Symbol:
Mtf1
Name:
metal response element binding transcription factor 1
RGD ID:
1319032
MGI Page
MGI
Description:
Enables DNA-binding transcription factor activity; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and histone acetyltransferase binding activity. Involved in DNA-templated transcription and cellular response to zinc ion. Acts upstream of or within positive regulation of transcription by RNA polymerase II; response to cadmium ion; and response to oxidative stress. Located in cytoplasm and nucleus. Is expressed in several structures, including cardiovascular system; central nervous system; early conceptus; genitourinary system; and gut. Orthologous to human MTF1 (metal regulatory transcription factor 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
metal regulatory transcription factor 1; metal response element-binding transcription factor 1; metalloregulatory transcription factor; MRE-binding transcription factor; MTF-1; Thy; Thyls; transcription factor MTF-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Build 34 1 36,271,267 - 36,284,160 NCBI GRCm39 4 124,696,342 - 124,743,593 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 124,695,897 - 124,743,593 (+) Ensembl GRCm39 Ensembl GRCm38 4 124,802,549 - 124,849,800 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 124,802,104 - 124,849,800 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 124,479,793 - 124,527,044 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 124,304,876 - 124,349,954 (+) NCBI MGSCv36 mm8 Celera 4 123,124,096 - 123,171,046 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 57.91 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mtf1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MTF1 mRNA CTD PMID:22206623 Mtf1 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MTF1 mRNA CTD PMID:17942748 Mtf1 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of MTF1 mRNA CTD PMID:25210133 Mtf1 Mouse 17beta-estradiol increases expression ISO MTF1 (Homo sapiens) 6480464 Estradiol results in increased expression of MTF1 mRNA CTD PMID:31614463 Mtf1 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MTF1 mRNA CTD PMID:39298647 Mtf1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MTF1 mRNA CTD PMID:24058054 more ... Mtf1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to MTF1 gene] CTD PMID:28213091 Mtf1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MTF1 mRNA CTD PMID:21570461 Mtf1 Mouse 2,6-dinitrotoluene affects expression ISO Mtf1 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of MTF1 mRNA CTD PMID:21346803 Mtf1 Mouse 2-(octylamino)-1-[4-(propan-2-ylthio)phenyl]-1-propanol multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 protein affects the reaction [Suloctidil results in increased expression of MT1M mRNA] CTD PMID:32661532 Mtf1 Mouse 2-tert-butylhydroquinone multiple interactions EXP 6480464 MTF1 protein affects the reaction [2-tert-butylhydroquinone results in increased expression of MT1 mRNA] CTD PMID:14998373 Mtf1 Mouse 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MTF1 mRNA CTD PMID:18648102 Mtf1 Mouse 4,4'-sulfonyldiphenol increases activity ISO MTF1 (Homo sapiens) 6480464 bisphenol S results in increased activity of MTF1 protein CTD PMID:36534918 Mtf1 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of MTF1 mRNA CTD PMID:33297965 Mtf1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of MTF1 mRNA CTD PMID:39298647 Mtf1 Mouse [2,8-bis(trifluoromethyl)quinolin-4-yl]-(2-piperidyl)methanol multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 protein affects the reaction [Mefloquine results in increased expression of HMOX1 mRNA] and MTF1 protein affects the reaction [Mefloquine results in increased expression of MT2A mRNA] CTD PMID:32661532 Mtf1 Mouse acetamide decreases expression ISO Mtf1 (Rattus norvegicus) 6480464 acetamide results in decreased expression of MTF1 mRNA CTD PMID:31881176 Mtf1 Mouse acrylamide increases expression ISO Mtf1 (Rattus norvegicus) 