Celera 6 34,492,142 - 34,492,826 UniSTS Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,685,765 - 32,686,449 UniSTS GeneMap99-GB4 RH Map 6 120.15 UniSTS NCBI RH Map 6 509.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2438
2788
2252
4973
1726
2351
6
624
1951
465
2269
7304
6471
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000374825 ⟹ ENSP00000363958
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,968,594 - 32,981,501 (+) Ensembl
Ensembl Acc Id:
ENST00000374831 ⟹ ENSP00000363964
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,970,888 - 32,981,505 (+) Ensembl
Ensembl Acc Id:
ENST00000395287 ⟹ ENSP00000378702
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,972,730 - 32,981,505 (+) Ensembl
Ensembl Acc Id:
ENST00000449025 ⟹ ENSP00000409613
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,973,084 - 32,981,505 (+) Ensembl
Ensembl Acc Id:
ENST00000449085 ⟹ ENSP00000409145
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,969,267 - 32,981,501 (+) Ensembl
Ensembl Acc Id:
ENST00000456339 ⟹ ENSP00000411195
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,969,319 - 32,976,618 (+) Ensembl
Ensembl Acc Id:
ENST00000463639
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,973,350 - 32,981,323 (+) Ensembl
Ensembl Acc Id:
ENST00000464592
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,971,082 - 32,980,815 (+) Ensembl
Ensembl Acc Id:
ENST00000469132
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,968,899 - 32,981,286 (+) Ensembl
Ensembl Acc Id:
ENST00000481259 ⟹ ENSP00000433751
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,976,569 - 32,977,901 (+) Ensembl
Ensembl Acc Id:
ENST00000482838
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,979,682 - 32,980,766 (+) Ensembl
Ensembl Acc Id:
ENST00000482914 ⟹ ENSP00000431514
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,970,953 - 32,981,505 (+) Ensembl
Ensembl Acc Id:
ENST00000495733 ⟹ ENSP00000436322
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,970,930 - 32,978,197 (+) Ensembl
Ensembl Acc Id:
ENST00000496118 ⟹ ENSP00000464077
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,969,165 - 32,972,141 (+) Ensembl
Ensembl Acc Id:
ENST00000580234
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,970,238 - 32,972,116 (+) Ensembl
Ensembl Acc Id:
ENST00000581002
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,970,902 - 32,972,051 (+) Ensembl
Ensembl Acc Id:
ENST00000584808
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,970,705 - 32,972,048 (+) Ensembl
Ensembl Acc Id:
ENST00000606059 ⟹ ENSP00000475288
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,976,413 - 32,977,074 (+) Ensembl
Ensembl Acc Id:
ENST00000607833 ⟹ ENSP00000475691
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,972,217 - 32,978,203 (+) Ensembl
Ensembl Acc Id:
ENST00000677085 ⟹ ENSP00000504779
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,970,246 - 32,981,040 (+) Ensembl
Ensembl Acc Id:
ENST00000677331
