Symbol:
RPP40
Name:
ribonuclease P/MRP subunit p40
RGD ID:
1321008
HGNC Page
HGNC:20992
Description:
Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Part of multimeric ribonuclease P complex.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
bA428J1.3; ribonuclease P (40 kD); ribonuclease P 40kDa subunit; ribonuclease P protein subunit p40; ribonuclease P, 40kD subunit; ribonuclease P/MRP 40kDa subunit; ribonuclease P1; RNase P subunit 1; RNaseP protein p40; RNASEP1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Rpp40 (ribonuclease P 40 subunit) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Rpp40 (ribonuclease P/MRP subunit p40) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Rpp40 (ribonuclease P/MRP subunit p40) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
RPP40 (ribonuclease P/MRP subunit p40) NCBI
Ortholog
Canis lupus familiaris (dog):
RPP40 (ribonuclease P/MRP subunit p40) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rpp40 (ribonuclease P/MRP subunit p40) NCBI
Ortholog
Sus scrofa (pig):
RPP40 (ribonuclease P/MRP subunit p40) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
RPP40 (ribonuclease P/MRP subunit p40) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Rpp40 (ribonuclease P/MRP subunit p40) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Rpp40 (ribonuclease P/MRP subunit p40)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rpp40 (ribonuclease P 40 subunit)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rpp40 (ribonuclease P/MRP 40 subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus laevis (African clawed frog):
rpp40.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
rpp40
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
RPP40P1
RPP40P2
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 4,988,426 - 5,004,037 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 4,994,717 - 5,004,063 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 4,994,951 - 5,004,271 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 4,940,279 - 4,949,270 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 4,940,279 - 4,949,270 NCBI Celera 6 6,224,004 - 6,232,997 (-) NCBI Celera Cytogenetic Map 6 p25.1 NCBI HuRef 6 4,871,613 - 4,880,606 (-) NCBI HuRef CHM1_1 6 4,997,633 - 5,006,608 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 4,855,789 - 4,873,023 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
RPP40 Human (1->4)-beta-D-glucan multiple interactions ISO Rpp40 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPP40 mRNA CTD PMID:36331819 RPP40 Human 17alpha-ethynylestradiol affects expression ISO Rpp40 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of RPP40 mRNA CTD PMID:17555576 RPP40 Human 17alpha-ethynylestradiol increases expression ISO Rpp40 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of RPP40 mRNA CTD PMID:17942748 RPP40 Human 17alpha-ethynylestradiol multiple interactions ISO Rpp40 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RPP40 mRNA CTD PMID:17942748 RPP40 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of RPP40 mRNA CTD PMID:31614463 RPP40 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rpp40 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RPP40 mRNA CTD PMID:17942748 RPP40 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Rpp40 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of RPP40 mRNA CTD PMID:33387578 RPP40 Human 2,4-dinitrotoluene affects expression ISO Rpp40 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of RPP40 mRNA CTD PMID:21346803 RPP40 Human 2,6-dinitrotoluene affects expression ISO Rpp40 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of RPP40 mRNA CTD PMID:21346803 RPP40 Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of RPP40 mRNA CTD PMID:21179406 RPP40 Human 4,4'-diaminodiphenylmethane decreases expression ISO Rpp40 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of RPP40 mRNA CTD PMID:18648102 RPP40 Human 4,4'-sulfonyldiphenol increases expression ISO Rpp40 (Mus musculus) 6480464 bisphenol S results in increased expression of RPP40 mRNA CTD PMID:39298647 RPP40 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of RPP40 mRNA CTD PMID:21934132 and PMID:33167477 RPP40 Human arsane multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RPP40 mRNA CTD PMID:39836092 RPP40 Human arsenic atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RPP40 mRNA CTD PMID:39836092 RPP40 Human Benoxacor increases expression ISO Rpp40 (Mus musculus) 6480464 benoxacor results in increased expression of RPP40 mRNA CTD PMID:34850242 RPP40 Human bisphenol A increases expression ISO Rpp40 (Mus musculus) 6480464 bisphenol A results in increased expression of RPP40 mRNA CTD PMID:26063408 RPP40 Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of RPP40 gene CTD PMID:31601247 RPP40 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RPP40 protein CTD PMID:33376534 RPP40 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of RPP40 gene CTD PMID:31601247 RPP40 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RPP40 