6480464 Acrylamide results in increased expression of MTF1 mRNA CTD PMID:28959563 Mtf1 Mouse acrylamide increases expression ISO MTF1 (Homo sapiens) 6480464 Acrylamide results in increased expression of MTF1 mRNA CTD PMID:32763439 Mtf1 Mouse aflatoxin B1 increases methylation ISO MTF1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MTF1 gene CTD PMID:27153756 Mtf1 Mouse aflatoxin B1 decreases methylation ISO MTF1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MTF1 intron CTD PMID:30157460 Mtf1 Mouse Aflatoxin B2 alpha decreases methylation ISO MTF1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of MTF1 intron CTD PMID:30157460 Mtf1 Mouse aldosterone multiple interactions ISO Mtf1 (Rattus norvegicus) 6480464 Amlodipine inhibits the reaction [Aldosterone results in increased expression of MTF1 mRNA] more ... CTD PMID:19333130 Mtf1 Mouse aldosterone increases expression ISO Mtf1 (Rattus norvegicus) 6480464 Aldosterone results in increased expression of MTF1 mRNA and Aldosterone results in increased expression of MTF1 protein CTD PMID:19333130 Mtf1 Mouse alexidine multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 protein affects the reaction [alexidine results in increased expression of ATF3 mRNA] and MTF1 protein affects the reaction [alexidine results in increased expression of MT1M mRNA] CTD PMID:32661532 Mtf1 Mouse all-trans-retinoic acid increases expression ISO MTF1 (Homo sapiens) 6480464 Tretinoin results in increased expression of MTF1 mRNA CTD PMID:33167477 Mtf1 Mouse allethrin increases activity ISO MTF1 (Homo sapiens) 6480464 Allethrins results in increased activity of MTF1 protein CTD PMID:20143881 Mtf1 Mouse aluminium sulfate (anhydrous) decreases expression ISO MTF1 (Homo sapiens) 6480464 aluminum sulfate results in decreased expression of MTF1 mRNA CTD PMID:15961160 Mtf1 Mouse amiodarone decreases expression ISO MTF1 (Homo sapiens) 6480464 Amiodarone results in decreased expression of MTF1 mRNA CTD PMID:35641671 Mtf1 Mouse amlodipine multiple interactions ISO Mtf1 (Rattus norvegicus) 6480464 Amlodipine inhibits the reaction [Aldosterone results in increased expression of MTF1 mRNA] and Amlodipine inhibits the reaction [Aldosterone results in increased expression of MTF1 protein] CTD PMID:19333130 Mtf1 Mouse arsane multiple interactions ISO MTF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MTF1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MTF1 mRNA CTD PMID:39836092 Mtf1 Mouse arsenic atom multiple interactions ISO MTF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MTF1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MTF1 mRNA CTD PMID:39836092 Mtf1 Mouse arsenic trichloride multiple interactions EXP 6480464 arsenic trichloride promotes the reaction [MTF1 protein binds to MT1 protein] more ... CTD PMID:19276070 Mtf1 Mouse arsenic trichloride decreases response to substance EXP 6480464 MTF1 protein results in decreased susceptibility to arsenic trichloride CTD PMID:19276070 Mtf1 Mouse arsenic trichloride affects response to substance EXP 6480464 MTF1 protein affects the susceptibility to arsenic trichloride CTD PMID:19276070 Mtf1 Mouse arsenite(3-) increases degradation ISO MTF1 (Homo sapiens) 6480464 arsenite results in increased degradation of MTF1 protein CTD PMID:25493652 Mtf1 Mouse arsenite(3-) multiple interactions ISO MTF1 (Homo sapiens) 6480464 [arsenite results in increased degradation of MTF1 protein] which results in increased expression of PGF mRNA CTD PMID:25493652 Mtf1 Mouse arsenous acid affects response to substance ISO MTF1 (Homo sapiens) 6480464 MTF1 gene mutant form affects the susceptibility to Arsenic Trioxide CTD PMID:30815697 Mtf1 Mouse astemizole multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 protein affects the reaction [Astemizole results in increased expression of MT1M mRNA] CTD PMID:32661532 Mtf1 Mouse bathocuproine disulfonic acid multiple interactions EXP 6480464 bathocuproine sulfonate inhibits the reaction [[cobaltiprotoporphyrin co-treated with HPX protein] affects the localization of MTF1 protein] more ... CTD PMID:11213479 Mtf1 Mouse benzo[a]pyrene increases methylation ISO MTF1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MTF1 3' UTR CTD PMID:27901495 Mtf1 Mouse benzo[a]pyrene decreases expression ISO MTF1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MTF1 mRNA CTD PMID:35641671 Mtf1 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MTF1 mRNA CTD PMID:26063408 Mtf1 Mouse bisphenol A increases activity ISO MTF1 (Homo sapiens) 6480464 bisphenol A results in increased activity of MTF1 protein CTD PMID:36534918 Mtf1 Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of MTF1 promoter CTD PMID:27312807 Mtf1 Mouse bisphenol A decreases expression ISO Mtf1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of MTF1 mRNA CTD PMID:25181051 Mtf1 Mouse Bisphenol A diglycidyl ether increases activity ISO MTF1 (Homo sapiens) 6480464 bisphenol A diglycidyl ether results in increased activity of MTF1 protein CTD PMID:36534918 Mtf1 Mouse busulfan decreases expression ISO MTF1 (Homo sapiens) 6480464 Busulfan results in decreased expression of MTF1 mRNA CTD PMID:35641671 Mtf1 Mouse cadmium atom affects localization EXP 6480464 Cadmium affects the localization of MTF1 protein CTD PMID:20688958 Mtf1 Mouse cadmium atom affects localization ISO MTF1 (Homo sapiens) 6480464 Cadmium affects the localization of MTF1 protein CTD PMID:36980293 Mtf1 Mouse cadmium atom affects metabolic processing ISO MTF1 (Homo sapiens) 6480464 MTF1 gene SNP affects the metabolism of Cadmium CTD PMID:26529669 Mtf1 Mouse cadmium atom multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MTF1 mRNA more ... CTD PMID:22057392 more ... Mtf1 Mouse cadmium atom decreases response to substance ISO MTF1 (Homo sapiens) 6480464 MTF1 protein results in decreased susceptibility to Cadmium CTD PMID:12716893 Mtf1 Mouse cadmium atom decreases response to substance EXP 6480464 MTF1 results in decreased susceptibility to Cadmium CTD PMID:16508004 Mtf1 Mouse cadmium atom increases expression ISO MTF1 (Homo sapiens) 6480464 Cadmium results in increased expression of MTF1 mRNA CTD PMID:14568174 Mtf1 Mouse cadmium atom multiple interactions EXP 6480464 Cadmium affects the localization of and affects the activity of MTF1 protein more ... CTD PMID:10734081 more ... Mtf1 Mouse cadmium dichloride multiple interactions EXP 6480464 MTF1 gene mutant form promotes the reaction [Cadmium Chloride results in increased expression of HMOX1 mRNA] CTD PMID:23085594 Mtf1 Mouse cadmium dichloride decreases expression ISO MTF1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MTF1 mRNA CTD PMID:38568856 Mtf1 Mouse cadmium dichloride increases expression ISO Mtf1 (Rattus norvegicus) 6480464 Cadmium Chloride results in increased expression of MTF1 mRNA CTD PMID:29548726 Mtf1 Mouse cadmium dichloride increases expression ISO MTF1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MTF1 mRNA CTD PMID:27647474 and PMID:28341147 Mtf1 Mouse cadmium dichloride multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Cadmium Chloride results in decreased activity of LATS1 protein] which results in decreased phosphorylation of MTF1 protein more ... CTD PMID:24962574 more ... Mtf1 Mouse cadmium sulfate decreases response to substance EXP 6480464 MTF1 results in decreased susceptibility to cadmium sulfate CTD PMID:16221973 Mtf1 Mouse cadmium sulfate multiple interactions EXP 6480464 cadmium sulfate affects the reaction [MTF1 affects the expression of ACSF2 mRNA] more ... CTD PMID:16221973 Mtf1 Mouse cerium decreases expression ISO MTF1 (Homo sapiens) 6480464 Cerium results in decreased expression of MTF1 mRNA CTD PMID:35641671 Mtf1 Mouse chromium(6+) multiple interactions EXP 6480464 chromium hexavalent ion inhibits the reaction [Zinc promotes the reaction [MTF1 protein binds to EP300 protein]] and MTF1 protein inhibits the reaction [chromium hexavalent ion inhibits the reaction [Zinc results