Symbol:
ARHGAP6
Name:
Rho GTPase activating protein 6
RGD ID:
1349829
HGNC Page
HGNC:676
Description:
Enables phospholipase activator activity and phospholipase binding activity. Involved in negative regulation of focal adhesion assembly; negative regulation of stress fiber assembly; and positive regulation of phospholipase C/protein kinase C signal transduction. Located in cytosol and mitotic spindle.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
rho GTPase-activating protein 6; rho-type GTPase-activating protein 6; Rho-type GTPase-activating protein RhoGAPX-1; RHOGAP6; RHOGAPX-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Arhgap6 (Rho GTPase activating protein 6) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Arhgap6 (Rho GTPase activating protein 6) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Arhgap6 (Rho GTPase activating protein 6) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
ARHGAP6 (Rho GTPase activating protein 6) NCBI
Ortholog
Canis lupus familiaris (dog):
ARHGAP6 (Rho GTPase activating protein 6) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Arhgap6 (Rho GTPase activating protein 6) NCBI
Ortholog
Sus scrofa (pig):
ARHGAP6 (Rho GTPase activating protein 6) HGNC
Ensembl, NCBI, OMA, OrthoDB, Panther
Chlorocebus sabaeus (green monkey):
ARHGAP6 (Rho GTPase activating protein 6) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Arhgap6 (Rho GTPase activating protein 6) NCBI
Ortholog
Alliance orthologs 3
Mus musculus (house mouse):
Arhgap6 (Rho GTPase activating protein 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Arhgap6 (Rho GTPase activating protein 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
RhoGAP102A
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
rga-6
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
arhgap6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 11,137,544 - 11,665,920 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 11,117,651 - 11,665,920 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 11,155,664 - 11,684,040 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 11,065,584 - 11,593,742 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 10,915,323 - 11,443,478 NCBI Celera X 15,283,114 - 15,812,107 (-) NCBI Celera Cytogenetic Map X p22.2 NCBI HuRef X 8,936,119 - 9,462,624 (-) NCBI HuRef CHM1_1 X 11,186,095 - 11,714,183 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 10,720,022 - 11,248,464 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
ARHGAP6 Human 1,2-dichloroethane affects expression ISO Arhgap6 (Mus musculus) 6480464 ethylene dichloride affects the expression of ARHGAP6 mRNA CTD PMID:28960355 ARHGAP6 Human 1,2-dimethylhydrazine decreases expression ISO Arhgap6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ARHGAP6 mRNA CTD PMID:22206623 ARHGAP6 Human 17beta-estradiol decreases expression ISO Arhgap6 (Rattus norvegicus) 6480464 Estradiol results in decreased expression of ARHGAP6 mRNA CTD PMID:32145629 ARHGAP6 Human 17beta-estradiol decreases expression ISO Arhgap6 (Mus musculus) 6480464 Estradiol results in decreased expression of ARHGAP6 mRNA CTD PMID:39298647 ARHGAP6 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Arhgap6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ARHGAP6 mRNA CTD PMID:19933214 ARHGAP6 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Arhgap6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ARHGAP6 mRNA CTD PMID:21570461 ARHGAP6 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Arhgap6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARHGAP6 mRNA CTD PMID:18172886 ARHGAP6 Human 3,3',5,5'-tetrabromobisphenol A increases expression ISO Arhgap6 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of ARHGAP6 mRNA CTD PMID:25172293 ARHGAP6 Human 4,4'-sulfonyldiphenol increases expression ISO Arhgap6 (Mus musculus) 6480464 bisphenol S results in increased expression of ARHGAP6 mRNA CTD PMID:30951980 ARHGAP6 Human 4,4'-sulfonyldiphenol decreases expression ISO Arhgap6 (Mus musculus) 6480464 bisphenol S results in decreased expression of ARHGAP6 mRNA CTD PMID:39298647 ARHGAP6 Human 7,12-dimethyltetraphene decreases expression ISO Arhgap6 (Mus musculus) 6480464 9 more ... CTD PMID:32553695 ARHGAP6 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of ARHGAP6 gene CTD PMID:27153756 ARHGAP6 Human aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of ARHGAP6 mRNA CTD PMID:32234424 ARHGAP6 Human Aflatoxin B2 alpha decreases methylation EXP 6480464 aflatoxin B2 results in decreased methylation of ARHGAP6 intron CTD PMID:30157460 ARHGAP6 Human aldehydo-D-glucose increases expression ISO Arhgap6 (Mus musculus) 6480464 Glucose results in increased expression of ARHGAP6 mRNA CTD PMID:31525975 ARHGAP6 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of ARHGAP6 mRNA CTD PMID:21934132 and PMID:23724009 ARHGAP6 Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of ARHGAP6 mRNA CTD PMID:33212167 ARHGAP6 Human benzo[a]pyrene decreases expression ISO Arhgap6 (Mus musculus) 6480464 Benzo(a)pyrene metabolite results in decreased expression of ARHGAP6 mRNA and Benzo(a)pyrene results in decreased expression of ARHGAP6 mRNA CTD PMID:19770486 and PMID:32553695 ARHGAP6 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ARHGAP6 mRNA CTD PMID:32234424 ARHGAP6 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of ARHGAP6 exon and Benzo(a)pyrene affects the methylation of ARHGAP6 promoter CTD PMID:27901495 ARHGAP6 Human bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of ARHGAP6 mRNA CTD PMID:31163220 ARHGAP6 Human bis(2-ethylhexyl) phthalate multiple interactions ISO Arhgap6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ARHGAP6 