Symbol:
KLF6
Name:
KLF transcription factor 6
RGD ID:
1349381
HGNC Page
HGNC:2235
Description:
Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Located in cytosol; fibrillar center; and nucleoplasm. Implicated in prostate cancer and stomach cancer.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
B-cell-derived protein 1; BCD1; CBA1; COPEB; core promoter element binding protein; core promoter element-binding protein; CPBP; DKFZp686N0199; GBF; GC-rich binding factor; GC-rich sites-binding factor GBF; Krueppel-like factor 6; Kruppel like factor 6; Kruppel-like factor 6; Kruppel-like zinc finger protein Zf9; PAC1; proto-oncogene BCD1; protooncogene B-cell derived 1; ST12; suppression of tumorigenicity 12 (prostate); suppressor of tumorigenicity 12 protein; transcription factor Zf9; ZF9
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Klf6 (Kruppel-like transcription factor 6) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Rattus norvegicus (Norway rat):
Klf6 (KLF transcription factor 6) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Klf6 (KLF transcription factor 6) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
KLF6 (KLF transcription factor 6) NCBI
Ortholog
Canis lupus familiaris (dog):
KLF6 (KLF transcription factor 6) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Klf6 (KLF transcription factor 6) NCBI
Ortholog
Sus scrofa (pig):
KLF6 (KLF transcription factor 6) HGNC
Ensembl, Inparanoid, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):
KLF6 (KLF transcription factor 6) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Klf6 (KLF transcription factor 6) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Klf6 (KLF transcription factor 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Klf6 (Kruppel-like transcription factor 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
klf6b (Kruppel-like factor 6b)
Alliance
DIOPT (PANTHER|ZFIN)
Danio rerio (zebrafish):
klf6a (Kruppel-like factor 6a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
klf-1
Alliance
DIOPT (OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
luna
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus laevis (African clawed frog):
klf6.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
klf6.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 3,775,996 - 3,785,209 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 3,775,996 - 3,785,281 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 3,818,188 - 3,827,401 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 3,811,234 - 3,817,455 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 3,811,240 - 3,817,455 NCBI Celera 10 3,763,066 - 3,772,350 (-) NCBI Celera Cytogenetic Map 10 p15.2 NCBI HuRef 10 3,754,750 - 3,764,030 (-) NCBI HuRef CHM1_1 10 3,818,788 - 3,828,068 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 3,779,895 - 3,789,103 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
KLF6 Human (-)-demecolcine increases expression EXP 6480464 Demecolcine results in increased expression of KLF6 mRNA CTD PMID:23649840 KLF6 Human (1->4)-beta-D-glucan multiple interactions ISO Klf6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KLF6 mRNA CTD PMID:36331819 KLF6 Human (S)-colchicine increases expression EXP 6480464 Colchicine results in increased expression of KLF6 mRNA CTD PMID:24211769 KLF6 Human 1,1-dichloroethene increases expression ISO Klf6 (Mus musculus) 6480464 vinylidene chloride results in increased expression of KLF6 mRNA CTD PMID:26682919 KLF6 Human 1,2-dimethylhydrazine decreases expression ISO Klf6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of KLF6 mRNA CTD PMID:22206623 KLF6 Human 1-chloro-2,4-dinitrobenzene increases expression EXP 6480464 Dinitrochlorobenzene results in increased expression of KLF6 mRNA CTD PMID:16314067 and PMID:17374397 KLF6 Human 1-methylphenanthrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1-methylphenanthrene] affects the expression of KLF6 mRNA CTD PMID:17690111 KLF6 Human 1-naphthyl isothiocyanate increases expression ISO Klf6 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in increased expression of KLF6 mRNA CTD PMID:25380136 and PMID:30723492 KLF6 Human 1-naphthyl isothiocyanate multiple interactions EXP 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of KLF6 mRNA CTD PMID:27344345 KLF6 Human 15-deoxy-Delta(12,14)-prostaglandin J2 multiple interactions ISO Klf6 (Mus musculus) 6480464 [15-deoxy-delta(12 more ... CTD PMID:16611854 KLF6 Human 17alpha-ethynylestradiol multiple interactions ISO Klf6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KLF6 mRNA CTD PMID:17942748 KLF6 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of KLF6 mRNA CTD PMID:20106945 KLF6 Human 17beta-estradiol decreases expression ISO Klf6 (Mus musculus) 6480464 Estradiol results in decreased expression of KLF6 mRNA CTD PMID:39298647 KLF6 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of KLF6 mRNA CTD PMID:19167446 and PMID:24758408 KLF6 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol binds to ESR2 protein] which results in decreased expression of KLF6 mRNA more ... CTD PMID:20404318 more ... KLF6 Human 17beta-hydroxy-5alpha-androstan-3-one increases expression EXP 6480464 Dihydrotestosterone results in increased expression of KLF6 mRNA CTD PMID:38122923 KLF6 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Klf6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KLF6 mRNA CTD PMID:24058054 and PMID:37172768 KLF6 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KLF6 mRNA CTD PMID:20106945 more ... KLF6 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Klf6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin affects the methylation of KLF6 intron] which results in increased expression of KLF6 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KLF6 mRNA CTD PMID:17942748 and PMID:33017471 KLF6 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Klf6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KLF6 mRNA CTD PMID:21570461 KLF6 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Klf6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KLF6 mRNA CTD PMID:19770486 KLF6 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Klf6 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KLF6 mRNA CTD PMID:11752688 and PMID:33387578 KLF6 Human 2,4-dinitrotoluene affects expression ISO Klf6 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of KLF6 mRNA CTD PMID:21346803 KLF6 Human 2-hydroxypropanoic acid increases expression EXP 6480464 Lactic Acid results in increased expression of KLF6 mRNA CTD PMID:30851411 KLF6 Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of KLF6 mRNA CTD PMID:21179406 KLF6 Human 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Klf6 (Rattus norvegicus) 6480464 3 more ... CTD PMID:23196670 KLF6 Human 3,5-diethoxycarbonyl-1,4-dihydrocollidine increases expression ISO Klf6 (Mus musculus) 6480464 Dicarbethoxydihydrocollidine results in increased expression of KLF6 mRNA CTD PMID:18098314 KLF6 Human 3,5-diethoxycarbonyl-1,4-dihydrocollidine multiple interactions ISO Klf6 (Mus musculus) 6480464 S-Adenosylmethionine inhibits the reaction [Dicarbethoxydihydrocollidine results in increased expression of KLF6 mRNA] CTD PMID:18098314 KLF6 Human 4,4'-diaminodiphenylmethane increases expression ISO Klf6 (Rattus norvegicus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of KLF6 mRNA CTD PMID:25380136 KLF6 Human 4,4'-sulfonyldiphenol increases expression ISO Klf6 (Mus musculus) 6480464 bisphenol S results in increased expression of KLF6 mRNA CTD PMID:30951980 KLF6 Human 4,4'-sulfonyldiphenol multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of KLF6 mRNA CTD PMID:36041667 KLF6 Human 4,4'-sulfonyldiphenol decreases expression ISO Klf6 (Mus musculus) 6480464 bisphenol S results in decreased expression of KLF6 mRNA CTD PMID:39298647 KLF6 Human 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression EXP 6480464 Oxazolone results in increased expression of KLF6 mRNA CTD PMID:17374397 and PMID:23999411 KLF6 Human 5-aza-2'-deoxycytidine affects expression EXP 6480464 Decitabine affects the expression of KLF6 mRNA CTD PMID:23300844 KLF6 Human 5-azacytidine multiple interactions EXP 6480464 TP73 protein promotes the reaction [Azacitidine results in increased expression of KLF6 mRNA] CTD PMID:21245298 KLF6 Human 5-azacytidine increases expression EXP 6480464 Azacitidine results in increased expression of KLF6 mRNA CTD PMID:21245298 KLF6 Human 5-fluorouracil decreases expression EXP 6480464 Fluorouracil results in decreased expression of KLF6 mRNA CTD PMID:15205334 KLF6 Human 9-cis-retinoic acid multiple interactions ISO Klf6 (Mus musculus) 6480464 [15-deoxy-delta(12 more ... CTD PMID:16611854 KLF6 Human acetamide increases expression ISO Klf6 (Rattus norvegicus) 6480464 acetamide results in increased expression of KLF6 mRNA CTD PMID:31881176 KLF6 Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of KLF6 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of KLF6 mRNA CTD PMID:32699268 KLF6 Human aflatoxin B1 affects expression EXP 6480464 Aflatoxin B1 affects the expression of KLF6 protein CTD PMID:20106945 KLF6 Human aflatoxin B1 increases expression ISO Klf6 (Rattus norvegicus) 6480464 Aflatoxin B1 results in increased expression of KLF6 mRNA CTD PMID:33354967 KLF6 Human aflatoxin B1 increases expression ISO Klf6 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of KLF6 mRNA CTD PMID:19770486 KLF6 Human alachlor increases expression ISO Klf6 (Rattus norvegicus) 6480464 alachlor results in increased expression of KLF6 mRNA CTD PMID:12419858 KLF6 Human aldehydo-D-glucose increases expression ISO Klf6 (Mus musculus) 6480464 Glucose results in increased expression of KLF6 mRNA CTD PMID:17178593 KLF6 Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of KLF6 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of KLF6 mRNA CTD PMID:32699268 KLF6 Human ammonium chloride affects expression ISO Klf6 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of KLF6 mRNA CTD PMID:16483693 KLF6 Human androstane-3,17-dione increases expression EXP 6480464 androstane-3 and 17-dione results in increased expression of KLF6 mRNA CTD PMID:38122923 KLF6 Human anthra[1,9-cd]pyrazol-6(2H)-one decreases expression EXP 6480464 pyrazolanthrone results in decreased expression of KLF6 mRNA CTD PMID:22486562 KLF6 Human anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 Arachidonic Acid inhibits the reaction [pyrazolanthrone results in decreased expression of KLF6 mRNA] more ... CTD PMID:22486562 KLF6 Human antimony(0) increases expression EXP 6480464 Antimony results in increased expression of KLF6 mRNA CTD PMID:17547211 KLF6 Human antimycin A increases expression EXP 6480464 Antimycin A results in increased expression of KLF6 mRNA CTD PMID:33512557 KLF6 Human arachidonic acid multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Arachidonic Acid promotes the reaction [CYP2E1 protein results in increased expression of KLF6 mRNA]] more ... CTD PMID:22486562 KLF6 Human arachidonic acid increases expression EXP 6480464 Arachidonic Acid results in increased expression of KLF6 mRNA more ... CTD PMID:22486562 KLF6 Human Aroclor 1254 decreases expression ISO Klf6 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of KLF6 mRNA CTD PMID:23650126 KLF6 Human arsenite(3-) affects expression EXP 6480464 arsenite affects the expression of KLF6 mRNA CTD PMID:22959463 KLF6 Human atrazine increases expression EXP 6480464 Atrazine results in increased expression of KLF6 mRNA CTD PMID:22378314 KLF6 Human azathioprine increases expression EXP 6480464 Azathioprine results in increased expression of KLF6 mRNA CTD PMID:22623647 KLF6 Human benzene decreases expression EXP 6480464 Benzene results in decreased expression of KLF6 mRNA CTD PMID:19162166 KLF6 Human benzo[a]pyrene increases expression ISO Klf6 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KLF6 mRNA CTD PMID:19770486 more ... KLF6 Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of KLF6 mRNA CTD PMID:21871943 more ... KLF6 Human benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1-methylphenanthrene] affects the expression of KLF6 mRNA CTD PMID:17690111 KLF6 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7 more ... CTD PMID:20018196 KLF6 Human benzoates increases expression EXP 6480464 Benzoates analog results in increased expression of KLF6 mRNA CTD PMID:29472718 KLF6 Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of KLF6 mRNA CTD PMID:38218311 KLF6 Human beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of KLF6 mRNA CTD PMID:19737606 KLF6 Human beta-naphthoflavone multiple interactions EXP 6480464 [CYP2E1 protein co-treated with beta-Naphthoflavone] results in increased expression of KLF6 protein CTD PMID:22486562 KLF6 Human bis(2-chloroethyl) sulfide affects expression ISO Klf6 (Rattus norvegicus) 6480464 Mustard Gas affects the expression of KLF6 mRNA CTD PMID:15651846 KLF6 Human bis(2-ethylhexyl) phthalate increases expression ISO Klf6 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of KLF6 mRNA CTD PMID:35716406 KLF6 Human bis(2-ethylhexyl) phthalate decreases expression ISO Klf6 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of KLF6 mRNA CTD PMID:34319233 KLF6 Human bisphenol A increases expression ISO Klf6 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of KLF6 mRNA CTD PMID:25181051 KLF6 Human bisphenol A multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of KLF6 mRNA CTD PMID:36041667 KLF6 Human bisphenol F increases expression ISO Klf6 (Mus musculus) 6480464 bisphenol F results in increased expression of KLF6 mRNA CTD PMID:30951980 KLF6 Human bisphenol F multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of KLF6 mRNA CTD PMID:36041667 KLF6 Human bortezomib increases expression EXP 6480464 Bortezomib results in increased expression of KLF6 mRNA CTD PMID:20977926 KLF6 Human cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of KLF6 mRNA CTD PMID:21120746 and PMID:24284285 KLF6 Human cadmium dichloride increases expression ISO Klf6 (Rattus norvegicus) 6480464 Cadmium Chloride results in increased expression of KLF6 mRNA CTD PMID:19010381 KLF6 Human cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of KLF6 mRNA CTD PMID:38382870 KLF6 Human cannabidiol increases expression EXP 6480464 Cannabidiol results in increased expression of KLF6 mRNA CTD PMID:33244087 KLF6 Human carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of KLF6 mRNA CTD PMID:25979313 KLF6 Human carbonyl sulfide increases expression ISO Klf6 (Rattus norvegicus) 6480464 carbonyl sulfide results in increased expression of KLF6 mRNA CTD PMID:19395590 KLF6 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to KLF6 gene] CTD PMID:28238834 KLF6 Human chloropicrin increases expression EXP 6480464 chloropicrin results in increased expression of KLF6 mRNA CTD PMID:26352163 KLF6 Human chloroprene increases expression ISO Klf6 (Rattus norvegicus) 6480464 Chloroprene results in increased expression of KLF6 mRNA CTD PMID:23125180 KLF6 Human choline multiple interactions ISO Klf6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KLF6 mRNA CTD PMID:20938992 KLF6 Human cisplatin decreases expression ISO Klf6 (Mus musculus) 