in increased expression of MT1 mRNA]] CTD PMID:18605988 and PMID:21467744 Mtf1 Mouse chromium(6+) decreases response to substance ISO MTF1 (Homo sapiens) 6480464 MTF1 protein results in decreased susceptibility to chromium hexavalent ion CTD PMID:12716893 Mtf1 Mouse chromium(6+) decreases activity ISO MTF1 (Homo sapiens) 6480464 chromium hexavalent ion results in decreased activity of MTF1 protein CTD PMID:12716893 Mtf1 Mouse chromium(6+) multiple interactions ISO MTF1 (Homo sapiens) 6480464 chromium hexavalent ion inhibits the reaction [MTF1 protein binds to MT1A promoter] CTD PMID:12716893 Mtf1 Mouse cisplatin multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of MTF1 mRNA CTD PMID:30871063 Mtf1 Mouse copper atom decreases response to substance ISO MTF1 (Homo sapiens) 6480464 MTF1 results in decreased susceptibility to Copper CTD PMID:15318808 Mtf1 Mouse copper atom multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of MTF1 mRNA more ... CTD PMID:22057392 more ... Mtf1 Mouse copper atom multiple interactions EXP 6480464 MTF1 protein affects the reaction [Copper results in increased activity of MT1 promoter] CTD PMID:14576086 Mtf1 Mouse copper(0) decreases response to substance ISO MTF1 (Homo sapiens) 6480464 MTF1 results in decreased susceptibility to Copper CTD PMID:15318808 Mtf1 Mouse copper(0) multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of MTF1 mRNA more ... CTD PMID:22057392 more ... Mtf1 Mouse copper(0) multiple interactions EXP 6480464 MTF1 protein affects the reaction [Copper results in increased activity of MT1 promoter] CTD PMID:14576086 Mtf1 Mouse copper(II) sulfate decreases expression ISO MTF1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MTF1 mRNA CTD PMID:20599845 Mtf1 Mouse copper(II) sulfate increases expression ISO MTF1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MTF1 mRNA CTD PMID:19549813 and PMID:20599845 Mtf1 Mouse crocidolite asbestos decreases expression ISO MTF1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of MTF1 mRNA CTD PMID:29523930 Mtf1 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of MTF1 mRNA CTD PMID:29279043 Mtf1 Mouse CU-O LINKAGE increases expression ISO MTF1 (Homo sapiens) 6480464 cupric oxide results in increased expression of MTF1 mRNA CTD PMID:22077320 Mtf1 Mouse cycloheximide multiple interactions EXP 6480464 MTF1 protein affects the reaction [Cycloheximide promotes the reaction [arsenic trichloride results in increased expression of MT1 mRNA]] and MTF1 protein affects the reaction [Cycloheximide results in increased expression of MT1 mRNA] CTD PMID:19276070 Mtf1 Mouse deoxycholic acid multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 protein affects the reaction [Deoxycholic Acid results in increased expression of ATF3 mRNA] more ... CTD PMID:32661532 Mtf1 Mouse diarsenic trioxide affects response to substance ISO MTF1 (Homo sapiens) 6480464 MTF1 gene mutant form affects the susceptibility to Arsenic Trioxide CTD PMID:30815697 Mtf1 Mouse dibutyl phthalate increases expression ISO Mtf1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of MTF1 mRNA CTD PMID:21266533 Mtf1 Mouse dicrotophos increases expression ISO MTF1 (Homo sapiens) 6480464 dicrotophos results in increased expression of MTF1 mRNA CTD PMID:28302478 Mtf1 Mouse dioxygen multiple interactions EXP 6480464 Oxygen deficiency promotes the reaction [HIF1A protein binds to MTF1 promoter] CTD PMID:22087877 Mtf1 Mouse dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of MTF1 mRNA CTD PMID:22087877 Mtf1 Mouse disulfiram multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of MTF1 mRNA more ... CTD PMID:24690739 and PMID:32661532 Mtf1 Mouse elemental selenium multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of MTF1 mRNA CTD PMID:19244175 Mtf1 Mouse ferroheme b multiple interactions EXP 6480464 [Heme co-treated with HPX protein] affects the localization of MTF1 protein and bathocuproine sulfonate inhibits the reaction [[Heme co-treated with HPX