mRNA CTD PMID:39150890 ARHGAP6 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ARHGAP6 mRNA CTD PMID:27685785 ARHGAP6 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of ARHGAP6 gene CTD PMID:31601247 ARHGAP6 Human bisphenol A increases expression ISO Arhgap6 (Mus musculus) 6480464 bisphenol A results in increased expression of ARHGAP6 mRNA CTD PMID:34585602 and PMID:35479511 ARHGAP6 Human butanal decreases expression EXP 6480464 butyraldehyde results in decreased expression of ARHGAP6 mRNA CTD PMID:26079696 ARHGAP6 Human Butylbenzyl phthalate multiple interactions ISO Arhgap6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ARHGAP6 mRNA CTD PMID:39150890 ARHGAP6 Human cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ARHGAP6 mRNA CTD PMID:38568856 ARHGAP6 Human carbon nanotube decreases expression ISO Arhgap6 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 ARHGAP6 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to ARHGAP6 gene] CTD PMID:28238834 ARHGAP6 Human D-glucose increases expression ISO Arhgap6 (Mus musculus) 6480464 Glucose results in increased expression of ARHGAP6 mRNA CTD PMID:31525975 ARHGAP6 Human DDT decreases expression ISO Arhgap6 (Rattus norvegicus) 6480464 DDT results in decreased expression of ARHGAP6 mRNA CTD PMID:30207508 ARHGAP6 Human dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of ARHGAP6 mRNA CTD PMID:25047013 ARHGAP6 Human dibutyl phthalate increases expression ISO Arhgap6 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ARHGAP6 mRNA CTD PMID:21266533 ARHGAP6 Human dibutyl phthalate multiple interactions ISO Arhgap6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ARHGAP6 mRNA CTD PMID:39150890 ARHGAP6 Human diethyl phthalate multiple interactions ISO Arhgap6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ARHGAP6 mRNA CTD PMID:39150890 ARHGAP6 Human diisobutyl phthalate multiple interactions ISO Arhgap6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ARHGAP6 mRNA CTD PMID:39150890 ARHGAP6 Human diisononyl phthalate multiple interactions ISO Arhgap6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ARHGAP6 mRNA CTD PMID:39150890 ARHGAP6 Human disodium selenite decreases expression EXP 6480464 Sodium Selenite results in decreased expression of ARHGAP6 mRNA CTD PMID:18175754 ARHGAP6 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 ARHGAP6 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of ARHGAP6 mRNA CTD PMID:29803840 ARHGAP6 Human fluorescein 5-isothiocyanate affects binding EXP 6480464 Fluorescein-5-isothiocyanate binds to ARHGAP6 protein CTD PMID:27129696 ARHGAP6 Human glucose increases expression ISO Arhgap6 (Mus musculus) 6480464 Glucose results in increased expression of ARHGAP6 mRNA CTD PMID:31525975 ARHGAP6 Human glyphosate decreases expression ISO Arhgap6 (Rattus norvegicus) 6480464 Glyphosate results in decreased expression of ARHGAP6 mRNA CTD PMID:38314887 ARHGAP6 Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of ARHGAP6 mRNA CTD PMID:35811015 ARHGAP6 Human O-methyleugenol decreases expression EXP 6480464 methyleugenol results in decreased expression of ARHGAP6 mRNA CTD PMID:32234424 ARHGAP6 Human ozone multiple interactions ISO Arhgap6 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ARHGAP6 mRNA CTD PMID:34911549 ARHGAP6 Human panobinostat increases expression EXP 6480464 panobinostat results in increased expression of ARHGAP6 mRNA CTD PMID:26272509 ARHGAP6 Human panobinostat multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARHGAP6 mRNA CTD PMID:27188386 ARHGAP6 Human pentanal decreases expression EXP 6480464 pentanal results in decreased expression of ARHGAP6 mRNA CTD PMID:26079696 ARHGAP6 Human phenobarbital affects expression ISO Arhgap6 (Mus musculus) 6480464 Phenobarbital affects the expression of ARHGAP6 mRNA CTD PMID:23091169 ARHGAP6 Human pirinixic acid multiple interactions ISO Arhgap6 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of ARHGAP6 mRNA CTD PMID:19710929 ARHGAP6 Human pirinixic acid decreases expression ISO Arhgap6 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ARHGAP6 mRNA CTD PMID:18445702 ARHGAP6 Human S-(1,2-dichlorovinyl)-L-cysteine decreases expression EXP 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of ARHGAP6 mRNA CTD PMID:35811015 ARHGAP6 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of ARHGAP6 mRNA CTD PMID:35811015 ARHGAP6 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 ARHGAP6 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ARHGAP6 mRNA CTD PMID:35954277 ARHGAP6 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of ARHGAP6 mRNA CTD PMID:31533062 ARHGAP6 Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of ARHGAP6 mRNA CTD PMID:33359661 ARHGAP6 Human tetrachloroethene increases expression ISO Arhgap6 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of ARHGAP6 mRNA CTD PMID:28973375 ARHGAP6 Human tetrachloromethane decreases expression ISO Arhgap6 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ARHGAP6 mRNA CTD PMID:17484886 ARHGAP6 Human titanium dioxide decreases expression ISO Arhgap6 (Mus musculus) 6480464 titanium dioxide results in decreased expression of ARHGAP6 mRNA CTD PMID:29264374 ARHGAP6 Human titanium dioxide increases expression ISO Arhgap6 (Mus musculus) 6480464 titanium dioxide results in increased expression of ARHGAP6 mRNA CTD PMID:35295148 ARHGAP6 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of ARHGAP6 mRNA CTD PMID:24935251 and PMID:26272509 ARHGAP6 Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARHGAP6 mRNA CTD PMID:27188386 ARHGAP6 Human triclosan increases expression EXP 6480464 Triclosan results in increased expression of ARHGAP6 mRNA CTD PMID:30510588 ARHGAP6 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of ARHGAP6 mRNA CTD PMID:37042841 ARHGAP6 Human troglitazone decreases expression ISO Arhgap6 (Mus musculus) 6480464 troglitazone results in decreased expression of ARHGAP6 mRNA CTD PMID:28973697 ARHGAP6 Human trovafloxacin decreases expression ISO Arhgap6 (Mus musculus) 6480464 trovafloxacin results in decreased expression of ARHGAP6 mRNA CTD PMID:35537566 ARHGAP6 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ARHGAP6 mRNA CTD PMID:23179753 more ... ARHGAP6 Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARHGAP6 mRNA CTD PMID:27188386 ARHGAP6 Human vorinostat multiple interactions EXP 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARHGAP6 mRNA CTD PMID:27188386