mRNA CTD PMID:30903817 RPP40 Human bisphenol A decreases expression ISO Rpp40 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of RPP40 mRNA CTD PMID:25181051 and PMID:34947998 RPP40 Human carbon nanotube increases expression ISO Rpp40 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of RPP40 mRNA CTD PMID:25554681 RPP40 Human copper atom multiple interactions ISO Rpp40 (Mus musculus) 6480464 MT1 affects the reaction [Copper results in increased expression of RPP40 mRNA] and MT2 affects the reaction [Copper results in increased expression of RPP40 mRNA] CTD PMID:16629173 RPP40 Human copper(0) multiple interactions ISO Rpp40 (Mus musculus) 6480464 MT1 affects the reaction [Copper results in increased expression of RPP40 mRNA] and MT2 affects the reaction [Copper results in increased expression of RPP40 mRNA] CTD PMID:16629173 RPP40 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of RPP40 mRNA CTD PMID:22147139 RPP40 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of RPP40 mRNA CTD PMID:20106945 and PMID:25562108 RPP40 Human cylindrospermopsin increases expression EXP 6480464 cylindrospermopsin results in increased expression of RPP40 mRNA CTD PMID:24921660 RPP40 Human deguelin increases expression EXP 6480464 deguelin results in increased expression of RPP40 mRNA CTD PMID:33512557 RPP40 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of RPP40 mRNA CTD PMID:37042841 RPP40 Human dibutyl phthalate decreases expression ISO Rpp40 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of RPP40 mRNA CTD PMID:21266533 RPP40 Human dicrotophos decreases expression EXP 6480464 dicrotophos results in decreased expression of RPP40 mRNA CTD PMID:28302478 RPP40 Human disodium selenite increases expression EXP 6480464 Sodium Selenite results in increased expression of RPP40 mRNA CTD PMID:18175754 RPP40 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RPP40 mRNA CTD PMID:27188386 RPP40 Human ethanol increases expression ISO Rpp40 (Mus musculus) 6480464 Ethanol results in increased expression of RPP40 mRNA CTD PMID:30319688 RPP40 Human finasteride increases expression ISO Rpp40 (Rattus norvegicus) 6480464 Finasteride results in increased expression of RPP40 mRNA CTD PMID:24136188 RPP40 Human flutamide increases expression ISO Rpp40 (Rattus norvegicus) 6480464 Flutamide results in increased expression of RPP40 mRNA CTD PMID:24136188 RPP40 Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of RPP40 gene CTD PMID:31601247 RPP40 Human gentamycin increases expression ISO Rpp40 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of RPP40 mRNA CTD PMID:22061828 RPP40 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of RPP40 mRNA CTD PMID:20044591 RPP40 Human isotretinoin decreases expression EXP 6480464 Isotretinoin results in decreased expression of RPP40 mRNA CTD PMID:20436886 RPP40 Human lead diacetate increases expression ISO Rpp40 (Mus musculus) 6480464 lead acetate results in increased expression of RPP40 mRNA CTD PMID:21829687 RPP40 Human manganese atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RPP40 mRNA CTD PMID:39836092 RPP40 Human manganese(0) multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RPP40 mRNA CTD PMID:39836092 RPP40 Human manganese(II) chloride multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RPP40 mRNA CTD PMID:39836092 RPP40 Human nickel atom increases expression EXP 6480464 Nickel results in increased expression of RPP40 mRNA CTD PMID:25583101 RPP40 Human perfluorononanoic acid increases expression EXP 6480464 perfluoro-n-nonanoic acid results in increased expression of RPP40 mRNA CTD PMID:32588087 RPP40 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Rpp40 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPP40 mRNA CTD PMID:36331819 RPP40 Human picoxystrobin increases expression EXP 6480464 picoxystrobin results in increased expression of RPP40 mRNA CTD PMID:33512557 RPP40 Human pirinixic acid increases expression ISO Rpp40 (Mus musculus) 6480464 pirinixic acid results in increased expression of RPP40 mRNA CTD PMID:18301758 RPP40 Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of RPP40 mRNA CTD PMID:21632981 RPP40 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RPP40 mRNA CTD PMID:27188386 RPP40 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of RPP40 mRNA CTD PMID:25895662 RPP40 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of RPP40 mRNA CTD PMID:22714537 RPP40 Human sodium arsenite multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RPP40 mRNA CTD PMID:39836092 RPP40 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of RPP40 mRNA CTD PMID:38568856 RPP40 Human T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of RPP40 mRNA CTD PMID:34581912 RPP40 Human tamoxifen affects expression ISO Rpp40 (Mus musculus) 6480464 Tamoxifen affects the expression of RPP40 mRNA CTD PMID:17555576 RPP40 Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of RPP40 mRNA CTD PMID:31758290 RPP40 Human tetrachloromethane decreases expression ISO Rpp40 