6480464 Cisplatin results in decreased expression of KLF6 mRNA CTD PMID:21151649 KLF6 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KLF6 mRNA CTD PMID:27392435 KLF6 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of KLF6 mRNA CTD PMID:33545341 KLF6 Human cisplatin affects expression EXP 6480464 Cisplatin affects the expression of KLF6 mRNA CTD PMID:23300844 KLF6 Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of KLF6 mRNA CTD PMID:19561079 more ... KLF6 Human clofibrate multiple interactions ISO Klf6 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KLF6 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of KLF6 mRNA] CTD PMID:17585979 KLF6 Human cobalt dichloride increases expression ISO Klf6 (Rattus norvegicus) 6480464 cobaltous chloride results in increased expression of KLF6 mRNA CTD PMID:24386269 KLF6 Human cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of KLF6 mRNA CTD PMID:22941251 KLF6 Human copper(II) chloride affects expression EXP 6480464 cupric chloride affects the expression of KLF6 mRNA CTD PMID:17211630 KLF6 Human copper(II) chloride increases expression EXP 6480464 cupric chloride results in increased expression of KLF6 mRNA CTD PMID:38568856 KLF6 Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of KLF6 mRNA CTD PMID:19549813 KLF6 Human coumestrol decreases expression EXP 6480464 Coumestrol results in decreased expression of KLF6 mRNA CTD PMID:19167446 KLF6 Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of KLF6 mRNA CTD PMID:19167446 KLF6 Human crocidolite asbestos increases expression EXP 6480464 Asbestos and Crocidolite results in increased expression of KLF6 mRNA CTD PMID:18687144 and PMID:25351596 KLF6 Human curcumin increases expression EXP 6480464 Curcumin results in increased expression of KLF6 mRNA CTD PMID:15713895 KLF6 Human cyclosporin A increases expression ISO Klf6 (Rattus norvegicus) 6480464 Cyclosporine results in increased expression of KLF6 mRNA CTD PMID:21865292 KLF6 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of KLF6 mRNA CTD PMID:20106945 and PMID:25562108 KLF6 Human cylindrospermopsin increases expression EXP 6480464 cylindrospermopsin results in increased expression of KLF6 mRNA CTD PMID:24921660 KLF6 Human D-glucose increases expression ISO Klf6 (Mus musculus) 6480464 Glucose results in increased expression of KLF6 mRNA CTD PMID:17178593 KLF6 Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of KLF6 mRNA CTD PMID:38568856 KLF6 Human Diallyl sulfide multiple interactions EXP 6480464 allyl sulfide inhibits the reaction [Arachidonic Acid promotes the reaction [CYP2E1 protein results in increased expression of KLF6 mRNA]] more ... CTD PMID:22486562 KLF6 Human dibutyl phthalate increases expression ISO Klf6 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of KLF6 mRNA CTD PMID:21266533 KLF6 Human dibutyl phthalate increases expression ISO Klf6 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of KLF6 mRNA CTD PMID:21266533 KLF6 Human dicoumarol multiple interactions EXP 6480464 Dicumarol inhibits the reaction [[CYP2E1 protein co-treated with Paraquat] results in increased expression of KLF6 protein] and Dicumarol inhibits the reaction [[CYP2E1 protein co-treated with Vitamin K 3] results in increased expression of KLF6 protein] CTD PMID:22486562 KLF6 Human dieldrin increases expression EXP 6480464 Dieldrin results in increased expression of KLF6 mRNA CTD PMID:31068361 KLF6 Human dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of KLF6 mRNA CTD PMID:24236059 KLF6 Human dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate increases expression EXP 6480464 Antimony Potassium Tartrate results in increased expression of KLF6 mRNA CTD PMID:17547211 KLF6 Human diuron decreases expression ISO Klf6 (Rattus norvegicus) 6480464 Diuron results in decreased expression of KLF6 mRNA CTD PMID:21551480 KLF6 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 KLF6 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of KLF6 mRNA CTD PMID:15205334 more ... KLF6 Human elemental selenium increases expression EXP 6480464 Selenium results in increased expression of KLF6 mRNA CTD PMID:19244175 KLF6 Human Enterolactone multiple interactions EXP 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of KLF6 mRNA CTD PMID:19167446 KLF6 Human ethanol multiple interactions ISO Klf6 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of KLF6 mRNA CTD PMID:30517762 KLF6 Human ethanol increases expression ISO Klf6 (Rattus norvegicus) 6480464 Ethanol results in increased expression of KLF6 mRNA CTD PMID:22486562 KLF6 Human ethanol affects splicing ISO Klf6 (Mus musculus) 6480464 Ethanol affects the splicing of KLF6 mRNA CTD PMID:30319688 KLF6 Human ethyl methanesulfonate decreases expression EXP 6480464 Ethyl Methanesulfonate results in decreased expression of KLF6 mRNA CTD PMID:24211769 KLF6 Human etoposide decreases expression EXP 6480464 Etoposide results in decreased expression of KLF6 mRNA CTD PMID:24211769 KLF6 Human fenthion increases expression ISO Klf6 (Mus musculus) 6480464 Fenthion results in increased expression of KLF6 mRNA CTD PMID:34813904 KLF6 Human fluoranthene multiple interactions ISO Klf6 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of KLF6 mRNA CTD PMID:28329830 KLF6 Human folic acid multiple interactions ISO Klf6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KLF6 mRNA CTD PMID:20938992 KLF6 Human folic acid decreases expression ISO Klf6 (Mus musculus) 6480464 Folic Acid results in decreased expression of KLF6 mRNA CTD PMID:25629700 KLF6 Human formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of KLF6 mRNA CTD PMID:23416264 and PMID:23649840 KLF6 Human fumonisin B1 increases expression ISO Klf6 (Mus musculus) 6480464 fumonisin B1 results in increased expression of KLF6 mRNA CTD PMID:16221962 KLF6 Human gentamycin increases expression ISO Klf6 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of KLF6 mRNA CTD PMID:22061828 and PMID:33387578 KLF6 Human geraniol increases expression EXP 6480464 geraniol results in increased expression of KLF6 mRNA CTD PMID:27683099 KLF6 Human glucose increases expression ISO Klf6 (Mus musculus) 6480464 Glucose results in increased expression of KLF6 mRNA CTD PMID:17178593 KLF6 Human Glutathione ethyl ester multiple interactions EXP 6480464 S-ethyl glutathione inhibits the reaction [[CYP2E1 protein co-treated with Paraquat] results in increased expression of KLF6 protein] and S-ethyl glutathione inhibits the reaction [[CYP2E1 protein co-treated with Vitamin K 3] results in increased expression of KLF6 protein] CTD PMID:22486562 KLF6 Human GSK-J4 increases expression EXP 6480464 GSK-J4 results in increased expression of KLF6 mRNA CTD PMID:29301935 KLF6 Human hydralazine multiple interactions EXP 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of KLF6 mRNA CTD PMID:17183730 KLF6 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of KLF6 mRNA CTD PMID:20044591 KLF6 Human hydrogen peroxide multiple interactions EXP 6480464 [Arachidonic Acid co-treated with Hydrogen Peroxide] results in increased expression of KLF6 protein more ... CTD PMID:22486562 KLF6 Human hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of KLF6 protein CTD PMID:22486562 KLF6 Human indole-3-methanol affects expression ISO Klf6 (Rattus norvegicus) 6480464 indole-3-carbinol affects the expression of KLF6 mRNA CTD PMID:21396975 KLF6 Human ionomycin multiple interactions EXP 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of KLF6 mRNA and pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of KLF6 mRNA] CTD PMID:15477007 KLF6 Human iron dichloride increases