protein] affects the localization of MTF1 protein] CTD PMID:11213479 Mtf1 Mouse flutamide increases expression ISO Mtf1 (Rattus norvegicus) 6480464 Flutamide results in increased expression of MTF1 mRNA CTD PMID:24136188 Mtf1 Mouse formaldehyde decreases expression ISO MTF1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of MTF1 mRNA CTD PMID:20655997 Mtf1 Mouse gallium nitrate increases expression ISO MTF1 (Homo sapiens) 6480464 gallium nitrate results in increased expression of MTF1 mRNA CTD PMID:18586083 Mtf1 Mouse gentamycin increases expression ISO Mtf1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of MTF1 mRNA CTD PMID:33387578 Mtf1 Mouse glutathione multiple interactions EXP 6480464 Glutathione inhibits the reaction [Cadmium inhibits the reaction [Zinc results in increased activity of MTF1 protein]] CTD PMID:9507026 Mtf1 Mouse glutathione multiple interactions ISO MTF1 (Homo sapiens) 6480464 Glutathione inhibits the reaction [Cadmium inhibits the reaction [Zinc results in increased activity of MTF1 protein]] CTD PMID:9507026 Mtf1 Mouse heme b multiple interactions EXP 6480464 [Heme co-treated with HPX protein] affects the localization of MTF1 protein and bathocuproine sulfonate inhibits the reaction [[Heme co-treated with HPX protein] affects the localization of MTF1 protein] CTD PMID:11213479 Mtf1 Mouse hydrogen peroxide multiple interactions EXP 6480464 MTF1 protein affects the reaction [Hydrogen Peroxide results in increased expression of MT1 mRNA] CTD PMID:14998373 Mtf1 Mouse hydrogen peroxide decreases response to substance EXP 6480464 MTF1 results in decreased susceptibility to Hydrogen Peroxide CTD PMID:16508004 Mtf1 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MTF1 mRNA CTD PMID:36331819 Mtf1 Mouse lead diacetate affects phosphorylation ISO MTF1 (Homo sapiens) 6480464 lead acetate affects the phosphorylation of MTF1 protein CTD PMID:24962574 Mtf1 Mouse lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of MTF1 mRNA CTD PMID:19339665 Mtf1 Mouse lipopolysaccharide multiple interactions EXP 6480464 methyldithiocarbamate inhibits the reaction [Lipopolysaccharides results in increased expression of MTF1 mRNA] CTD PMID:19339665 Mtf1 Mouse manganese atom multiple interactions ISO MTF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MTF1 mRNA CTD PMID:39836092 Mtf1 Mouse manganese(0) multiple interactions ISO MTF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MTF1 mRNA CTD PMID:39836092 Mtf1 Mouse manganese(II) chloride multiple interactions ISO MTF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MTF1 mRNA CTD PMID:39836092 Mtf1 Mouse mefloquine multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 protein affects the reaction [Mefloquine results in increased expression of HMOX1 mRNA] and MTF1 protein affects the reaction [Mefloquine results in increased expression of MT2A mRNA] CTD PMID:32661532 Mtf1 Mouse mercury atom increases expression ISO MTF1 (Homo sapiens) 6480464 Mercury results in increased expression of MTF1 mRNA CTD PMID:16823088 Mtf1 Mouse mercury(0) increases expression ISO MTF1 (Homo sapiens) 6480464 Mercury results in increased expression of MTF1 mRNA CTD PMID:16823088 Mtf1 Mouse metam multiple interactions EXP 6480464 methyldithiocarbamate inhibits the reaction [Lipopolysaccharides results in increased expression of MTF1 mRNA] CTD PMID:19339665 Mtf1 Mouse methylmercury chloride decreases expression ISO MTF1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of MTF1 mRNA CTD PMID:28001369 Mtf1 Mouse N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine multiple interactions ISO MTF1 (Homo sapiens) 6480464 N more ... CTD PMID:17018880 Mtf1 Mouse N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine multiple interactions EXP 6480464 N more ... CTD PMID:21738690 Mtf1 Mouse N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO MTF1 (Homo sapiens) 6480464 N more ... CTD PMID:12756304 and PMID:12888634 Mtf1 Mouse nickel atom multiple interactions ISO