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 7,12-dimethyltetraphene (ISO) aflatoxin B1 (EXP) Aflatoxin B2 alpha (EXP) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP) aristolochic acid A (EXP) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) butanal (EXP) Butylbenzyl phthalate (ISO) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (EXP) D-glucose (ISO) DDT (ISO) dexamethasone (EXP) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) disodium selenite (EXP) dorsomorphin (EXP) doxorubicin (EXP) fluorescein 5-isothiocyanate (EXP) glucose (ISO) glyphosate (ISO) lipopolysaccharide (EXP) O-methyleugenol (EXP) ozone (ISO) panobinostat (EXP) pentanal (EXP) phenobarbital (ISO) pirinixic acid (ISO) S-(1,2-dichlorovinyl)-L-cysteine (EXP) SB 431542 (EXP) sodium arsenite (EXP) sunitinib (EXP) testosterone (EXP) tetrachloroethene (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trichostatin A (EXP) triclosan (EXP) triphenyl phosphate (EXP) troglitazone (ISO) trovafloxacin (ISO) valproic acid (EXP) vorinostat (EXP)
ARHGAP6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 11,137,544 - 11,665,920 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 11,117,651 - 11,665,920 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 11,155,664 - 11,684,040 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 11,065,584 - 11,593,742 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 10,915,323 - 11,443,478 NCBI Celera X 15,283,114 - 15,812,107 (-) NCBI Celera Cytogenetic Map X p22.2 NCBI HuRef X 8,936,119 - 9,462,624 (-) NCBI HuRef CHM1_1 X 11,186,095 - 11,714,183 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 10,720,022 - 11,248,464 (-) NCBI T2T-CHM13v2.0
Arhgap6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 167,578,091 - 168,087,436 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 167,578,095 - 168,087,431 (+) Ensembl GRCm39 Ensembl GRCm38 X 168,795,094 - 169,304,440 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 168,795,099 - 169,304,435 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 165,233,031 - 165,742,367 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 164,139,204 - 164,648,540 (+) NCBI MGSCv36 mm8 Celera X 151,961,093 - 152,469,567 (+) NCBI Celera Cytogenetic Map X F5 NCBI cM Map X 78.77 NCBI
Arhgap6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 28,525,912 - 29,062,344 (-) NCBI GRCr8 mRatBN7.2 X 24,953,464 - 25,490,003 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 24,953,464 - 25,488,663 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 X 26,314,561 - 26,845,242 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 26,315,878 - 26,376,467 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 26,719,353 - 27,249,921 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 45,638,826 - 46,180,012 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 25,373,362 - 25,904,033 (-) NCBI Celera Cytogenetic Map X q13 NCBI
Arhgap6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955544 1,620,838 - 2,095,220 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955544 1,619,742 - 2,095,314 (+) NCBI ChiLan1.0 ChiLan1.0
ARHGAP6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 12,939,312 - 13,464,863 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 12,942,977 - 13,468,537 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 3,767,259 - 4,291,738 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 11,058,207 - 11,582,588 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 11,058,207 - 11,582,115 (-) Ensembl panpan1.1 panPan2
ARHGAP6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 7,704,838 - 8,188,358 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 7,706,156 - 7,951,557 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 7,661,628 - 8,145,052 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 7,658,026 - 8,140,930 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 7,658,031 - 7,905,288 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 7,641,326 - 8,124,919 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 7,677,568 - 8,161,294 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 7,672,129 - 8,156,977 (-) NCBI UU_Cfam_GSD_1.0
Arhgap6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 1,048,141 - 1,501,946 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 1,049,461 - 1,500,877 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 1,048,145 - 1,501,970 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARHGAP6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 7,910,858 - 8,120,386 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 7,910,851 - 8,441,579 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 8,541,109 - 8,686,000 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARHGAP6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666056 11,312,486 - 11,345,780 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arhgap6
.