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,969,278 - 32,980,815 (+) Ensembl
Ensembl Acc Id:
ENST00000678250 ⟹ ENSP00000502900
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,969,449 - 32,981,501 (+) Ensembl
Ensembl Acc Id:
ENST00000678778 ⟹ ENSP00000503515
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,968,899 - 32,980,779 (+) Ensembl
Ensembl Acc Id:
ENST00000679099
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,971,082 - 32,981,040 (+) Ensembl
Ensembl Acc Id:
ENST00000679179 ⟹ ENSP00000503678
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,968,899 - 32,981,040 (+) Ensembl
RefSeq Acc Id:
NM_001113182 ⟹ NP_001106653
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 32,970,930 - 32,981,501 (+) NCBI GRCh37 6 32,936,437 - 32,949,282 (+) ENTREZGENE HuRef 6 32,678,978 - 32,691,818 (+) ENTREZGENE CHM1_1 6 32,939,470 - 32,950,091 (+) NCBI T2T-CHM13v2.0 6 32,792,289 - 32,802,867 (+) NCBI
Sequence:
GCTCGCCCTCCTCCCTGGCGCTGACCGATGGACCAGCCGCTCCGTGGGGAGGACTCCGGACCCTGGTGGGGGGGCGGGGGGGTTCTTTCGCCCCCGTGGCGGAGGGCCCCTGAGAGGCGGATACGGGT
hide sequence
RefSeq Acc Id:
NM_001199455 ⟹ NP_001186384
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 32,971,595 - 32,981,505 (+) NCBI GRCh37 6 32,936,437 - 32,949,282 (+) ENTREZGENE HuRef 6 32,678,978 - 32,691,818 (+) ENTREZGENE CHM1_1 6 32,940,177 - 32,950,091 (+) NCBI T2T-CHM13v2.0 6 32,792,954 - 32,802,871 (+) NCBI
Sequence:
ATTCTTCGCTGCTGCTGCCTTACCGCCGAGAACCACCACCCGCCAGGCGTCTTGCGGCCACACC
hide sequence
RefSeq Acc Id:
NM_001199456 ⟹ NP_001186385
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 32,973,084 - 32,981,501 (+) NCBI GRCh37 6 32,936,437 - 32,949,282 (+) ENTREZGENE HuRef 6 32,678,978 - 32,691,818 (+) ENTREZGENE CHM1_1 6 32,941,666 - 32,950,091 (+) NCBI T2T-CHM13v2.0 6 32,794,443 - 32,802,867 (+) NCBI
Sequence:
GGAACGGTGGTGGCGGCTCGGCTACTGCTCGTGGAGGGGAATACAGGCTCCCTGGGGAAGGGAA
hide sequence
RefSeq Acc Id:
NM_001291986 ⟹ NP_001278915
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 32,970,930 - 32,981,501 (+) NCBI CHM1_1 6 32,939,470 - 32,950,091 (+) NCBI T2T-CHM13v2.0 6 32,792,289 - 32,802,867 (+) NCBI
Sequence:
GCTCGCCCTCCTCCCTGGCGCTGACCGATGGACCAGCCGCTCCGTGGGGAGGACTCCGGACCCTGGTGGGGGGGCGGGGGGGTTCTTTCGCCCCCGTGGCGGAGGGCCCCTGAGAGGCGGATACGGGT
hide sequence
RefSeq Acc Id:
NM_005104 ⟹ NP_005095
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 32,968,594 - 32,981,501 (+) NCBI GRCh37 6 32,936,437 - 32,949,282 (+) ENTREZGENE Build 36 6 33,044,415 - 33,057,059 (+) NCBI Archive HuRef 6 32,678,978 - 32,691,818 (+) ENTREZGENE CHM1_1 6 32,937,242 - 32,950,091 (+) NCBI T2T-CHM13v2.0 6 32,789,953 - 32,802,867 (+) NCBI
Sequence:
GTGTTCCTGGTCTGCGGCAGCCATGCTGAACTCGTATGGAGAGGCGAGTGGGGGGGACAGAGTCCAGGACTGCGGGATAGGAAGCTGGGGATATGGACAAGCAGCAGCGTTATAGCGCTCTGGGTTTC
hide sequence
RefSeq Acc Id:
XM_047419222 ⟹ XP_047275178
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 32,970,930 - 32,979,902 (+) NCBI
RefSeq Acc Id:
XM_047419223 ⟹ XP_047275179
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 32,970,930 - 32,977,523 (+) NCBI
