Advanced Search (OLGA)

Gene: Or5c1 (olfactory receptor family 5 subfamily C member 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Or5c1

Name:

olfactory receptor family 5 subfamily C member 1

RGD ID:

1333139

Description:

Predicted to enable odorant binding activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane. Orthologous to human OR5C1 (olfactory receptor family 5 subfamily C member 1); INTERACTS WITH bisphenol A; cadmium dichloride; copper atom.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 434; olfactory receptor gene Olr434; olfactory receptor Olr434; Olr434

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	41,253,167 - 41,254,150 (+)	NCBI		GRCr8
mRatBN7.2	3	20,862,297 - 20,863,280 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	20,859,540 - 20,863,471 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	23,935,741 - 23,936,724 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	32,520,663 - 32,521,646 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	30,756,653 - 30,757,636 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	21,363,285 - 21,364,268 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	21,363,285 - 21,364,268 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	26,603,044 - 26,604,027 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	16,846,045 - 16,847,028 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	16,742,416 - 16,743,400 (+)	NCBI
Celera	3	15,530,578 - 15,531,561 (+)	NCBI		Celera
Cytogenetic Map	3	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or5c1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Or5c1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of OR5C1 mRNA	CTD	PMID:22206623
Or5c1	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	Or5c1 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of OR5C1 mRNA	CTD	PMID:18648102
Or5c1	Rat	aflatoxin B1	increases methylation	ISO	OR5C1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of OR5C1 gene	CTD	PMID:27153756
Or5c1	Rat	Azoxymethane	multiple interactions	ISO	Or5c1 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of OR5C1 mRNA	CTD	PMID:29950665
Or5c1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OR5C1 mRNA	CTD	PMID:25181051
Or5c1	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of OR5C1 promoter	CTD	PMID:22457795
Or5c1	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of OR5C1 mRNA	CTD	PMID:26033743
Or5c1	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of OR5C1 mRNA	CTD	PMID:26033743
Or5c1	Rat	dextran sulfate	multiple interactions	ISO	Or5c1 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of OR5C1 mRNA	CTD	PMID:29950665
Or5c1	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of OR5C1 gene	CTD	PMID:35440735
Or5c1	Rat	resveratrol	multiple interactions	ISO	OR5C1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of OR5C1 mRNA	CTD	PMID:23557933
Or5c1	Rat	titanium dioxide	multiple interactions	ISO	Or5c1 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of OR5C1 mRNA	CTD	PMID:29950665
Or5c1	Rat	titanium dioxide	decreases expression	ISO	Or5c1 (Mus musculus)	6480464	titanium dioxide results in decreased expression of OR5C1 mRNA	CTD	PMID:29264374
Or5c1	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of OR5C1 mRNA	CTD	PMID:33387578
Or5c1	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of OR5C1 mRNA	CTD	PMID:23869203

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or5c1	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IEA	GO:0004984	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Or5c1	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or5c1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or5c1	Rat	G protein-coupled receptor signaling pathway		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or5c1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or5c1	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or5c1	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or5c1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or5c1	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or5c1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Or5c1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or5c1	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or5c1	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or5c1	Rat	odorant binding	enables	IBA	MGI:3030853 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or5c1	Rat	olfactory receptor activity	enables	IBA	MGI:3030069 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or5c1	Rat	olfactory receptor activity		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or5c1	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or5c1	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Or5c1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	41,253,167 - 41,254,150 (+)	NCBI		GRCr8
mRatBN7.2	3	20,862,297 - 20,863,280 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	20,859,540 - 20,863,471 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	23,935,741 - 23,936,724 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	32,520,663 - 32,521,646 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	30,756,653 - 30,757,636 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	21,363,285 - 21,364,268 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	21,363,285 - 21,364,268 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	26,603,044 - 26,604,027 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	16,846,045 - 16,847,028 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	16,742,416 - 16,743,400 (+)	NCBI
Celera	3	15,530,578 - 15,531,561 (+)	NCBI		Celera
Cytogenetic Map	3	q11	NCBI