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of RPP40 mRNA CTD PMID:31919559 RPP40 Human trichostatin A affects expression EXP 6480464 trichostatin A affects the expression of RPP40 mRNA CTD PMID:28542535 RPP40 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of RPP40 mRNA CTD PMID:37042841 RPP40 Human triptonide decreases expression ISO Rpp40 (Mus musculus) 6480464 triptonide results in decreased expression of RPP40 mRNA CTD PMID:33045310 RPP40 Human tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of RPP40 mRNA CTD PMID:22378314 RPP40 Human valproic acid affects expression ISO Rpp40 (Mus musculus) 6480464 Valproic Acid affects the expression of RPP40 mRNA CTD PMID:17963808 RPP40 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of RPP40 mRNA CTD PMID:25979313 RPP40 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of RPP40 mRNA CTD PMID:23179753 and PMID:26272509 RPP40 Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RPP40 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
RPP40 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 4,988,426 - 5,004,037 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 4,994,717 - 5,004,063 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 4,994,951 - 5,004,271 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 4,940,279 - 4,949,270 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 4,940,279 - 4,949,270 NCBI Celera 6 6,224,004 - 6,232,997 (-) NCBI Celera Cytogenetic Map 6 p25.1 NCBI HuRef 6 4,871,613 - 4,880,606 (-) NCBI HuRef CHM1_1 6 4,997,633 - 5,006,608 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 4,855,789 - 4,873,023 (-) NCBI T2T-CHM13v2.0
Rpp40 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 36,080,685 - 36,095,548 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 36,077,455 - 36,090,342 (-) Ensembl GRCm39 Ensembl GRCm38 13 35,895,104 - 35,911,565 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 35,893,472 - 35,906,359 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 35,986,973 - 35,998,216 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 35,900,937 - 35,913,812 (-) NCBI MGSCv36 mm8 Celera 13 37,009,759 - 37,021,002 (-) NCBI Celera Cytogenetic Map 13 A3.3 NCBI cM Map 13 14.44 NCBI
Rpp40 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 29,153,203 - 29,162,241 (+) NCBI GRCr8 mRatBN7.2 17 28,947,752 - 28,956,788 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 28,947,734 - 28,956,788 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 28,807,889 - 28,816,921 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 30,411,435 - 30,420,467 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 28,783,409 - 28,792,437 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 29,638,647 - 29,647,709 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 29,638,677 - 29,647,763 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 31,534,547 - 31,543,593 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 35,249,263 - 35,257,891 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 35,252,103 - 35,260,731 (+) NCBI Celera 17 28,549,277 - 28,557,686 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
Rpp40 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955465 8,540,459 - 8,550,249 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955465 8,540,500 - 8,550,255 (+) NCBI ChiLan1.0 ChiLan1.0
RPP40 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 19,623,806 - 19,632,422 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 15,627,775 - 15,636,370 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 4,828,155 - 4,838,680 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 5,015,953 - 5,024,540 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 5,015,953 - 5,024,540 (-) Ensembl panpan1.1 panPan2
RPP40 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 5,109,324 - 5,119,713 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 5,109,658 - 5,120,294 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 5,118,469 - 5,128,320 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 5,181,170 - 5,191,232 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 5,181,173 - 5,191,799 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 5,046,009 - 5,056,067 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 5,071,013 - 5,081,115 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 6,403,016 - 6,413,078 (-) NCBI UU_Cfam_GSD_1.0
Rpp40 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 19,202,211 - 19,211,477 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936534 7,471,198 - 7,480,475 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936534 7,471,209 - 7,480,457 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RPP40
RPP40 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 67,172,759 - 67,181,669 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 67,173,130 - 67,181,975 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 4,945,666 - 4,954,176 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rpp40
.