RefSeq Acc Id:
XM_054356162 ⟹ XP_054212137
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 32,792,289 - 32,801,267 (+) NCBI
RefSeq Acc Id:
XM_054356163 ⟹ XP_054212138
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 32,792,289 - 32,798,882 (+) NCBI
RefSeq Acc Id:
NP_005095 ⟸ NM_005104
- Peptide Label:
isoform 1
- UniProtKB:
Q6P3U2 (UniProtKB/Swiss-Prot), Q658Y7 (UniProtKB/Swiss-Prot), Q63HQ9 (UniProtKB/Swiss-Prot), Q5STC9 (UniProtKB/Swiss-Prot), Q15310 (UniProtKB/Swiss-Prot), O00700 (UniProtKB/Swiss-Prot), O00699 (UniProtKB/Swiss-Prot), B1AZT1 (UniProtKB/Swiss-Prot), B0S7P0 (UniProtKB/Swiss-Prot), A2AAU0 (UniProtKB/Swiss-Prot), Q969U4 (UniProtKB/Swiss-Prot), P25440 (UniProtKB/Swiss-Prot), H0Y6K2 (UniProtKB/TrEMBL)
- Sequence:
MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKR
hide sequence
RefSeq Acc Id:
NP_001106653 ⟸ NM_001113182
- Peptide Label:
isoform 1
- UniProtKB:
Q6P3U2 (UniProtKB/Swiss-Prot), Q658Y7 (UniProtKB/Swiss-Prot), Q63HQ9 (UniProtKB/Swiss-Prot), Q5STC9 (UniProtKB/Swiss-Prot), Q15310 (UniProtKB/Swiss-Prot), O00700 (UniProtKB/Swiss-Prot), O00699 (UniProtKB/Swiss-Prot), B1AZT1 (UniProtKB/Swiss-Prot), B0S7P0 (UniProtKB/Swiss-Prot), A2AAU0 (UniProtKB/Swiss-Prot), Q969U4 (UniProtKB/Swiss-Prot), P25440 (UniProtKB/Swiss-Prot), H0Y6K2 (UniProtKB/TrEMBL)
- Sequence:
MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPP
hide sequence
RefSeq Acc Id:
NP_001186384 ⟸ NM_001199455
- Peptide Label:
isoform 2
- UniProtKB:
A0A0G2JK44 (UniProtKB/TrEMBL)
- Sequence:
MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKR
hide sequence
RefSeq Acc Id:
NP_001186385 ⟸ NM_001199456
- Peptide Label:
isoform 3
- UniProtKB:
X5CF57 (UniProtKB/TrEMBL), H0Y6K2 (UniProtKB/TrEMBL)
- Sequence:
MASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQ
hide sequence
RefSeq Acc Id:
NP_001278915 ⟸ NM_001291986
- Peptide Label:
isoform 4
- UniProtKB:
A0A1U9X7A8 (UniProtKB/TrEMBL), A0A1U9X7B3 (UniProtKB/TrEMBL), A0A1U9X7B4 (UniProtKB/TrEMBL), A0A1U9X7B8 (UniProtKB/TrEMBL)
- Sequence:
MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISS
hide sequence
Ensembl Acc Id:
ENSP00000363958 ⟸ ENST00000374825
Ensembl Acc Id:
ENSP00000363964 ⟸ ENST00000374831
Ensembl Acc Id:
ENSP00000436322 ⟸ ENST00000495733
Ensembl Acc Id:
ENSP00000433751 ⟸ ENST00000481259
Ensembl Acc Id:
ENSP00000411195 ⟸ ENST00000456339
Ensembl Acc Id:
ENSP00000431514 ⟸ ENST00000482914
Ensembl Acc Id:
ENSP00000464077 ⟸ ENST00000496118
Ensembl Acc Id:
ENSP00000378702 ⟸ ENST00000395287
Ensembl Acc Id:
ENSP00000409613 ⟸ ENST00000449025
Ensembl Acc Id:
ENSP00000409145 ⟸ ENST00000449085
Ensembl Acc Id:
ENSP00000475288 ⟸ ENST00000606059
Ensembl Acc Id:
ENSP00000475691 ⟸ ENST00000607833
Ensembl Acc Id:
ENSP00000504779 ⟸ ENST00000677085
Ensembl Acc Id:
ENSP00000502900 ⟸ ENST00000678250
Ensembl Acc Id:
ENSP00000503515 ⟸ ENST00000678778
Ensembl Acc Id:
ENSP00000503678 ⟸ ENST00000679179
RefSeq Acc Id:
XP_047275178 ⟸ XM_047419222
- Peptide Label:
isoform X1
- UniProtKB:
U3KQA6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047275179 ⟸ XM_047419223
- Peptide Label:
isoform X2
- UniProtKB:
E9PIQ3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054212137 ⟸ XM_054356162
- Peptide Label:
isoform X1
- UniProtKB:
U3KQA6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054212138 ⟸ XM_054356163
- Peptide Label:
isoform X2
- UniProtKB:
E9PIQ3 (UniProtKB/TrEMBL)
RGD ID: 6872868 Promoter ID: EPDNEW_H9574 Type: initiation region Name: BRD2_3 Description: bromodomain containing 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H9575 EPDNEW_H9576 EPDNEW_H9577 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 6 32,968,603 - 32,968,663 EPDNEW
RGD ID: 6803832 Promoter ID: HG_KWN:53142 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_005104, OTTHUMT00000276543, OTTHUMT00000276549, UC010JUG.1 Position: Human Assembly Chr Position (strand) Source Build 36 6 33,043,296 - 33,044,402 (+) MPROMDB
RGD ID: 6805035 Promoter ID: HG_KWN:53144 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: ENST00000374831, ENST00000395289, OTTHUMT00000276546, OTTHUMT00000276930, UC003OCO.2, UC003OCP.2, UC010JUH.1 Position: Human Assembly Chr Position (strand) Source Build 36 6 33,045,156 - 33,048,502 (+) MPROMDB
RGD ID: 6812913 Promoter ID: HG_ACW:68007 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_2Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: BRD2.TAPR07-UNSPLICED Position: Human Assembly Chr Position (strand) Source Build 36 6 33,049,321 - 33,050,592 (+) MPROMDB
RGD ID: 6803808 Promoter ID: HG_KWN:53146 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000276551, OTTHUMT00000276552 Position: Human Assembly Chr Position (strand) Source Build 36 6 33,050,971 - 33,052,657 (+) MPROMDB
RGD ID: 6803807 Promoter ID: HG_KWN:53147 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000276553 Position: Human Assembly Chr Position (strand) Source Build 36 6 33,053,104 - 33,053,604 (+) MPROMDB
RGD ID: 6803809 Promoter ID: HG_KWN:53148 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000276547, OTTHUMT00000276554 Position: Human Assembly Chr Position (strand) Source Build 36 6 33,054,356 - 33,056,127 (+) MPROMDB
COSMIC BRD2 COSMIC
Ensembl Genes ENSG00000204256 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
ENSG00000215077 UniProtKB/Swiss-Prot
ENSG00000234507 UniProtKB/Swiss-Prot
ENSG00000234704 UniProtKB/Swiss-Prot
ENSG00000235307 UniProtKB/Swiss-Prot
Ensembl Transcript ENST00000374825 ENTREZGENE
ENST00000374825.9 UniProtKB/Swiss-Prot
ENST00000374831 ENTREZGENE
ENST00000374831.8 UniProtKB/Swiss-Prot
ENST00000383108.6 UniProtKB/Swiss-Prot
ENST00000395287 ENTREZGENE
ENST00000395287.5 UniProtKB/Swiss-Prot
ENST00000399527.5 UniProtKB/Swiss-Prot
ENST00000399528.5 UniProtKB/Swiss-Prot
ENST00000399529.7 UniProtKB/Swiss-Prot
ENST00000414731.6 UniProtKB/Swiss-Prot
ENST00000436979.5 UniProtKB/Swiss-Prot
ENST00000438194.6 UniProtKB/Swiss-Prot
ENST00000442863.5 UniProtKB/Swiss-Prot
ENST00000448067.5 UniProtKB/Swiss-Prot
ENST00000449025 ENTREZGENE