expression EXP 6480464 ferrous chloride results in increased expression of KLF6 mRNA CTD PMID:35984750 KLF6 Human isobutanol multiple interactions EXP 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of KLF6 mRNA CTD PMID:29432896 KLF6 Human kenpaullone decreases expression ISO Klf6 (Rattus norvegicus) 6480464 kenpaullone results in decreased expression of KLF6 mRNA CTD PMID:17993264 KLF6 Human ketamine decreases expression ISO Klf6 (Rattus norvegicus) 6480464 Ketamine results in decreased expression of KLF6 mRNA CTD PMID:20080153 KLF6 Human L-methionine multiple interactions ISO Klf6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KLF6 mRNA CTD PMID:20938992 KLF6 Human lead diacetate increases expression ISO Klf6 (Mus musculus) 6480464 lead acetate results in increased expression of KLF6 mRNA CTD PMID:25270620 KLF6 Human lead diacetate increases methylation ISO Klf6 (Rattus norvegicus) 6480464 lead acetate results in increased methylation of KLF6 gene CTD PMID:29571894 KLF6 Human leflunomide increases expression EXP 6480464 leflunomide results in increased expression of KLF6 mRNA CTD PMID:28988120 KLF6 Human lipopolysaccharide increases expression ISO Klf6 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of KLF6 mRNA CTD PMID:26582142 KLF6 Human lipopolysaccharide multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 Ranitidine promotes the reaction [Lipopolysaccharides results in increased expression of KLF6 mRNA] CTD PMID:16415329 KLF6 Human lipopolysaccharide increases expression ISO Klf6 (Rattus norvegicus) 6480464 Lipopolysaccharides results in increased expression of KLF6 mRNA CTD PMID:16415329 KLF6 Human lithium atom affects expression EXP 6480464 Lithium affects the expression of KLF6 mRNA CTD PMID:21092101 KLF6 Human lithium hydride affects expression EXP 6480464 Lithium affects the expression of KLF6 mRNA CTD PMID:21092101 KLF6 Human MeIQx decreases expression EXP 6480464 2-amino-3 more ... CTD PMID:20816883 KLF6 Human menadione affects expression EXP 6480464 Vitamin K 3 affects the expression of KLF6 mRNA CTD PMID:20044591 KLF6 Human menadione increases expression EXP 6480464 Vitamin K 3 results in increased expression of KLF6 mRNA more ... CTD PMID:22486562 KLF6 Human menadione multiple interactions EXP 6480464 [Arachidonic Acid co-treated with Vitamin K 3] results in increased expression of KLF6 protein more ... CTD PMID:22486562 KLF6 Human mercury dibromide increases expression EXP 6480464 mercuric bromide results in increased expression of KLF6 mRNA CTD PMID:26272509 KLF6 Human mercury dibromide multiple interactions EXP 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KLF6 mRNA CTD PMID:27188386 KLF6 Human mercury dichloride increases expression ISO Klf6 (Rattus norvegicus) 6480464 Mercuric Chloride results in increased expression of KLF6 mRNA CTD PMID:16507785 KLF6 Human methamphetamine increases expression ISO Klf6 (Rattus norvegicus) 6480464 Methamphetamine results in increased expression of KLF6 mRNA CTD PMID:19564919 KLF6 Human methamphetamine decreases expression ISO Klf6 (Mus musculus) 6480464 Methamphetamine results in decreased expression of KLF6 mRNA CTD PMID:36914120 KLF6 Human methidathion increases expression ISO Klf6 (Mus musculus) 6480464 methidathion results in increased expression of KLF6 mRNA CTD PMID:34813904 KLF6 Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of KLF6 mRNA CTD PMID:24211769 KLF6 Human methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of KLF6 mRNA CTD PMID:28001369 KLF6 Human methyltestosterone multiple interactions EXP 6480464 [Methyltestosterone co-treated with Cholic Acids] affects the expression of KLF6 mRNA CTD PMID:27344345 KLF6 Human mitomycin C decreases expression EXP 6480464 Mitomycin results in decreased expression of KLF6 mRNA CTD PMID:24211769 KLF6 Human N-acetylsphingosine increases expression ISO Klf6 (Mus musculus) 6480464 N-acetylsphingosine results in increased expression of KLF6 mRNA CTD PMID:18270325 KLF6 Human N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of KLF6 mRNA CTD PMID:31806706 KLF6 Human N-methyl-4-phenylpyridinium increases expression ISO Klf6 (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of KLF6 mRNA CTD PMID:16026605 KLF6 Human N-methylformamide affects expression ISO Klf6 (Mus musculus) 6480464 methylformamide affects the expression of KLF6 mRNA and methylformamide analog affects the expression of KLF6 mRNA CTD PMID:17040096 KLF6 Human N-nitrosodiethylamine increases expression ISO Klf6 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of KLF6 mRNA CTD PMID:24535843 KLF6 Human N-nitrosodiethylamine multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of KLF6 mRNA CTD PMID:28943392 KLF6 Human N-nitrosodiethylamine multiple interactions ISO Klf6 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of KLF6 mRNA CTD PMID:24535843 KLF6 Human N-nitrosodimethylamine increases expression ISO Klf6 (Rattus norvegicus) 6480464 Dimethylnitrosamine results in increased expression of KLF6 mRNA CTD PMID:25380136 KLF6 Human N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of KLF6 mRNA CTD PMID:17547211 KLF6 Human N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 Ranitidine promotes the reaction [Lipopolysaccharides results in increased expression of KLF6 mRNA] CTD PMID:16415329 KLF6 Human nickel atom increases expression ISO Klf6 (Mus musculus) 6480464 Nickel results in increased expression of KLF6 mRNA CTD PMID:12540486 KLF6 Human nickel dichloride increases expression EXP 6480464 nickel chloride results in increased expression of KLF6 mRNA CTD PMID:17547211 KLF6 Human nickel dichloride affects expression ISO Klf6 (Rattus norvegicus) 6480464 nickel chloride affects the expression of KLF6 mRNA CTD PMID:22110744 KLF6 Human nickel sulfate increases expression EXP 6480464 nickel sulfate results in increased expression of KLF6 mRNA CTD PMID:16314067 and PMID:17374397 KLF6 Human O-methyleugenol increases expression ISO Klf6 (Rattus norvegicus) 6480464 methyleugenol results in increased expression of KLF6 mRNA CTD PMID:23411599 KLF6 Human oxaliplatin multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of KLF6 mRNA CTD PMID:25729387 KLF6 Human ozone increases expression ISO Klf6 (Rattus norvegicus) 6480464 Ozone results in increased expression of KLF6 mRNA CTD PMID:16716893 KLF6 Human ozone multiple interactions ISO Klf6 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of KLF6 mRNA CTD PMID:34911549 KLF6 Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of KLF6 mRNA more ... CTD PMID:32699268 KLF6 Human panobinostat multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KLF6 mRNA CTD PMID:27188386 KLF6 Human panobinostat increases expression EXP 6480464 panobinostat results in increased expression of KLF6 mRNA CTD PMID:26272509 KLF6 Human paracetamol multiple interactions ISO Klf6 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KLF6 mRNA more ... CTD PMID:17585979 and PMID:29246445 KLF6 Human paracetamol increases expression ISO Klf6 (Mus musculus) 6480464 Acetaminophen results in increased expression of KLF6 mRNA and Acetaminophen results in increased expression of KLF6 protein CTD PMID:29246445 more ... KLF6 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of KLF6 mRNA CTD PMID:21420995 and PMID:29067470 KLF6 Human paracetamol affects expression ISO Klf6 (Mus musculus) 6480464 Acetaminophen affects the expression of KLF6 mRNA CTD PMID:17562736 KLF6 Human paracetamol increases expression ISO Klf6 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of KLF6 mRNA CTD PMID:17202762 and PMID:33387578 KLF6 Human paraquat multiple interactions