Predicted Target Of
Count of predictions: 789 Count of miRNA genes: 484 Interacting mature miRNAs: 524 Transcripts: ENST00000319533, ENST00000380051, ENST00000464646, ENST00000468105, ENST00000479782, ENST00000483546 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2289408 BW324_H Body weight QTL 324 (human) 3.15 0.0001 Body fat amount 6 1 20803913 Human 1643418 BW282_H Body Weight QTL 282 (human) 2.07 0.001 Body weight 6 1 19321359 Human 597133668 GWAS1229742_H memory performance QTL GWAS1229742 (human) 0.000004 memory performance 6 4995574 4995575 Human 2289435 BMD4_H Bone mineral density QTL 4 (human) 3.15 0.0001 Bone mineral density 6 1 20803913 Human 596986908 GWAS1106427_H memory performance QTL GWAS1106427 (human) 0.000004 memory performance 6 4995574 4995575 Human 2292824 PRSTS5_H Prostate tumor susceptibility QTL 5 (human) Prostate tumor susceptibility 6 1 19232373 Human 2289320 BW390_H Body weight QTL 390 (human) 2.13 Body weight BMI 6 1 19321359 Human 1643495 BW291_H Body Weight QTL 291 (human) 2.13 Body weight BMI 6 1 19321359 Human
RH47442
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 4,995,339 - 4,995,479 UniSTS GRCh37 Build 36 6 4,940,338 - 4,940,478 RGD NCBI36 Celera 6 6,224,063 - 6,224,203 RGD Cytogenetic Map 6 p25.1 UniSTS HuRef 6 4,871,672 - 4,871,812 UniSTS GeneMap99-GB4 RH Map 6 25.31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1940
465
2270
7295
6461
53
3734
1
852
1744
1617
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000319533 ⟹ ENSP00000317998
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 4,995,047 - 5,004,036 (-) Ensembl
Ensembl Acc Id:
ENST00000380051 ⟹ ENSP00000369391
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 4,994,717 - 5,004,037 (-) Ensembl
Ensembl Acc Id:
ENST00000464646 ⟹ ENSP00000419431
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 4,995,078 - 5,003,658 (-) Ensembl
Ensembl Acc Id:
ENST00000468105
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 4,998,688 - 5,004,047 (-) Ensembl
Ensembl Acc Id:
ENST00000479782 ⟹ ENSP00000418874
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 4,998,828 - 5,004,018 (-) Ensembl
Ensembl Acc Id:
ENST00000483546
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 5,001,776 - 5,004,063 (-) Ensembl
Ensembl Acc Id:
ENST00000618533 ⟹ ENSP00000484334
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 4,995,049 - 5,004,063 (-) Ensembl
RefSeq Acc Id:
NM_001286132 ⟹ NP_001273061
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 4,994,717 - 5,004,037 (-) NCBI HuRef 6 4,871,613 - 4,880,632 (-) NCBI CHM1_1 6 4,997,633 - 5,006,634 (-) NCBI T2T-CHM13v2.0 6 4,863,716 - 4,873,023 (-) NCBI
Sequence:
AGCGGAGGCCGGGAGGACCAGGAACCCAGGAGAGCATGGCCACGCTGCGCCGGCTTCGGGAGGCGCCGCGGCACTTACTGGTTTGCGAGAAATCCAACTTCGGCAACCACAAGTCGCGCCACCGGCAT
hide sequence
RefSeq Acc Id:
NM_001286133 ⟹ NP_001273062
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 4,994,717 - 5,004,037 (-) NCBI HuRef 6 4,871,613 - 4,880,632 (-) NCBI CHM1_1 6 4,997,633 - 5,006,634 (-) NCBI T2T-CHM13v2.0 6 4,863,716 - 4,873,023 (-) NCBI
Sequence:
AGCGGAGGCCGGGAGGACCAGGAACCCAGGAGAGCATGGCCACGCTGCGCCGGCTTCGGGAGGC
hide sequence
RefSeq Acc Id:
NM_006638 ⟹ NP_006629
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 4,994,717 - 5,004,037 (-) NCBI GRCh37 6 4,995,280 - 5,004,292 (-) NCBI Build 36 6 4,940,279 - 4,949,270 (-) NCBI Archive Celera 6 6,224,004 - 6,232,997 (-) RGD HuRef 6 4,871,613 - 4,880,632 (-) NCBI CHM1_1 6 4,997,633 - 5,006,634 (-) NCBI T2T-CHM13v2.0 6 4,863,716 - 4,873,023 (-) NCBI
Sequence:
AGCGGAGGCCGGGAGGACCAGGAACCCAGGAGAGCATGGCCACGCTGCGCCGGCTTCGGGAGGC
hide sequence
RefSeq Acc Id:
XM_011514253 ⟹ XP_011512555
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 4,988,426 - 5,004,037 (-) NCBI
Sequence:
AGGGGCGGGGCGTGCCCCGCCAGCGGAGGCCGGGAGGACCAGGAACCCAGGAGAGCATGGCCAC
hide sequence
RefSeq Acc Id:
XM_024446309 ⟹ XP_024302077