Predicted Target Of
Count of predictions: 6528 Count of miRNA genes: 1351 Interacting mature miRNAs: 1762 Transcripts: ENST00000303025, ENST00000337414, ENST00000380717, ENST00000380718, ENST00000380732, ENST00000380736, ENST00000413512, ENST00000489330, ENST00000491514, ENST00000495242, ENST00000534860 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
597150359 GWAS1246433_H prostate carcinoma QTL GWAS1246433 (human) 9e-23 prostate carcinoma X 11464514 11464515 Human 597049749 GWAS1145823_H prostate carcinoma QTL GWAS1145823 (human) 1e-08 prostate carcinoma X 11464514 11464515 Human 597107922 GWAS1203996_H testosterone measurement QTL GWAS1203996 (human) 4e-10 testosterone measurement serum testosterone level (CMO:0000568) X 11191064 11191065 Human 597101106 GWAS1197180_H prostate carcinoma QTL GWAS1197180 (human) 1e-12 prostate carcinoma X 11464514 11464515 Human 597051006 GWAS1147080_H prostate carcinoma QTL GWAS1147080 (human) 2e-13 prostate carcinoma X 11464514 11464515 Human 597150360 GWAS1246434_H prostate carcinoma QTL GWAS1246434 (human) 1e-09 prostate carcinoma X 11443954 11443955 Human 597147366 GWAS1243440_H prostate carcinoma QTL GWAS1243440 (human) 3e-08 prostate carcinoma X 11443954 11443955 Human 597211626 GWAS1307700_H velopharyngeal dysfunction QTL GWAS1307700 (human) 0.000002 velopharyngeal dysfunction X 11292299 11292300 Human 597147365 GWAS1243439_H prostate carcinoma QTL GWAS1243439 (human) 1e-21 prostate carcinoma X 11464514 11464515 Human 597211627 GWAS1307701_H velopharyngeal dysfunction QTL GWAS1307701 (human) 0.000003 velopharyngeal dysfunction X 11552729 11552730 Human 597169696 GWAS1265770_H Varicose veins QTL GWAS1265770 (human) 2e-11 Varicose veins X 11277189 11277190 Human 597050862 GWAS1146936_H prostate carcinoma QTL GWAS1146936 (human) 9e-11 prostate carcinoma X 11321091 11321092 Human 597323747 GWAS1419821_H Varicose veins QTL GWAS1419821 (human) 2e-09 Varicose veins X 11277189 11277190 Human 597107435 GWAS1203509_H testosterone measurement QTL GWAS1203509 (human) 6e-09 testosterone measurement serum testosterone level (CMO:0000568) X 11191064 11191065 Human 597189638 GWAS1285712_H testosterone measurement QTL GWAS1285712 (human) 3e-08 testosterone measurement serum testosterone level (CMO:0000568) X 11312699 11312700 Human 597049800 GWAS1145874_H prostate carcinoma QTL GWAS1145874 (human) 4e-10 prostate carcinoma X 11321091 11321092 Human 597334660 GWAS1430734_H severe acute respiratory syndrome, COVID-19 QTL GWAS1430734 (human) 3e-08 severe acute respiratory syndrome, COVID-19 X 11333380 11333381 Human
DXS1043
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,468,259 - 11,468,412 UniSTS GRCh37 GRCh37 X 11,468,251 - 11,468,398 UniSTS GRCh37 Build 36 X 11,378,172 - 11,378,319 RGD NCBI36 Celera X 15,595,722 - 15,595,875 UniSTS Celera X 15,595,714 - 15,595,861 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,247,290 - 9,247,437 UniSTS HuRef X 9,247,298 - 9,247,451 UniSTS Marshfield Genetic Map X 18.37 RGD Genethon Genetic Map X 17.7 UniSTS TNG Radiation Hybrid Map X 2197.0 UniSTS deCODE Assembly Map X 21.33 UniSTS Stanford-G3 RH Map X 840.0 UniSTS GeneMap99-GB4 RH Map X 83.98 UniSTS Whitehead-RH Map X 7.7 UniSTS Whitehead-YAC Contig Map X UniSTS NCBI RH Map X 10.7 UniSTS GeneMap99-G3 RH Map X 26.0 UniSTS
D11S1905
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,192,307 - 11,192,858 UniSTS GRCh37 Celera X 15,319,758 - 15,320,309 UniSTS Cytogenetic Map X p22.3 UniSTS Marshfield Genetic Map 11 42.55 UniSTS Marshfield Genetic Map 11 42.55 RGD
DXS7090
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,497,394 - 11,497,585 UniSTS GRCh37 Build 36 X 11,407,315 - 11,407,506 RGD NCBI36 Celera X 15,624,857 - 15,625,048 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,276,256 - 9,276,447 UniSTS Whitehead-RH Map X 9.4 UniSTS Whitehead-YAC Contig Map X UniSTS NCBI RH Map X 10.0 UniSTS
RH79902
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,317,122 - 11,317,314 UniSTS GRCh37 Build 36 X 11,227,043 - 11,227,235 RGD NCBI36 Celera X 15,444,579 - 15,444,771 RGD Cytogenetic Map X p22.31-p22.1 UniSTS Cytogenetic Map X p22.3 UniSTS HuRef X 9,096,745 - 9,096,937 UniSTS
RH98500
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,155,714 - 11,155,863 UniSTS GRCh37 Build 36 X 11,065,635 - 11,065,784 RGD NCBI36 Celera X 15,283,165 - 15,283,314 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 8,936,170 - 8,936,319 UniSTS GeneMap99-GB4 RH Map X 83.98 UniSTS