MTF1 (Homo sapiens) 6480464 Nickel affects the localization of and results in increased activity of MTF1 protein CTD PMID:19097988 Mtf1 Mouse nickel sulfate increases activity EXP 6480464 nickel sulfate results in increased activity of MTF1 protein CTD PMID:19131640 Mtf1 Mouse nickel sulfate affects phosphorylation ISO MTF1 (Homo sapiens) 6480464 nickel sulfate affects the phosphorylation of MTF1 protein CTD PMID:24962574 Mtf1 Mouse nitroprusside multiple interactions ISO MTF1 (Homo sapiens) 6480464 N more ... CTD PMID:17018880 Mtf1 Mouse nitroprusside increases expression ISO MTF1 (Homo sapiens) 6480464 Nitroprusside results in increased expression of MTF1 mRNA CTD PMID:17018880 Mtf1 Mouse paraquat decreases expression ISO MTF1 (Homo sapiens) 6480464 Paraquat results in decreased expression of MTF1 mRNA CTD PMID:35641671 Mtf1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MTF1 mRNA CTD PMID:36331819 Mtf1 Mouse phenylarsine oxide affects binding EXP 6480464 oxophenylarsine binds to MTF1 protein CTD PMID:19276070 Mtf1 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of MTF1 mRNA CTD PMID:23811191 Mtf1 Mouse potassium dichromate increases expression ISO MTF1 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of MTF1 mRNA CTD PMID:11678601 Mtf1 Mouse potassium dichromate affects phosphorylation ISO MTF1 (Homo sapiens) 6480464 Potassium Dichromate affects the phosphorylation of MTF1 protein CTD PMID:24962574 Mtf1 Mouse resveratrol increases expression ISO MTF1 (Homo sapiens) 6480464 resveratrol results in increased expression of MTF1 mRNA CTD PMID:12002526 Mtf1 Mouse S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions EXP 6480464 MTF1 results in decreased susceptibility to [Buthionine Sulfoximine co-treated with cadmium sulfate] CTD PMID:16221973 Mtf1 Mouse S-butyl-DL-homocysteine (S,R)-sulfoximine decreases response to substance EXP 6480464 MTF1 results in decreased susceptibility to Buthionine Sulfoximine CTD PMID:16221973 Mtf1 Mouse S-nitroso-N-acetyl-D-penicillamine affects localization EXP 6480464 S-Nitroso-N-Acetylpenicillamine affects the localization of MTF1 protein CTD PMID:16423564 Mtf1 Mouse selenium atom multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of MTF1 mRNA CTD PMID:19244175 Mtf1 Mouse silicon dioxide decreases expression ISO MTF1 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of MTF1 mRNA CTD PMID:23623845 Mtf1 Mouse silver(1+) nitrate multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 mutant form inhibits the reaction [Silver Nitrate results in increased expression of MT1A mRNA] and MTF1 mutant form inhibits the reaction [Silver Nitrate results in increased expression of SLC30A1 mRNA] CTD PMID:19733233 Mtf1 Mouse silver(1+) nitrate increases activity ISO MTF1 (Homo sapiens) 6480464 Silver Nitrate results in increased activity of MTF1 protein CTD PMID:19733233 Mtf1 Mouse sodium arsenate increases expression EXP 6480464 sodium arsenate results in increased expression of MTF1 protein CTD PMID:11353140 Mtf1 Mouse sodium arsenite affects phosphorylation ISO MTF1 (Homo sapiens) 6480464 sodium arsenite affects the phosphorylation of MTF1 protein CTD PMID:24962574 Mtf1 Mouse sodium arsenite multiple interactions ISO MTF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MTF1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MTF1 mRNA CTD PMID:39836092 Mtf1 Mouse sodium arsenite increases expression ISO MTF1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MTF1 mRNA CTD PMID:38568856 Mtf1 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of MTF1 mRNA and sodium arsenite results in increased expression of MTF1 protein CTD PMID:11353140 and PMID:25485709 Mtf1 Mouse sodium arsenite multiple interactions EXP 6480464 MT1 gene mutant form affects the reaction [sodium arsenite results in increased expression of MTF1 mRNA] and MT2 gene mutant form affects the reaction [sodium arsenite results in increased expression of MTF1 mRNA] CTD PMID:25485709 Mtf1 Mouse sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of MTF1 mRNA CTD PMID:22155349 Mtf1 Mouse spironolactone multiple interactions ISO Mtf1 (Rattus norvegicus) 6480464 Spironolactone inhibits the reaction [Aldosterone results in increased expression of MTF1 mRNA] and Spironolactone inhibits the reaction [Aldosterone results in increased expression of MTF1 protein] CTD PMID:19333130 Mtf1 Mouse succimer multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of MTF1 mRNA CTD PMID:26378955 Mtf1 Mouse TCEP multiple interactions ISO MTF1 (Homo sapiens) 6480464 tris(2-carboxyethyl)phosphine inhibits the reaction [Cadmium promotes the reaction [MTF1 protein binds to MTF1 protein]] and tris(2-carboxyethyl)phosphine inhibits the reaction [Copper promotes the reaction [MTF1 protein binds to MTF1 protein]] CTD PMID:22057392 Mtf1 Mouse tert-butyl hydroperoxide increases response to substance ISO MTF1 (Homo sapiens) 6480464 MTF1 gene mutant form results in increased susceptibility to tert-Butylhydroperoxide CTD PMID:15378601 Mtf1 Mouse thioacetamide increases expression ISO Mtf1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of MTF1 mRNA CTD PMID:34492290 Mtf1 Mouse thiostrepton multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 protein affects the reaction [Thiostrepton results in increased expression of HMOX1 mRNA] and MTF1 protein affects the reaction [Thiostrepton results in increased expression of MT1M mRNA] CTD PMID:32661532 Mtf1 Mouse urethane increases expression ISO MTF1 (Homo sapiens) 6480464 Urethane results in increased expression of MTF1 mRNA CTD PMID:28818685 Mtf1 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of MTF1 mRNA CTD PMID:17292431 Mtf1 Mouse valproic acid affects expression ISO MTF1 (Homo sapiens) 6480464 Valproic Acid affects the expression of MTF1 mRNA CTD PMID:25979313 Mtf1 Mouse vinclozolin increases expression ISO Mtf1 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of MTF1 mRNA CTD PMID:23034163 Mtf1 Mouse vitamin E multiple interactions ISO MTF1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of MTF1 mRNA CTD PMID:19244175 Mtf1 Mouse zinc atom decreases response to substance ISO MTF1 (Homo sapiens) 6480464 MTF1 protein results in decreased susceptibility to Zinc CTD PMID:12716893 Mtf1 Mouse zinc atom increases activity EXP 6480464 Zinc results in increased activity of MTF1 protein CTD PMID:10605938 more ... Mtf1 Mouse zinc atom increases activity ISO MTF1 (Homo sapiens) 6480464 Zinc results in increased activity of MTF1 protein CTD PMID:1459136 more ... Mtf1 Mouse zinc atom affects localization EXP 6480464 Zinc affects the localization of MTF1 protein CTD PMID:15142038 more ... Mtf1 Mouse zinc atom increases expression EXP 6480464 Zinc results in increased expression of MTF1 mRNA and Zinc results in increased expression of MTF1 protein CTD PMID:22228435 Mtf1 Mouse zinc atom multiple interactions EXP 6480464 [[Zinc affects the localization of MTF1 protein] promotes the reaction [MTF1 protein binds to SLC39A13 promoter]] which results in increased expression of SLC39A13 mRNA more ... CTD PMID:10734081 more ... Mtf1 Mouse zinc atom affects binding EXP 6480464 Zinc binds to MTF1 protein CTD PMID:10734081 Mtf1 Mouse zinc atom increases expression ISO MTF1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of MTF1 mRNA more ... CTD PMID:14568174 more ... Mtf1 Mouse zinc atom increases response to substance EXP 6480464 MTF1 protein results in increased susceptibility to Zinc CTD PMID:16847313 Mtf1 Mouse zinc atom multiple interactions ISO MTF1 (Homo sapiens) 6480464 Cadmium inhibits the reaction [Zinc results in increased activity of MTF1 protein] more ... CTD PMID:1459136 more ... Mtf1 Mouse zinc dichloride multiple interactions EXP 6480464 zinc chloride results in increased phosphorylation of and results in increased activity of MTF1 protein CTD PMID:11551972 Mtf1 Mouse zinc dichloride multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 protein mutant form inhibits the