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 4,988,426 - 5,004,037 (-) NCBI
Sequence:
AGGGGCGGGGCGTGCCCCGCCAGCGGAGGCCGGGAGGACCAGGAACCCAGGAGAGCATGGCCAC
hide sequence
RefSeq Acc Id:
XM_047418095 ⟹ XP_047274051
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 4,994,717 - 5,004,037 (-) NCBI
RefSeq Acc Id:
XM_047418096 ⟹ XP_047274052
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 4,988,426 - 5,004,037 (-) NCBI
RefSeq Acc Id:
XM_054354062 ⟹ XP_054210037
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 4,862,553 - 4,873,023 (-) NCBI
RefSeq Acc Id:
XM_054354063 ⟹ XP_054210038
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 4,863,716 - 4,873,023 (-) NCBI
RefSeq Acc Id:
XM_054354064 ⟹ XP_054210039
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 4,862,553 - 4,873,023 (-) NCBI
RefSeq Acc Id:
XM_054354065 ⟹ XP_054210040
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 4,862,553 - 4,873,023 (-) NCBI
RefSeq Acc Id:
XR_007059200
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 4,988,426 - 5,004,037 (-) NCBI
RefSeq Acc Id:
XR_008487242
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 4,855,791 - 4,873,023 (-) NCBI
RefSeq Acc Id:
XR_008487243
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 4,855,789 - 4,873,023 (-) NCBI
RefSeq Acc Id:
XR_926031
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 4,988,426 - 5,004,037 (-) NCBI
Sequence:
AGGGGCGGGGCGTGCCCCGCCAGCGGAGGCCGGGAGGACCAGGAACCCAGGAGAGCATGGCCAC
hide sequence
RefSeq Acc Id:
NP_006629 ⟸ NM_006638
- Peptide Label:
isoform a
- UniProtKB:
Q5VX97 (UniProtKB/Swiss-Prot), Q8WVK8 (UniProtKB/Swiss-Prot), O75818 (UniProtKB/Swiss-Prot), X6RLL4 (UniProtKB/TrEMBL)
- Sequence:
MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITPEFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETG
hide sequence
RefSeq Acc Id:
NP_001273061 ⟸ NM_001286132
- Peptide Label:
isoform b
- UniProtKB:
X6RLL4 (UniProtKB/TrEMBL)
- Sequence:
MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLM
hide sequence
RefSeq Acc Id:
NP_001273062 ⟸ NM_001286133
- Peptide Label:
isoform c
- UniProtKB:
A0A087X1N3 (UniProtKB/TrEMBL), X6RLL4 (UniProtKB/TrEMBL)
- Sequence:
MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITPEFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETG
hide sequence
RefSeq Acc Id:
XP_011512555 ⟸ XM_011514253
- Peptide Label:
isoform X1
- Sequence:
MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITPEFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETG
hide sequence
RefSeq Acc Id:
XP_024302077 ⟸ XM_024446309
- Peptide Label:
isoform X4
- Sequence:
MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTG
hide sequence
Ensembl Acc Id:
ENSP00000419431 ⟸ ENST00000464646
Ensembl Acc Id:
ENSP00000418874 ⟸ ENST00000479782
Ensembl Acc Id:
ENSP00000484334 ⟸ ENST00000618533
Ensembl Acc Id:
ENSP00000369391 ⟸ ENST00000380051
Ensembl Acc Id:
ENSP00000317998 ⟸ ENST00000319533
RefSeq Acc Id:
XP_047274052 ⟸ XM_047418096
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_047274051 ⟸ XM_047418095
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_054210039 ⟸ XM_054354064
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_054210040 ⟸ XM_054354065
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_054210037 ⟸ XM_054354062
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_054210038 ⟸ XM_054354063
- Peptide Label:
isoform X2
RGD ID: 6804745 Promoter ID: HG_KWN:52203 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_006638, UC003MWM.1 Position: Human Assembly Chr Position (strand) Source Build 36 6 4,949,151 - 4,949,651 (-) MPROMDB
RGD ID: 6871940 Promoter ID: EPDNEW_H9134 Type: initiation region Name: RPP40_1 Description: ribonuclease P/MRP subunit p40 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 6 5,004,027 - 5,004,087 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-12
RPP40
ribonuclease P/MRP subunit p40
ribonuclease P/MRP 40kDa subunit
Symbol and/or name change
5135510 APPROVED