EXP 6480464 [CYP2E1 protein co-treated with Paraquat] results in increased expression of KLF6 protein more ... CTD PMID:22486562 KLF6 Human parathion increases expression ISO Klf6 (Mus musculus) 6480464 Parathion results in increased expression of KLF6 mRNA CTD PMID:34813904 KLF6 Human pentanal decreases expression EXP 6480464 pentanal results in decreased expression of KLF6 mRNA CTD PMID:26079696 KLF6 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Klf6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KLF6 mRNA CTD PMID:36331819 KLF6 Human perfluorooctanoic acid increases expression ISO Klf6 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in increased expression of KLF6 mRNA CTD PMID:19162173 KLF6 Human phenobarbital multiple interactions ISO Klf6 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of KLF6 mRNA CTD PMID:24535843 KLF6 Human phenobarbital affects expression ISO Klf6 (Mus musculus) 6480464 Phenobarbital affects the expression of KLF6 mRNA CTD PMID:23091169 KLF6 Human phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of KLF6 mRNA CTD PMID:19159669 KLF6 Human phenol increases expression EXP 6480464 Phenol results in increased expression of KLF6 mRNA CTD PMID:17547211 KLF6 Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of KLF6 mRNA CTD PMID:26272509 KLF6 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KLF6 mRNA CTD PMID:27188386 KLF6 Human phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of KLF6 mRNA and pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of KLF6 mRNA] CTD PMID:15477007 KLF6 Human piperonyl butoxide increases expression ISO Klf6 (Rattus norvegicus) 6480464 Piperonyl Butoxide results in increased expression of KLF6 mRNA CTD PMID:23411599 KLF6 Human pirinixic acid increases expression ISO Klf6 (Mus musculus) 6480464 pirinixic acid results in increased expression of KLF6 mRNA CTD PMID:18445702 KLF6 Human pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of KLF6 mRNA CTD PMID:19710929 KLF6 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of KLF6 mRNA CTD PMID:22714537 KLF6 Human progesterone increases expression EXP 6480464 Progesterone results in increased expression of KLF6 mRNA CTD PMID:18070364 more ... KLF6 Human pyrrolidine dithiocarbamate multiple interactions EXP 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of KLF6 mRNA] CTD PMID:15477007 KLF6 Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of KLF6 mRNA CTD PMID:21632981 KLF6 Human rac-lactic acid increases expression EXP 6480464 Lactic Acid results in increased expression of KLF6 mRNA CTD PMID:30851411 KLF6 Human raloxifene decreases expression ISO Klf6 (Rattus norvegicus) 6480464 Raloxifene Hydrochloride results in decreased expression of KLF6 mRNA CTD PMID:15576828 KLF6 Human ranitidine multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 Ranitidine promotes the reaction [Lipopolysaccharides results in increased expression of KLF6 mRNA] CTD PMID:16415329 KLF6 Human reactive oxygen species affects expression EXP 6480464 Reactive Oxygen Species affects the expression of KLF6 mRNA CTD PMID:25800948 KLF6 Human rifampicin multiple interactions EXP 6480464 [Rifampin co-treated with NR1I2 protein] results in increased expression of KLF6 mRNA CTD PMID:21127053 KLF6 Human rimonabant multiple interactions ISO Klf6 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of KLF6 mRNA] CTD PMID:19030233 KLF6 Human rotenone increases expression ISO Klf6 (Rattus norvegicus) 6480464 Rotenone results in increased expression of KLF6 mRNA CTD PMID:28374803 KLF6 Human S-adenosyl-L-methioninate decreases expression ISO Klf6 (Mus musculus) 6480464 S-Adenosylmethionine results in decreased expression of KLF6 mRNA CTD PMID:18098314 KLF6 Human S-adenosyl-L-methioninate multiple interactions ISO Klf6 (Mus musculus) 6480464 S-Adenosylmethionine inhibits the reaction [Dicarbethoxydihydrocollidine results in increased expression of KLF6 mRNA] CTD PMID:18098314 KLF6 Human S-adenosyl-L-methionine multiple interactions ISO Klf6 (Mus musculus) 6480464 S-Adenosylmethionine inhibits the reaction [Dicarbethoxydihydrocollidine results in increased expression of KLF6 mRNA] CTD PMID:18098314 KLF6 Human S-adenosyl-L-methionine decreases expression ISO Klf6 (Mus musculus) 6480464 S-Adenosylmethionine results in decreased expression of KLF6 mRNA CTD PMID:18098314 KLF6 Human S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions EXP 6480464 Buthionine Sulfoximine promotes the reaction [[CYP2E1 protein co-treated with Vitamin K 3] results in increased expression of KLF6 protein] CTD PMID:22486562 KLF6 Human Salinomycin increases expression EXP 6480464 salinomycin results in increased expression of KLF6 mRNA CTD PMID:22215106 KLF6 Human SB 203580 multiple interactions EXP 6480464 [Arachidonic Acid co-treated with SB 203580] results in decreased expression of KLF6 mRNA more ... CTD PMID:22486562 KLF6 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 KLF6 Human selenium atom increases expression EXP 6480464 Selenium results in increased expression of KLF6 mRNA CTD PMID:19244175 KLF6 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of KLF6 mRNA and Silicon Dioxide results in increased expression of KLF6 mRNA CTD PMID:25351596 and PMID:25895662 KLF6 Human silicon dioxide increases expression ISO Klf6 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of KLF6 mRNA CTD PMID:19073995 and PMID:23221170 KLF6 Human silver atom increases expression EXP 6480464 Silver results in increased expression of KLF6 mRNA CTD PMID:26014281 and PMID:28959546 KLF6 Human silver(0) increases expression EXP 6480464 Silver results in increased expression of KLF6 mRNA CTD PMID:26014281 and PMID:28959546 KLF6 Human simvastatin increases expression EXP 6480464 Simvastatin results in increased expression of KLF6 mRNA CTD PMID:17428261 KLF6 Human sirolimus decreases phosphorylation ISO Klf6 (Mus musculus) 6480464 Sirolimus results in decreased phosphorylation of KLF6 protein CTD PMID:16611854 KLF6 Human sodium arsenate increases expression ISO Klf6 (Mus musculus) 6480464 sodium arsenate results in increased expression of KLF6 mRNA CTD PMID:21795629 KLF6 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of KLF6 mRNA CTD PMID:36586010 KLF6 Human sodium dichromate increases expression ISO Klf6 (Rattus norvegicus) 6480464 sodium bichromate results in increased expression of KLF6 mRNA CTD PMID:25993096 KLF6 Human sodium fluoride decreases expression ISO Klf6 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of KLF6 mRNA CTD PMID:27862939 KLF6 Human Soman increases expression ISO Klf6 (Rattus norvegicus) 6480464 Soman results in increased expression of KLF6 mRNA CTD PMID:19281266 KLF6 Human succimer multiple interactions ISO Klf6 (Mus musculus) 6480464 [Succimer co-treated with Magnetite Nanoparticles] affects the expression of KLF6 mRNA CTD PMID:26378955 KLF6 Human T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of KLF6 mRNA CTD PMID:34581912 KLF6 Human tacrolimus hydrate increases expression ISO Klf6 (Rattus norvegicus) 6480464 Tacrolimus results in increased expression of KLF6 mRNA CTD PMID:21865292 KLF6 Human tebufenpyrad increases expression EXP 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of KLF6 mRNA CTD PMID:33512557 KLF6 Human tetrachloroethene increases expression ISO Klf6 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of KLF6 mRNA CTD PMID:28973375 KLF6 Human tetrachloromethane increases expression ISO Klf6 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of KLF6 mRNA CTD PMID:15728706 and PMID:31150632 KLF6 Human tetrachloromethane multiple interactions ISO Klf6 