OR5C1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	122,788,933 - 122,789,895 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	122,788,933 - 122,789,895 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	125,551,212 - 125,552,174 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	124,591,033 - 124,591,995 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	96,199,553 - 96,200,515 (+)	NCBI		Celera
Cytogenetic Map	9	q33.2	NCBI
HuRef	9	95,165,800 - 95,166,762 (+)	NCBI		HuRef
CHM1_1	9	125,699,035 - 125,699,997 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	134,986,287 - 134,987,249 (+)	NCBI		T2T-CHM13v2.0

Or5c1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	37,221,761 - 37,222,744 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	37,216,527 - 37,222,784 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	37,331,749 - 37,332,732 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	37,326,515 - 37,332,772 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	37,187,269 - 37,188,252 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	37,153,758 - 37,154,741 (+)	NCBI		MGSCv36	mm8
Celera	2	37,015,743 - 37,016,726 (+)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	24.19	NCBI

LOC102020917
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955419	5,153,126 - 5,154,109 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100968122
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	16,554,775 - 16,564,074 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	16,557,210 - 16,562,104 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	93,919,964 - 93,921,530 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	122,254,589 - 122,255,664 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	122,254,645 - 122,255,607 (+)	Ensembl	panpan1.1		panPan2

OR5C1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	59,984,662 - 59,985,621 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	59,984,058 - 59,985,621 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	59,180,484 - 59,181,443 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	60,901,421 - 60,902,380 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	60,900,818 - 60,902,380 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	59,660,530 - 59,661,489 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	59,975,472 - 59,976,431 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	60,068,619 - 60,069,578 (-)	NCBI		UU_Cfam_GSD_1.0

LOC101966098
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	191,515,065 - 191,516,509 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936487	11,283,622 - 11,284,664 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100626932
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	1	263,726,194 - 263,730,635 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	297,140,314 - 297,144,756 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103239908
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	15,334,231 - 15,335,836 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	15,334,587 - 15,335,549 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666079	727,142 - 728,416 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101710083
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624760	12,117,337 - 12,118,269 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Or5c1
2 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	83
Count of miRNA genes:	72
Interacting mature miRNAs:	75
Transcripts:	ENSRNOT00000010520
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	body weight (CMO:0000012)	3	17374703	35528639	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
8693641	Alc30	Alcohol consumption QTL 30	2	0.739	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	3	10434306	24512004	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	18311454	47233430	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	18311454	47233430	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	18311454	47233430	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	10778823	30356773	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	18311454	47233430	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	18311454	47233430	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	47233430	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	18311454	47233430	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	28441896	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

appendage	ectoderm	endocrine system	endoderm	hemolymphoid system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
1	7	6	5	5	1	7	6	5	28	5


RefSeq Transcripts	NM_001000397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010520 ⟹ ENSRNOP00000010520

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	20,859,540 - 20,863,471 (+)	Ensembl
Rnor_6.0 Ensembl	3	21,363,285 - 21,364,268 (+)	Ensembl

RefSeq Acc Id:

NM_001000397 ⟹ NP_001000397

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	41,253,167 - 41,254,150 (+)	NCBI
mRatBN7.2	3	20,862,297 - 20,863,280 (+)	NCBI
Rnor_6.0	3	21,363,285 - 21,364,268 (+)	NCBI
Rnor_5.0	3	26,603,044 - 26,604,027 (+)	NCBI
RGSC_v3.4	3	16,846,045 - 16,847,028 (+)	RGD
Celera	3	15,530,578 - 15,531,561 (+)	RGD