AF003642
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,220,867 - 11,221,035 UniSTS GRCh37 Build 36 X 11,130,788 - 11,130,956 RGD NCBI36 Celera X 15,348,320 - 15,348,488 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,000,333 - 9,000,502 UniSTS
AF003643
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,203,197 - 11,203,360 UniSTS GRCh37 Build 36 X 11,113,118 - 11,113,281 RGD NCBI36 Celera X 15,330,648 - 15,330,811 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 8,983,039 - 8,983,202 UniSTS
AF003645
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,232,191 - 11,232,456 UniSTS GRCh37 Build 36 X 11,142,112 - 11,142,377 RGD NCBI36 Celera X 15,359,644 - 15,359,911 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,011,659 - 9,011,926 UniSTS
AF003646
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,284,082 - 11,284,317 UniSTS GRCh37 Build 36 X 11,194,003 - 11,194,238 RGD NCBI36 Celera X 15,411,538 - 15,411,773 RGD Cytogenetic Map X p22.3 UniSTS
AF003647
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,220,081 - 11,220,244 UniSTS GRCh37 Build 36 X 11,130,002 - 11,130,165 RGD NCBI36 Celera X 15,347,532 - 15,347,697 RGD Cytogenetic Map X p22.3 UniSTS
AF003648
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,259,537 - 11,259,739 UniSTS GRCh37 Build 36 X 11,169,458 - 11,169,660 RGD NCBI36 Celera X 15,386,993 - 15,387,195 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,039,108 - 9,039,310 UniSTS
AF003655
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,338,845 - 11,339,019 UniSTS GRCh37 Build 36 X 11,248,766 - 11,248,940 RGD NCBI36 Celera X 15,466,300 - 15,466,478 RGD Cytogenetic Map X p22.3 UniSTS
AF003672
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,156,200 - 11,156,421 UniSTS GRCh37 Build 36 X 11,066,121 - 11,066,342 RGD NCBI36 Celera X 15,283,651 - 15,283,872 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 8,936,656 - 8,936,877 UniSTS
AF003685
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,184,705 - 11,184,878 UniSTS GRCh37 Build 36 X 11,094,626 - 11,094,799 RGD NCBI36 Celera X 15,312,156 - 15,312,329 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 8,964,627 - 8,964,800 UniSTS
DXF22S5
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,260,594 - 11,260,787 UniSTS GRCh37 Build 36 X 11,170,515 - 11,170,708 RGD NCBI36 Celera X 15,388,050 - 15,388,243 RGD Cytogenetic Map X p22.3 UniSTS
DXS1380
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,451,793 - 11,451,896 UniSTS GRCh37 Build 36 X 11,361,714 - 11,361,817 RGD NCBI36 Celera X 15,579,256 - 15,579,359 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,230,907 - 9,231,010 UniSTS
DXS1445
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,581,372 - 11,581,514 UniSTS GRCh37 Build 36 X 11,491,293 - 11,491,435 RGD NCBI36 Celera X 15,708,477 - 15,708,619 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,359,477 - 9,359,619 UniSTS
DXS1129
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,649,156 - 11,649,342 UniSTS GRCh37 Build 36 X 11,559,077 - 11,559,263 RGD NCBI36 Celera X 15,777,447 - 15,777,633 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,428,083 - 9,428,269 UniSTS
DXS1135
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,519,985 - 11,520,256 UniSTS GRCh37 Build 36 X 11,429,906 - 11,430,177 RGD NCBI36 Celera X 15,647,828 - 15,648,099 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,299,394 - 9,299,665 UniSTS
GDB:677393
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,315,324 - 11,315,473 UniSTS GRCh37 Build 36 X 11,225,245 - 11,225,394 RGD NCBI36 Celera X 15,442,781 - 15,442,930 RGD Cytogenetic Map X p22.31-p22.1 UniSTS Cytogenetic Map X p22.3 UniSTS HuRef X 9,094,947 - 9,095,096 UniSTS
SHGC-80932
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,321,091 - 11,321,382 UniSTS GRCh37 Build 36 X 11,231,012 - 11,231,303 RGD NCBI36 Celera X 15,448,547 - 15,448,838 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,100,564 - 9,100,855 UniSTS TNG Radiation Hybrid Map X 2227.0 UniSTS
SHGC-84186
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,451,596 - 11,451,882 UniSTS GRCh37 Build 36 X 11,361,517 - 11,361,803 RGD NCBI36 Celera X 15,579,059 - 15,579,345 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,230,710 - 9,230,996 UniSTS TNG Radiation Hybrid Map X 2204.0 UniSTS
RH123869