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of KLF6 mRNA CTD PMID:30517762 KLF6 Human tetrachloromethane increases expression ISO Klf6 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of KLF6 mRNA CTD PMID:27339419 and PMID:31919559 KLF6 Human thioacetamide increases expression ISO Klf6 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of KLF6 mRNA CTD PMID:23411599 and PMID:34492290 KLF6 Human thioacetamide multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of KLF6 mRNA CTD PMID:28943392 KLF6 Human thiram increases expression EXP 6480464 Thiram results in increased expression of KLF6 mRNA CTD PMID:38568856 KLF6 Human titanium dioxide increases expression ISO Klf6 (Mus musculus) 6480464 titanium dioxide analog results in increased expression of KLF6 mRNA CTD PMID:25111187 KLF6 Human topotecan multiple interactions ISO Klf6 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of KLF6 mRNA CTD PMID:25729387 KLF6 Human topotecan increases expression ISO Klf6 (Rattus norvegicus) 6480464 Topotecan results in increased expression of KLF6 mRNA CTD PMID:25729387 KLF6 Human torcetrapib increases expression EXP 6480464 torcetrapib results in increased expression of KLF6 mRNA CTD PMID:23228038 KLF6 Human trichloroethene increases methylation ISO Klf6 (Rattus norvegicus) 6480464 Trichloroethylene results in increased methylation of KLF6 gene CTD PMID:27618143 KLF6 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of KLF6 mRNA CTD PMID:24935251 and PMID:26272509 KLF6 Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KLF6 mRNA CTD PMID:27188386 KLF6 Human triphenyl phosphate increases expression ISO Klf6 (Rattus norvegicus) 6480464 triphenyl phosphate results in increased expression of KLF6 mRNA CTD PMID:30589522 KLF6 Human troglitazone increases expression EXP 6480464 troglitazone results in increased expression of KLF6 mRNA CTD PMID:19140230 KLF6 Human urethane increases expression EXP 6480464 Urethane results in increased expression of KLF6 mRNA CTD PMID:28818685 KLF6 Human valproic acid multiple interactions EXP 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of KLF6 mRNA more ... CTD PMID:17183730 and PMID:27188386 KLF6 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of KLF6 mRNA CTD PMID:23179753 and PMID:27188386 KLF6 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of KLF6 mRNA CTD PMID:24383497 more ... KLF6 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of KLF6 mRNA CTD PMID:25979313 KLF6 Human vancomycin decreases expression ISO Klf6 (Mus musculus) 6480464 Vancomycin results in decreased expression of KLF6 mRNA CTD PMID:18930951 KLF6 Human venlafaxine hydrochloride increases expression ISO Klf6 (Rattus norvegicus) 6480464 Venlafaxine Hydrochloride results in increased expression of KLF6 mRNA CTD PMID:25423262 KLF6 Human vinclozolin affects expression ISO Klf6 (Rattus norvegicus) 6480464 vinclozolin affects the expression of KLF6 mRNA CTD PMID:19015723 KLF6 Human vincristine increases expression EXP 6480464 Vincristine results in increased expression of KLF6 mRNA CTD PMID:23649840 KLF6 Human vitamin E multiple interactions EXP 6480464 Vitamin E inhibits the reaction [[CYP2E1 protein co-treated with Paraquat] results in increased expression of KLF6 protein] more ... CTD PMID:22486562 KLF6 Human vorinostat decreases expression EXP 6480464 vorinostat results in decreased expression of KLF6 mRNA CTD PMID:27188386 KLF6 Human wortmannin decreases expression EXP 6480464 Wortmannin results in decreased expression of KLF6 mRNA CTD PMID:22486562 KLF6 Human wortmannin multiple interactions EXP 6480464 Wortmannin inhibits the reaction [Arachidonic Acid promotes the reaction [CYP2E1 protein results in increased expression of KLF6 mRNA]] and Wortmannin inhibits the reaction [CYP2E1 protein results in increased expression of KLF6 mRNA] CTD PMID:22486562 KLF6 Human zinc atom multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KLF6 mRNA CTD PMID:18593933 KLF6 Human zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of KLF6 mRNA CTD PMID:18356318 KLF6 Human zinc(0) multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KLF6 mRNA CTD PMID:18593933 KLF6 Human zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of KLF6 mRNA CTD PMID:18356318
(-)-demecolcine (EXP) (1->4)-beta-D-glucan (ISO) (S)-colchicine (EXP) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (EXP) 1-methylphenanthrene (EXP) 1-naphthyl isothiocyanate (EXP,ISO) 15-deoxy-Delta(12,14)-prostaglandin J2 (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2-hydroxypropanoic acid (EXP) 2-methylcholine (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP) 5-aza-2'-deoxycytidine (EXP) 5-azacytidine (EXP) 5-fluorouracil (EXP) 9-cis-retinoic acid (ISO) acetamide (ISO) acrolein (EXP) aflatoxin B1 (EXP,ISO) alachlor (ISO) aldehydo-D-glucose (ISO) alpha-pinene (EXP) ammonium chloride (ISO) androstane-3,17-dione (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) antimony(0) (EXP) antimycin A (EXP) arachidonic acid (EXP) Aroclor 1254 (ISO) arsenite(3-) (EXP) atrazine (EXP) azathioprine (EXP) benzene (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) benzoates (EXP) beta-lapachone (EXP) beta-naphthoflavone (EXP) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) bisphenol F (ISO) bortezomib (EXP) cadmium atom (EXP) cadmium dichloride (EXP,ISO) cannabidiol (EXP) carbamazepine (EXP) carbonyl sulfide (ISO) CGP 52608 (EXP) chloropicrin (EXP) chloroprene (ISO) choline (ISO) cisplatin (EXP,ISO) clofibrate (ISO) cobalt dichloride (EXP,ISO) copper(II) chloride (EXP) copper(II) sulfate (EXP) coumestrol (EXP) crocidolite asbestos (EXP) curcumin (EXP) cyclosporin A (EXP,ISO) cylindrospermopsin (EXP) D-glucose (ISO) DDE (EXP) Diallyl sulfide (EXP) dibutyl phthalate (ISO) dicoumarol (EXP) dieldrin (EXP) dioxygen (EXP) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (EXP) diuron (ISO) dorsomorphin (EXP) doxorubicin (EXP) elemental selenium (EXP) Enterolactone (EXP) ethanol (ISO) ethyl methanesulfonate (EXP) etoposide (EXP) fenthion (ISO) fluoranthene (ISO) folic acid (ISO) formaldehyde (EXP) fumonisin B1 (ISO) gentamycin (ISO) geraniol (EXP) glucose (ISO) Glutathione ethyl ester (EXP) GSK-J4 (EXP) hydralazine (EXP) hydrogen peroxide (EXP) indole-3-methanol (ISO) ionomycin (EXP) iron dichloride (EXP) isobutanol (EXP) kenpaullone (ISO) ketamine (ISO) L-methionine (ISO) lead diacetate (ISO) leflunomide (EXP) lipopolysaccharide (ISO) lithium atom (EXP) lithium hydride (EXP) MeIQx (EXP) menadione (EXP) mercury dibromide (EXP) mercury dichloride (ISO) methamphetamine (ISO) methidathion (ISO) methyl methanesulfonate (EXP) methylmercury chloride (EXP) methyltestosterone (EXP) mitomycin C (EXP) N-acetylsphingosine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP) N-methyl-4-phenylpyridinium (ISO) N-methylformamide (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (EXP,ISO) N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (ISO) nickel atom (ISO) nickel dichloride (EXP,ISO) nickel sulfate (EXP) O-methyleugenol (ISO) oxaliplatin (ISO) ozone (EXP,ISO) panobinostat (EXP) paracetamol (EXP,ISO) paraquat (EXP) parathion (ISO) pentanal (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) phenol (EXP) phenylmercury acetate (EXP) phorbol 13-acetate 12-myristate (EXP) piperonyl butoxide (ISO) pirinixic acid (EXP,ISO) potassium chromate (EXP) progesterone (EXP) pyrrolidine dithiocarbamate (EXP) quercetin (EXP) rac-lactic acid (EXP) raloxifene (ISO) ranitidine (ISO) reactive oxygen species (EXP) rifampicin (EXP) rimonabant (ISO) rotenone (ISO) S-adenosyl-L-methioninate (ISO) S-adenosyl-L-methionine (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) Salinomycin (EXP) SB 203580 (EXP) SB 431542 (EXP) selenium atom (EXP) silicon dioxide (EXP,ISO) silver atom (EXP) silver(0) (EXP) simvastatin (EXP) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (EXP) sodium dichromate (ISO) sodium fluoride (ISO) Soman (ISO) succimer (ISO) T-2 toxin (EXP) tacrolimus hydrate (ISO) tebufenpyrad (EXP) tetrachloroethene (ISO) tetrachloromethane (ISO) thioacetamide (ISO) thiram (EXP) titanium dioxide (ISO) topotecan (ISO) torcetrapib (EXP) trichloroethene (ISO) trichostatin A (EXP) triphenyl phosphate (ISO) troglitazone (EXP) urethane (EXP) valproic acid (EXP) vancomycin (ISO) venlafaxine hydrochloride (ISO) vinclozolin (ISO) vincristine (EXP) vitamin E (EXP) vorinostat (EXP) wortmannin (EXP) zinc atom (EXP) zinc(0) (EXP)