Sequence:

show sequence

ATGAGCTCAGAGAACTTCACCTGGTCCAGAGTTACGCCTGCTGAGTTCATTCTCTTGGGGATCACAAATCGTTGGGACCTGCGCGTGACCCTCTTCCTGATATTCCTGCCCATCTACCTCATGAGCCT
GCTGGGAAATGTGGGAATGGTGCTACTCATCCGTATAGATGCCAGGCTCCACACACCCATGTACTTCTTCCTGGCCAACCTCTCCCTGCTGGATGCCTTCTATTCCTCTGCCATAGGCCCCAAGATGC
TAGTGGATCTTCTACTGTCCCGTGCCACCATCCCTTATGCAGCCTGTGCCCTCCAGATGTTTGTCTTTGCAGGGTTGGCTGATGCTGAGTGTTGCCTGTTAGCAGTCATGGCCTATGATCGCTATGTG
GCCATTGGGAACCCTCTCCTCTATACCACAGTCATGTCACCCCGTCTATGCCTGGCCCTCCTTGGGGCATCAGGCCTGGGAGGAGCAGTGAGTGCCTTTGTACATACAACTTTCACCTTCCGCCTGAG
CTTCTGTGGCTCACTAGAAGTCAACAGCTTCTTCTGCGATATTCCTCCACTGCTTGCCATCTCCTGCAATGACACCAGTCTAAATGAACTCCTCCTTTTTGCTGTCTGTGGTTTTATCCAGACAGCCA
CAGTGTTGGCTATTGCTGTGTCTTATGGATTCATCGCTGGTGCTGTGATCCGCATGCAGTCAGTTGAGGGCCGTCGGAGGGCAGCTTCCACTTGTGGCTCTCACCTCACAGCTGTAGCCATACTATAT
GGGACTCTTATTTTCATGTATCTGCGTCCTAGCTCCAGCTATGCCCTGGACACGGACAAGATGGCATCAGTGTTCTATACTCTCGTCATTCCAGCTCTCAACCCACTCATCTACAGCCTTAGAAACAA
GGAAGTCAAGGAAGCCTTCCGGCGCACTTGCCATCGATTCTGCTGCTCGGGGCGGAGCACCAGTGACTGGCCACAGGAAGCTCCTTAA

hide sequence


Protein RefSeqs	NP_001000397	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL93101	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010520
	ENSRNOP00000010520.3

RefSeq Acc Id:

NP_001000397 ⟸ NM_001000397

- UniProtKB:

D3ZLV0 (UniProtKB/TrEMBL), A6JUJ6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSENFTWSRVTPAEFILLGITNRWDLRVTLFLIFLPIYLMSLLGNVGMVLLIRIDARLHTPMYFFLANLSLLDAFYSSAIGPKMLVDLLLSRATIPYAACALQMFVFAGLADAECCLLAVMAYDRYV
AIGNPLLYTTVMSPRLCLALLGASGLGGAVSAFVHTTFTFRLSFCGSLEVNSFFCDIPPLLAISCNDTSLNELLLFAVCGFIQTATVLAIAVSYGFIAGAVIRMQSVEGRRRAASTCGSHLTAVAILY
GTLIFMYLRPSSSYALDTDKMASVFYTLVIPALNPLIYSLRNKEVKEAFRRTCHRFCCSGRSTSDWPQEAP

hide sequence

Ensembl Acc Id:

ENSRNOP00000010520 ⟸ ENSRNOT00000010520

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZLV0-F1-model_v2	AlphaFold	D3ZLV0	1-327	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-49965	BioCyc
Ensembl Genes	ENSRNOG00000008003	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010520	ENTREZGENE
	ENSRNOT00000010520.3	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:296694	UniProtKB/TrEMBL
NCBI Gene	296694	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or5c1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008003	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6JUJ6	ENTREZGENE, UniProtKB/TrEMBL
	D3ZLV0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or5c1	olfactory receptor family 5 subfamily C member 1	Olr434	olfactory receptor 434	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr434	olfactory receptor 434	Olr434_predicted	olfactory receptor 434 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr434_predicted	olfactory receptor 434 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Mammalian Phenotype