ENST00000449085.4 UniProtKB/Swiss-Prot
ENST00000449118.5 UniProtKB/Swiss-Prot
ENST00000495733 ENTREZGENE
ENST00000549126.4 UniProtKB/Swiss-Prot
ENST00000552587.4 UniProtKB/Swiss-Prot
ENST00000607833 ENTREZGENE
ENST00000678250.1 UniProtKB/Swiss-Prot
Gene3D-CATH 1.20.1270.220 UniProtKB/Swiss-Prot
1.20.920.10 UniProtKB/Swiss-Prot
GTEx ENSG00000204256 GTEx
ENSG00000215077 GTEx
ENSG00000234507 GTEx
ENSG00000234704 GTEx
ENSG00000235307 GTEx
HGNC ID HGNC:1103 ENTREZGENE
Human Proteome Map BRD2 Human Proteome Map
InterPro Bromo_Brdt_I UniProtKB/Swiss-Prot
Bromo_Brdt_II UniProtKB/Swiss-Prot
Bromo_chromatin_reader UniProtKB/Swiss-Prot
Bromodomain UniProtKB/Swiss-Prot
Bromodomain-like_sf UniProtKB/Swiss-Prot
Bromodomain_CS UniProtKB/Swiss-Prot
NET_dom UniProtKB/Swiss-Prot
NET_sf UniProtKB/Swiss-Prot
KEGG Report hsa:6046 UniProtKB/Swiss-Prot
NCBI Gene 6046 ENTREZGENE
OMIM 601540 OMIM
PANTHER BROMODOMAIN-CONTAINING PROTEIN 2 UniProtKB/Swiss-Prot
FALZ-RELATED BROMODOMAIN-CONTAINING PROTEINS UniProtKB/Swiss-Prot
Pfam BET UniProtKB/Swiss-Prot
Bromodomain UniProtKB/Swiss-Prot
PharmGKB PA25414 PharmGKB
PRINTS BROMODOMAIN UniProtKB/Swiss-Prot
PROSITE BROMODOMAIN_1 UniProtKB/Swiss-Prot
BROMODOMAIN_2 UniProtKB/Swiss-Prot
NET UniProtKB/Swiss-Prot
RNAcentral URS00009B474B RNACentral
URS00009C2F74 RNACentral
URS0002617AE1 RNACentral
URS0002617B60 RNACentral
URS0002618188 RNACentral
URS0002618474 RNACentral
URS000261851F RNACentral
URS000261855F RNACentral
SMART BROMO UniProtKB/Swiss-Prot
Superfamily-SCOP SSF47370 UniProtKB/Swiss-Prot
UniProt A0A0G2JHL0_HUMAN UniProtKB/TrEMBL
A0A0G2JHN8_HUMAN UniProtKB/TrEMBL
A0A0G2JK44 ENTREZGENE, UniProtKB/TrEMBL
A0A140T9E9_HUMAN UniProtKB/TrEMBL
A0A140T9F7_HUMAN UniProtKB/TrEMBL
A0A140T9I1_HUMAN UniProtKB/TrEMBL
A0A140T9V2_HUMAN UniProtKB/TrEMBL
A0A140T9X8_HUMAN UniProtKB/TrEMBL
A0A1U9X7A8 ENTREZGENE, UniProtKB/TrEMBL
A0A1U9X7B3 ENTREZGENE, UniProtKB/TrEMBL
A0A1U9X7B4 ENTREZGENE, UniProtKB/TrEMBL
A0A1U9X7B8 ENTREZGENE, UniProtKB/TrEMBL
A2AAU0 ENTREZGENE
B0S7P0 ENTREZGENE
B1AZT1 ENTREZGENE
BRD2_HUMAN UniProtKB/Swiss-Prot
E9PIQ3 ENTREZGENE, UniProtKB/TrEMBL
E9PKQ9_HUMAN UniProtKB/TrEMBL
H0Y6K2 ENTREZGENE, UniProtKB/TrEMBL
H0Y799_HUMAN UniProtKB/TrEMBL
H0YDJ7_HUMAN UniProtKB/TrEMBL
J3QR72_HUMAN UniProtKB/TrEMBL
O00699 ENTREZGENE
O00700 ENTREZGENE
P25440 ENTREZGENE
Q15310 ENTREZGENE
Q5STC9 ENTREZGENE
Q63HQ9 ENTREZGENE
Q658Y7 ENTREZGENE
Q6P3U2 ENTREZGENE
Q969U4 ENTREZGENE
U3KPW0_HUMAN UniProtKB/TrEMBL
U3KQA6 ENTREZGENE, UniProtKB/TrEMBL
X5CF57 ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary A2AAU0 UniProtKB/Swiss-Prot
B0S7P0 UniProtKB/Swiss-Prot
B1AZT1 UniProtKB/Swiss-Prot
O00699 UniProtKB/Swiss-Prot
O00700 UniProtKB/Swiss-Prot
Q15310 UniProtKB/Swiss-Prot
Q5STC9 UniProtKB/Swiss-Prot
Q63HQ9 UniProtKB/Swiss-Prot
Q658Y7 UniProtKB/Swiss-Prot
Q6P3U2 UniProtKB/Swiss-Prot
Q969U4 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-01-20
BRD2
bromodomain containing 2
BRD2-IT1
BRD2 intronic transcript 1
Data merged from RGD:10413065
737654 PROVISIONAL