KLF6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 3,775,996 - 3,785,209 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 3,775,996 - 3,785,281 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 3,818,188 - 3,827,401 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 3,811,234 - 3,817,455 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 3,811,240 - 3,817,455 NCBI Celera 10 3,763,066 - 3,772,350 (-) NCBI Celera Cytogenetic Map 10 p15.2 NCBI HuRef 10 3,754,750 - 3,764,030 (-) NCBI HuRef CHM1_1 10 3,818,788 - 3,828,068 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 3,779,895 - 3,789,103 (-) NCBI T2T-CHM13v2.0
Klf6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 5,911,488 - 5,920,392 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 5,911,481 - 5,920,393 (+) Ensembl GRCm39 Ensembl GRCm38 13 5,861,489 - 5,870,393 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 5,861,482 - 5,870,394 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 5,860,735 - 5,869,639 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 5,860,735 - 5,869,639 (+) NCBI MGSCv36 mm8 Celera 13 5,806,926 - 5,815,830 (+) NCBI Celera Cytogenetic Map 13 A1 NCBI cM Map 13 2.94 NCBI
Klf6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 69,449,483 - 69,458,478 (-) NCBI GRCr8 mRatBN7.2 17 64,539,456 - 64,548,451 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 64,531,463 - 64,588,570 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 68,038,144 - 68,047,153 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 71,866,987 - 71,875,996 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 65,913,871 - 65,922,847 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 67,887,939 - 67,945,052 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 67,887,939 - 67,945,037 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 69,616,967 - 69,674,031 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 75,578,498 - 75,585,072 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 75,589,332 - 75,595,905 (-) NCBI Celera 17 64,125,707 - 64,134,702 (-) NCBI Celera Cytogenetic Map 17 q12.1 NCBI
Klf6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 1,838,537 - 1,846,915 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 1,838,537 - 1,846,915 (+) NCBI ChiLan1.0 ChiLan1.0
KLF6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 16,278,053 - 16,286,827 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 16,283,374 - 16,292,148 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 3,781,797 - 3,790,539 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 3,789,893 - 3,798,057 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 3,789,893 - 3,796,379 (-) Ensembl panpan1.1 panPan2
KLF6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 31,654,142 - 31,664,009 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 31,654,175 - 31,662,351 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 28,683,538 - 28,693,072 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 32,036,878 - 32,046,413 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 32,036,907 - 32,046,041 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 29,123,207 - 29,131,390 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 29,962,128 - 29,971,626 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 30,688,899 - 30,698,432 (+) NCBI UU_Cfam_GSD_1.0
Klf6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 34,305,208 - 34,311,507 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936484 10,470,332 - 10,478,119 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936484 10,470,384 - 10,476,682 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KLF6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 66,488,391 - 66,497,844 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 66,488,445 - 66,497,830 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 72,992,298 - 73,001,801 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KLF6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 3,872,376 - 3,881,238 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 3,875,356 - 3,881,229 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666051 9,015,716 - 9,024,467 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Klf6
.
Confirmed Target Of
MIR181A2 hsa-miR-181a-5p Mirtarbase external_info Luciferase reporter assay//qRT-PCR//Western blot Functional MTI 22581522 MIR181A2 hsa-miR-181a-5p OncomiRDB external_info NA NA 22581522 MIR181A1 hsa-miR-181a-5p Mirtarbase external_info Luciferase reporter assay//qRT-PCR//Western blot Functional MTI 22581522 MIR181A1 hsa-miR-181a-5p OncomiRDB external_info NA NA 22581522
Predicted Target Of
Count of predictions: 4748 Count of miRNA genes: 1231 Interacting mature miRNAs: 1563 Transcripts: ENST00000173785, ENST00000380946, ENST00000461124, ENST00000469435, ENST00000492125, ENST00000497571, ENST00000542957 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597076292 GWAS1172366_H heel bone mineral density QTL GWAS1172366 (human) 1e-09 heel bone mineral density bone mineral density (CMO:0001226) 10 3780950 3780951 Human 597324110 GWAS1420184_H schizophrenia QTL GWAS1420184 (human) 5e-14 schizophrenia 10 3779369 3779370 Human 597095299 GWAS1191373_H schizophrenia QTL GWAS1191373 (human) 0.000002 schizophrenia 10 3779369 3779370 Human 597081790 GWAS1177864_H monocyte count QTL GWAS1177864 (human) 3e-12 monocyte quantity (VT:0000223) blood monocyte count (CMO:0000032) 10 3779369 3779370 Human 407059402 GWAS708378_H heel bone mineral density QTL GWAS708378 (human) 4e-19 heel bone mineral density bone mineral density (CMO:0001226) 10 3778595 3778596 Human 597032956 GWAS1129030_H balding measurement QTL GWAS1129030 (human) 1e-08 hair amount (VT:0000416) coat/hair morphological measurement (CMO:0001807) 10 3783959 3783960 Human 597043356 GWAS1139430_H schizophrenia QTL GWAS1139430 (human) 2e-09 schizophrenia 10 3777522 3777523 Human 597085676 GWAS1181750_H monocyte count QTL GWAS1181750 (human) 1e-13 monocyte quantity (VT:0000223) blood monocyte count (CMO:0000032) 10 3779369 3779370 Human 597089768 GWAS1185842_H monocyte count QTL GWAS1185842 (human) 2e-14 monocyte quantity (VT:0000223) blood monocyte count (CMO:0000032) 10 3779369 3779370 Human 597077417 GWAS1173491_H heel bone mineral density QTL GWAS1173491 (human) 2e-10 heel bone mineral density bone mineral density (CMO:0001226) 10 3780950 3780951 Human 597225863 GWAS1321937_H heel bone mineral density QTL GWAS1321937 (human) 1e-14 heel bone mineral density bone mineral density (CMO:0001226) 10 3780950 3780951 Human
RH48829
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 3,821,077 - 3,821,205 UniSTS GRCh37 Build 36 10 3,811,077 - 3,811,205 RGD NCBI36 Celera 10 3,765,955 - 3,766,083 RGD Cytogenetic Map 10 p15 UniSTS HuRef 10 3,757,639 - 3,757,767 UniSTS GeneMap99-GB4 RH Map 10 39.82 UniSTS NCBI RH Map 10 103.9 UniSTS