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,172,765 - 11,173,063 UniSTS GRCh37 Build 36 X 11,082,686 - 11,082,984 RGD NCBI36 Celera X 15,300,216 - 15,300,514 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 8,952,706 - 8,953,004 UniSTS TNG Radiation Hybrid Map X 2281.0 UniSTS
G62689
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,548,837 - 11,549,130 UniSTS GRCh37 Build 36 X 11,458,758 - 11,459,051 RGD NCBI36 Celera X 15,675,772 - 15,676,065 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,327,265 - 9,327,558 UniSTS TNG Radiation Hybrid Map X 2182.0 UniSTS
G42692
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,316,604 - 11,316,668 UniSTS GRCh37 GRCh37 Y 6,736,503 - 6,736,567 UniSTS GRCh37 Build 36 X 11,226,525 - 11,226,589 RGD NCBI36 Celera X 15,444,061 - 15,444,125 RGD Celera Y 2,479,480 - 2,479,544 UniSTS Cytogenetic Map X p22.3 UniSTS Cytogenetic Map Y p11.2 UniSTS Cytogenetic Map X p22.31-p22.1 UniSTS HuRef X 9,096,227 - 9,096,291 UniSTS HuRef Y 4,295,557 - 4,295,621 UniSTS
DXS7543
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,164,658 - 11,164,761 UniSTS GRCh37 Build 36 X 11,074,579 - 11,074,682 RGD NCBI36 Celera X 15,292,109 - 15,292,212 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 8,945,114 - 8,945,217 UniSTS
DXS7928
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,167,562 - 11,167,668 UniSTS GRCh37 Build 36 X 11,077,483 - 11,077,589 RGD NCBI36 Celera X 15,295,013 - 15,295,119 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 8,947,424 - 8,947,530 UniSTS
GDB:371402
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,316,279 - 11,316,650 UniSTS GRCh37 Build 36 X 11,226,200 - 11,226,571 RGD NCBI36 Celera X 15,443,736 - 15,444,107 RGD Cytogenetic Map X p22.31-p22.1 UniSTS Cytogenetic Map X p22.3 UniSTS HuRef X 9,095,902 - 9,096,273 UniSTS
GDB:574117
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,312,849 - 11,313,028 UniSTS GRCh37 Build 36 X 11,222,770 - 11,222,949 RGD NCBI36 Celera X 15,440,306 - 15,440,485 RGD Cytogenetic Map X p22.31-p22.1 UniSTS Cytogenetic Map X p22.3 UniSTS HuRef X 9,092,472 - 9,092,651 UniSTS
GDB:574121
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,314,737 - 11,315,050 UniSTS GRCh37 Build 36 X 11,224,658 - 11,224,971 RGD NCBI36 Celera X 15,442,194 - 15,442,507 RGD Cytogenetic Map X p22.31-p22.1 UniSTS Cytogenetic Map X p22.3 UniSTS HuRef X 9,094,360 - 9,094,673 UniSTS
GDB:574132
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,316,059 - 11,316,524 UniSTS GRCh37 GRCh37 Y 6,736,647 - 6,737,115 UniSTS GRCh37 Build 36 X 11,225,980 - 11,226,445 RGD NCBI36 Celera X 15,443,516 - 15,443,981 RGD Celera Y 2,478,932 - 2,479,400 UniSTS Cytogenetic Map X p22.3 UniSTS Cytogenetic Map Y p11.2 UniSTS Cytogenetic Map X p22.31-p22.1 UniSTS HuRef X 9,095,682 - 9,096,147 UniSTS HuRef Y 4,295,701 - 4,296,169 UniSTS
GDB:574144
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,316,632 - 11,317,187 UniSTS GRCh37 Build 36 X 11,226,553 - 11,227,108 RGD NCBI36 Celera X 15,444,089 - 15,444,644 RGD Cytogenetic Map X p22.31-p22.1 UniSTS Cytogenetic Map X p22.3 UniSTS HuRef X 9,096,255 - 9,096,810 UniSTS
GDB:574146
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,317,520 - 11,318,872 UniSTS GRCh37 Build 36 X 11,227,441 - 11,228,793 RGD NCBI36 Celera X 15,444,977 - 15,446,329 RGD Cytogenetic Map X p22.31-p22.1 UniSTS Cytogenetic Map X p22.3 UniSTS
SHGC-108012
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,499,022 - 11,499,328 UniSTS GRCh37 Build 36 X 11,408,943 - 11,409,249 RGD NCBI36 Celera X 15,626,485 - 15,626,791 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,278,328 - 9,278,634 UniSTS TNG Radiation Hybrid Map X 2189.0 UniSTS
RH46956
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,317,385 - 11,317,515 UniSTS GRCh37 Build 36 X 11,227,306 - 11,227,436 RGD NCBI36 Celera X 15,444,842 - 15,444,972 RGD Cytogenetic Map X p22.31-p22.1 UniSTS Cytogenetic Map X p22.3 UniSTS GeneMap99-GB4 RH Map X 83.98 UniSTS NCBI RH Map X 10.0 UniSTS
SHGC-105133
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,633,711 - 11,634,033 UniSTS GRCh37 Build 36 X 11,543,632 - 11,543,954 RGD NCBI36 Celera X 15,762,162 - 15,762,484 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,412,327 - 9,412,649 UniSTS TNG Radiation Hybrid Map X 2141.0 UniSTS
AMELX