G62122
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 3,821,519 - 3,821,638 UniSTS GRCh37 Build 36 10 3,811,519 - 3,811,638 RGD NCBI36 Celera 10 3,766,397 - 3,766,516 RGD Cytogenetic Map 10 p15 UniSTS HuRef 10 3,758,081 - 3,758,200 UniSTS
WI-12084
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 3,821,275 - 3,821,415 UniSTS GRCh37 Build 36 10 3,811,275 - 3,811,415 RGD NCBI36 Celera 10 3,766,153 - 3,766,293 RGD Cytogenetic Map 10 p15 UniSTS HuRef 10 3,757,837 - 3,757,977 UniSTS GeneMap99-GB4 RH Map 10 39.82 UniSTS Whitehead-RH Map 10 39.0 UniSTS NCBI RH Map 10 103.9 UniSTS
D10S1368E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 3,819,344 - 3,819,445 UniSTS GRCh37 Build 36 10 3,809,344 - 3,809,445 RGD NCBI36 Celera 10 3,764,222 - 3,764,323 RGD Cytogenetic Map 10 p15 UniSTS HuRef 10 3,755,906 - 3,756,007 UniSTS GeneMap99-GB4 RH Map 10 38.19 UniSTS NCBI RH Map 10 103.9 UniSTS
D10S2364
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 3,819,191 - 3,819,288 UniSTS GRCh37 Build 36 10 3,809,191 - 3,809,288 RGD NCBI36 Celera 10 3,764,068 - 3,764,165 RGD Cytogenetic Map 10 p15 UniSTS HuRef 10 3,755,752 - 3,755,849 UniSTS Stanford-G3 RH Map 10 117.0 UniSTS NCBI RH Map 10 81.8 UniSTS GeneMap99-G3 RH Map 10 117.0 UniSTS
STS-AA018922
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 3,823,873 - 3,824,114 UniSTS GRCh37 Build 36 10 3,813,873 - 3,814,114 RGD NCBI36 Celera 10 3,768,751 - 3,768,992 RGD Cytogenetic Map 10 p15 UniSTS HuRef 10 3,760,430 - 3,760,671 UniSTS GeneMap99-GB4 RH Map 10 39.82 UniSTS NCBI RH Map 10 103.9 UniSTS
COPEB_2513
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 3,821,100 - 3,821,710 UniSTS GRCh37 Build 36 10 3,811,100 - 3,811,710 RGD NCBI36 Celera 10 3,765,978 - 3,766,588 RGD HuRef 10 3,757,662 - 3,758,272 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2435
2788
2247
4954
1724
2351
5
622
1950
465
2269
7297
6465
53
3716
852
1740
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000173785
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 3,779,047 - 3,782,051 (-) Ensembl
Ensembl Acc Id:
ENST00000380946
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 3,781,808 - 3,785,183 (-) Ensembl
Ensembl Acc Id:
ENST00000461124
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 3,775,996 - 3,780,217 (-) Ensembl
Ensembl Acc Id:
ENST00000469435 ⟹ ENSP00000419079
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 3,780,327 - 3,785,193 (-) Ensembl
Ensembl Acc Id:
ENST00000492125
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 3,779,550 - 3,780,496 (-) Ensembl
Ensembl Acc Id:
ENST00000497571 ⟹ ENSP00000419923
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 3,775,996 - 3,785,209 (-) Ensembl
Ensembl Acc Id:
ENST00000542957 ⟹ ENSP00000445301
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 3,775,997 - 3,785,281 (-) Ensembl
RefSeq Acc Id:
NM_001160124 ⟹ NP_001153596
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 3,775,996 - 3,785,209 (-) NCBI GRCh37 10 3,818,188 - 3,827,473 (-) ENTREZGENE HuRef 10 3,754,750 - 3,764,030 (-) ENTREZGENE CHM1_1 10 3,818,788 - 3,828,068 (-) NCBI T2T-CHM13v2.0 10 3,779,895 - 3,789,103 (-) NCBI
Sequence:
GCAGTCAGTCCGGTGTTTGCAAATATTGTGTGGGCTCCGCGCGCTGCGGGCTGCGGGAGGGTCCGGCCGGGCGTCTCTGCGAGCCTGGAGTTTGCATGAAACTTTCACCTGCGCTCCGGGGAGACTTT
hide sequence
RefSeq Acc Id:
NM_001160125 ⟹ NP_001153597
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 3,775,996 - 3,785,209 (-) NCBI GRCh37 10 3,818,188 - 3,827,473 (-) ENTREZGENE HuRef 10 3,754,750 - 3,764,030 (-) ENTREZGENE CHM1_1 10 3,818,788 - 3,828,068 (-) NCBI T2T-CHM13v2.0 10 3,779,895 - 3,789,103 (-) NCBI
Sequence:
GCAGTCAGTCCGGTGTTTGCAAATATTGTGTGGGCTCCGCGCGCTGCGGGCTGCGGGAGGGTCCGGCCGGGCGTCTCTGCGAGCCTGGAGTTTGCATGAAACTTTCACCTGCGCTCCGGGGAGACTTT
hide sequence
RefSeq Acc Id:
NM_001300 ⟹ NP_001291
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 3,775,996 - 3,785,209 (-) NCBI GRCh37 10 3,818,188 - 3,827,473 (-) ENTREZGENE Build 36 10 3,811,234 - 3,817,455 (-) NCBI Archive HuRef 10 3,754,750 - 3,764,030 (-) ENTREZGENE CHM1_1 10 3,818,788 - 3,828,068 (-) NCBI T2T-CHM13v2.0 10 3,779,895 - 3,789,103 (-) NCBI
Sequence:
GCAGTCAGTCCGGTGTTTGCAAATATTGTGTGGGCTCCGCGCGCTGCGGGCTGCGGGAGGGTCCGGCCGGGCGTCTCTGCGAGCCTGGAGTTTGCATGAAACTTTCACCTGCGCTCCGGGGAGACTTT
hide sequence
RefSeq Acc Id:
NR_027653
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 3,775,996 - 3,785,209 (-) NCBI GRCh37 10 3,818,188 - 3,827,473 (-) ENTREZGENE HuRef 10 3,754,750 - 3,764,030 (-) ENTREZGENE CHM1_1 10 3,818,788 - 3,828,068 (-) NCBI T2T-CHM13v2.0 10 3,779,895 - 3,789,103 (-) NCBI
Sequence:
GCAGTCAGTCCGGTGTTTGCAAATATTGTGTGGGCTCCGCGCGCTGCGGGCTGCGGGAGGGTCCGGCCGGGCGTCTCTGCGAGCCTGGAGTTTGCATGAAACTTTCACCTGCGCTCCGGGGAGACTTT
hide sequence
RefSeq Acc Id:
NP_001153596 ⟸ NM_001160124
- Peptide Label:
isoform B
- UniProtKB:
D3GC14 (UniProtKB/TrEMBL)
- Sequence:
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSD
hide sequence
RefSeq Acc Id:
NP_001153597 ⟸ NM_001160125
- Peptide Label:
isoform C
- UniProtKB:
Q99612 (UniProtKB/Swiss-Prot)
- Sequence:
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSD
hide sequence
RefSeq Acc Id:
NP_001291 ⟸ NM_001300
- Peptide Label:
isoform A
- UniProtKB:
Q5VUT8 (UniProtKB/Swiss-Prot), Q5VUT7 (UniProtKB/Swiss-Prot), F5H3M5 (UniProtKB/Swiss-Prot), D3DRR1 (UniProtKB/Swiss-Prot), B4DDN0 (UniProtKB/Swiss-Prot), B2RE86 (UniProtKB/Swiss-Prot), Q9BT79 (UniProtKB/Swiss-Prot), Q99612 (UniProtKB/Swiss-Prot)
- Sequence:
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSD
hide sequence
Ensembl Acc Id:
ENSP00000445301 ⟸ ENST00000542957
Ensembl Acc Id:
ENSP00000419079 ⟸ ENST00000469435
Ensembl Acc Id:
ENSP00000419923 ⟸ ENST00000497571
RGD ID: 7216875 Promoter ID: EPDNEW_H14184 Type: initiation region Name: KLF6_1 Description: Kruppel like factor 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 10 3,785,209 - 3,785,269 EPDNEW
RGD ID: 6815824 Promoter ID: HG_SPT:6431 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: AI355637, BE617725, CD742988 Position: Human Assembly Chr Position (strand) Source Build 36 10 3,807,661 - 3,808,412 (+) MPROMDB
RGD ID: 6787837 Promoter ID: HG_KWN:8388 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, K562, Lymphoblastoid Transcripts: OTTHUMT00000046499, OTTHUMT00000046500 Position: Human Assembly Chr Position (strand) Source Build 36 10 3,812,426 - 3,813,627 (-) MPROMDB
RGD ID: 6787834 Promoter ID: HG_KWN:8389 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, K562, Lymphoblastoid Transcripts: OTTHUMT00000046498 Position: Human Assembly Chr Position (strand) Source Build 36 10 3,813,786 - 3,815,217 (-) MPROMDB
RGD ID: 6787833 Promoter ID: HG_KWN:8390 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: ENST00000322510, NM_001160124, NM_001160125, NR_027653, OTTHUMT00000046495, OTTHUMT00000046497, UC001IHB.1 Position: Human Assembly Chr Position (strand) Source Build 36 10 3,817,061 - 3,818,277 (-) MPROMDB
RGD ID: 6851684 Promoter ID: EP73644 Type: initiation region Name: HS_COPEB Description: Core promoter element binding protein. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: NEDO full length human cDNA sequencing project.; Oligo-capping Position: Human Assembly Chr Position (strand) Source Build 36 10 3,817,401 - 3,817,461 EPD
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-07-11
KLF6
KLF transcription factor 6
KLF6
Kruppel like factor 6
Symbol and/or name change
19259463 PROVISIONAL
2016-06-07
KLF6
Kruppel like factor 6
KLF6
Kruppel-like factor 6
Symbol and/or name change
5135510 APPROVED