Human Assembly Chr Position (strand) Source JBrowse GRCh37 Y 6,736,086 - 6,736,302 UniSTS GRCh37 GRCh37 X 11,316,869 - 11,317,085 UniSTS GRCh37 Build 36 X 11,226,790 - 11,227,006 RGD NCBI36 Celera Y 2,479,745 - 2,479,961 UniSTS Celera X 15,444,326 - 15,444,542 RGD HuRef Y 4,295,140 - 4,295,356 UniSTS HuRef X 9,096,492 - 9,096,708 UniSTS
DXS7519
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,204,783 - 11,204,918 UniSTS GRCh37 Build 36 X 11,114,704 - 11,114,839 RGD NCBI36 Celera X 15,332,234 - 15,332,369 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 8,984,625 - 8,984,760 UniSTS Whitehead-YAC Contig Map X UniSTS
DXS9824
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,391,128 - 11,391,356 UniSTS GRCh37 Build 36 X 11,301,049 - 11,301,277 RGD NCBI36 Celera X 15,518,587 - 15,518,815 RGD HuRef X 9,170,639 - 9,170,867 UniSTS
DXS9825
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,371,275 - 11,371,745 UniSTS GRCh37 Build 36 X 11,281,196 - 11,281,666 RGD NCBI36 Celera X 15,498,733 - 15,499,205 RGD HuRef X 9,150,578 - 9,151,050 UniSTS
AFMa052zc1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,369,112 - 11,369,266 UniSTS GRCh37 Build 36 X 11,279,033 - 11,279,187 RGD NCBI36 Celera X 15,496,570 - 15,496,724 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,148,411 - 9,148,569 UniSTS Whitehead-RH Map X 3.9 UniSTS Whitehead-YAC Contig Map X UniSTS NCBI RH Map X 10.0 UniSTS
DXS7800
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,187,488 - 11,187,602 UniSTS GRCh37 Build 36 X 11,097,409 - 11,097,523 RGD NCBI36 Celera X 15,314,939 - 15,315,053 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 8,967,410 - 8,967,524 UniSTS
SHGC-34710
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,270,570 - 11,270,719 UniSTS GRCh37 Build 36 X 11,180,491 - 11,180,640 RGD NCBI36 Celera X 15,398,026 - 15,398,175 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,050,364 - 9,050,513 UniSTS Stanford-G3 RH Map X 828.0 UniSTS GeneMap99-GB4 RH Map X 83.98 UniSTS Whitehead-RH Map X 6.1 UniSTS NCBI RH Map X 10.0 UniSTS GeneMap99-G3 RH Map X 13.0 UniSTS
DXS8202
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,281,076 - 11,281,245 UniSTS GRCh37 Build 36 X 11,190,997 - 11,191,166 RGD NCBI36 Celera X 15,408,532 - 15,408,701 RGD Cytogenetic Map X p22.3 UniSTS HuRef X 9,060,665 - 9,060,834 UniSTS
ARHGAP6_4363
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 11,161,513 - 11,162,315 UniSTS GRCh37 Build 36 X 11,071,434 - 11,072,236 RGD NCBI36 Celera X 15,288,964 - 15,289,766 RGD HuRef X 8,941,969 - 8,942,771 UniSTS
DXS1043
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map X p22.3 UniSTS Marshfield Genetic Map X 18.37 UniSTS Genethon Genetic Map X 17.7 UniSTS deCODE Assembly Map X 21.33 UniSTS GeneMap99-GB4 RH Map X 83.98 UniSTS Whitehead-RH Map X 7.7 UniSTS Whitehead-YAC Contig Map X UniSTS NCBI RH Map X 10.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2371
2788
2229
4909
1704
2223
3
611
1836
451
2242
7129
6355
33
3697
841
1706
1505
169
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000303025 ⟹ ENSP00000302312
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 11,137,544 - 11,265,975 (-) Ensembl
Ensembl Acc Id:
ENST00000337414 ⟹ ENSP00000338967
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 11,137,544 - 11,665,920 (-) Ensembl
Ensembl Acc Id:
ENST00000380717 ⟹ ENSP00000370093
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 11,143,397 - 11,290,478 (-) Ensembl
Ensembl Acc Id:
ENST00000380718 ⟹ ENSP00000370094
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 11,143,397 - 11,665,701 (-) Ensembl
Ensembl Acc Id:
ENST00000380736 ⟹ ENSP00000370112
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 11,137,543 - 11,427,773 (-) Ensembl
Ensembl Acc Id:
ENST00000489330
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 11,137,547 - 11,665,083 (-) Ensembl
Ensembl Acc Id:
ENST00000491514
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 11,169,156 - 11,182,074 (-) Ensembl
Ensembl Acc Id:
ENST00000495242 ⟹ ENSP00000435767
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 11,137,544 - 11,665,701 (-) Ensembl
Ensembl Acc Id:
ENST00000657361 ⟹ ENSP00000499351
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 11,117,651 - 11,266,004 (-) Ensembl
RefSeq Acc Id:
NM_001287242 ⟹ NP_001274171
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 X 11,137,544 - 11,427,818 (-) NCBI HuRef X 8,936,119 - 9,462,624 (-) NCBI CHM1_1 X 11,186,095 - 11,476,315 (-) NCBI T2T-CHM13v2.0 X 10,720,022 - 11,010,322 (-) NCBI
Sequence:
CTCTTCCCCCTCCCCCTTCGCGCCGCTGCCTTCTCCAGGTCCCCACCGGCTCCGCAGCGGCAGCGGGACGCTGTGCCAGGGGCGCTTTGCACAGCACTCGGCACGCACGGAGCAGGGCTCGCGCCCAG
hide sequence
RefSeq Acc Id:
NM_006125 ⟹ NP_006116
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 X 11,143,397 - 11,665,920 (-) NCBI GRCh37 X 11,155,663 - 11,683,821 (-) RGD Build 36 X 11,071,438 - 11,593,742 (-) NCBI Archive Celera X 15,283,114 - 15,812,107 (-) RGD HuRef X 8,936,119 - 9,462,624 (-) RGD CHM1_1 X 11,191,951 - 11,714,183 (-) NCBI T2T-CHM13v2.0 X 10,725,875 - 11,248,464 (-) NCBI
Sequence:
CTCCCCAGGAGACCCGGTATCAGTGGCGAGCTGCCTTCTCTCCTCGCCGCTTGCAGGTTTGGCGCCTGGAAAACTCTTCACGTTCTGCTTTCTCCTGCTCCTGGCTCCGCCCCAGCTCCAGCCCCGGC
hide sequence
RefSeq Acc Id:
NM_013423 ⟹ NP_038267
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 X 11,137,544 - 11,265,992 (-) NCBI GRCh37 X 11,155,663 - 11,683,821 (-) RGD Build 36 X 11,065,584 - 11,194,016 (-) NCBI Archive Celera X 15,283,114 - 15,812,107 (-) RGD HuRef X 8,936,119 - 9,462,624 (-) RGD CHM1_1 X 11,186,095 - 11,314,563 (-) NCBI T2T-CHM13v2.0 X 10,720,022 - 10,848,494 (-) NCBI
Sequence:
ACTTACTCAGGGACACAGCCTGCCTCTGTTCTGAAAGGACAGGAACTTCTCAATGATCCGATGA
hide sequence
RefSeq Acc Id:
NM_013427 ⟹ NP_038286
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 X 11,137,544 - 11,665,920 (-) NCBI GRCh37 X 11,155,663 - 11,683,821 (-) RGD Build 36 X 11,065,584 - 11,593,742 (-) NCBI Archive Celera X 15,283,114 - 15,812,107 (-) RGD HuRef X 8,936,119 - 9,462,624 (-) RGD CHM1_1 X 11,186,095 - 11,714,183 (-) NCBI T2T-CHM13v2.0 X 10,720,022 - 11,248,464 (-) NCBI
Sequence:
CTCCCCAGGAGACCCGGTATCAGTGGCGAGCTGCCTTCTCTCCTCGCCGCTTGCAGGTTTGGCG
hide sequence
RefSeq Acc Id:
NR_109776
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 X 11,137,544 - 11,665,920 (-) NCBI HuRef X 8,936,119 - 9,462,624 (-) NCBI CHM1_1 X 11,186,095 - 11,714,183 (-) NCBI T2T-CHM13v2.0 X 10,720,022 - 11,248,464 (-) NCBI
Sequence:
CTCCCCAGGAGACCCGGTATCAGTGGCGAGCTGCCTTCTCTCCTCGCCGCTTGCAGGTTTGGCG
hide sequence
RefSeq Acc Id:
NP_038286 ⟸ NM_013427
- Peptide Label:
isoform 1
- UniProtKB:
Q9UK81 (UniProtKB/Swiss-Prot), Q9P1B3 (UniProtKB/Swiss-Prot), O43437 (UniProtKB/Swiss-Prot), B2RWQ0 (UniProtKB/Swiss-Prot), Q9UK82 (UniProtKB/Swiss-Prot), O43182 (UniProtKB/Swiss-Prot), A8KAL3 (UniProtKB/TrEMBL)
- Sequence:
MSAQSLLHSVFSCSSPASSSAASAKGFSKRKLRQTRSLDPALIGGCGSDEAGAEGSARGATAGRLYSPSLPAESLGPRLASSSRGPPPRATRLPPPGPLCSSFSTPSTPQEKSPSGSFHFDYEVPLGR
hide sequence
RefSeq Acc Id:
NP_038267 ⟸ NM_013423
- Peptide Label:
isoform 4
- UniProtKB:
O43182 (UniProtKB/Swiss-Prot)
- Sequence:
MSGRSVRLRSVPIQSLSELERARLQEVAFYQLQQDCDLSCQITIPKDGQKRKKSLRKKLDSLGKEKNKDKEFIPQAFGMPLSQVIANDRAYKLKQDLQRDEQKDASDFVASLLPFGNKRQNKELSSSN
hide sequence
RefSeq Acc Id:
NP_006116 ⟸ NM_006125
- Peptide Label:
isoform 3
- UniProtKB:
Q59HG6 (UniProtKB/TrEMBL)
- Sequence:
MSAQSLLHSVFSCSSPASSSAASAKGFSKRKLRQTRSLDPALIGGCGSDEAGAEGSARGATAGR
hide sequence
RefSeq Acc Id:
NP_001274171 ⟸ NM_001287242
- Peptide Label:
isoform 6
- UniProtKB:
A8KAL3 (UniProtKB/TrEMBL)
- Sequence:
MGHPVYRGEKPQLHYAGDFTWNSMSGRSVRLRSVPIQSLSELERARLQEVAFYQLQQDCDLSCQ
hide sequence
Ensembl Acc Id:
ENSP00000338967 ⟸ ENST00000337414
Ensembl Acc Id:
ENSP00000435767 ⟸ ENST00000495242
Ensembl Acc Id:
ENSP00000499351 ⟸ ENST00000657361
Ensembl Acc Id:
ENSP00000370112 ⟸ ENST00000380736
Ensembl Acc Id:
ENSP00000370093 ⟸ ENST00000380717
Ensembl Acc Id:
ENSP00000370094 ⟸ ENST00000380718
Ensembl Acc Id:
ENSP00000302312 ⟸ ENST00000303025
RGD ID: 6808499 Promoter ID: HG_KWN:65989 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Jurkat Transcripts: OTTHUMT00000055765 Position: Human Assembly Chr Position (strand) Source Build 36 X 11,110,136 - 11,110,636 (-) MPROMDB
RGD ID: 6808502 Promoter ID: HG_KWN:65990 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: ENST00000353663, NM_013423 Position: Human Assembly Chr Position (strand) Source Build 36 X 11,193,941 - 11,194,441 (-) MPROMDB
RGD ID: 6808498 Promoter ID: HG_KWN:65994 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562, Lymphoblastoid Transcripts: ENST00000380736 Position: Human Assembly Chr Position (strand) Source Build 36 X 11,355,429 - 11,355,929 (-) MPROMDB
RGD ID: 6808501 Promoter ID: HG_KWN:65995 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lymphoblastoid Transcripts: ENST00000380717, NM_006125, NM_013427, OTTHUMT00000055761, OTTHUMT00000291400 Position: Human Assembly Chr Position (strand) Source Build 36 X 11,592,811 - 11,594,327 (-) MPROMDB