reaction [zinc chloride promotes the reaction [MTF1 protein binds to MTF1 promoter]] more ... CTD PMID:35027733 Mtf1 Mouse zinc dichloride affects localization EXP 6480464 zinc chloride affects the localization of MTF1 protein CTD PMID:11551972 and PMID:16423564 Mtf1 Mouse zinc dichloride decreases expression ISO MTF1 (Homo sapiens) 6480464 zinc chloride results in decreased expression of MTF1 mRNA CTD PMID:18947441 Mtf1 Mouse zinc pyrithione multiple interactions EXP 6480464 MTF1 gene mutant form promotes the reaction [pyrithione zinc results in increased expression of HMOX1 mRNA] CTD PMID:23085594 Mtf1 Mouse zinc sulfate multiple interactions ISO MTF1 (Homo sapiens) 6480464 MTF1 mutant form inhibits the reaction [Zinc Sulfate results in increased expression of SLC30A1 mRNA] more ... CTD PMID:16460681 more ... Mtf1 Mouse zinc sulfate increases expression EXP 6480464 Zinc Sulfate results in increased expression of MTF1 protein CTD PMID:11213479 Mtf1 Mouse zinc sulfate increases expression ISO MTF1 (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of MTF1 mRNA and Zinc Sulfate results in increased expression of MTF1 protein CTD PMID:17018880 and PMID:25162517 Mtf1 Mouse zinc sulfate increases activity ISO MTF1 (Homo sapiens) 6480464 Zinc Sulfate results in increased activity of MTF1 protein CTD PMID:16460681 Mtf1 Mouse zinc(0) decreases response to substance ISO MTF1 (Homo sapiens) 6480464 MTF1 protein results in decreased susceptibility to Zinc CTD PMID:12716893 Mtf1 Mouse zinc(0) multiple interactions ISO MTF1 (Homo sapiens) 6480464 Cadmium inhibits the reaction [Zinc results in increased activity of MTF1 protein] more ... CTD PMID:1459136 more ... Mtf1 Mouse zinc(0) increases response to substance EXP 6480464 MTF1 protein results in increased susceptibility to Zinc CTD PMID:16847313 Mtf1 Mouse zinc(0) increases expression ISO MTF1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of MTF1 mRNA more ... CTD PMID:14568174 more ... Mtf1 Mouse zinc(0) affects binding EXP 6480464 Zinc binds to MTF1 protein CTD PMID:10734081 Mtf1 Mouse zinc(0) multiple interactions EXP 6480464 [[Zinc affects the localization of MTF1 protein] promotes the reaction [MTF1 protein binds to SLC39A13 promoter]] which results in increased expression of SLC39A13 mRNA more ... CTD PMID:10734081 more ... Mtf1 Mouse zinc(0) increases expression EXP 6480464 Zinc results in increased expression of MTF1 mRNA and Zinc results in increased expression of MTF1 protein CTD PMID:22228435 Mtf1 Mouse zinc(0) affects localization EXP 6480464 Zinc affects the localization of MTF1 protein CTD PMID:15142038 more ... Mtf1 Mouse zinc(0) increases activity ISO MTF1 (Homo sapiens) 6480464 Zinc results in increased activity of MTF1 protein CTD PMID:1459136 more ... Mtf1 Mouse zinc(0) increases activity EXP 6480464 Zinc results in increased activity of MTF1 protein CTD PMID:10605938 more ...
1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,6-dinitrotoluene (ISO) 2-(octylamino)-1-[4-(propan-2-ylthio)phenyl]-1-propanol (ISO) 2-tert-butylhydroquinone (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) [2,8-bis(trifluoromethyl)quinolin-4-yl]-(2-piperidyl)methanol (ISO) acetamide (ISO) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldosterone (ISO) alexidine (ISO) all-trans-retinoic acid (ISO) allethrin (ISO) aluminium sulfate (anhydrous) (ISO) amiodarone (ISO) amlodipine (ISO) arsane (ISO) arsenic atom (ISO) arsenic trichloride (EXP) arsenite(3-) (ISO) arsenous acid (ISO) astemizole (ISO) bathocuproine disulfonic acid (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) busulfan (ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (EXP) cerium (ISO) chromium(6+) (EXP,ISO) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) crocidolite asbestos (EXP,ISO) CU-O LINKAGE (ISO) cycloheximide (EXP) deoxycholic acid (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dioxygen (EXP) disulfiram (ISO) elemental selenium (ISO) ferroheme b (EXP) flutamide (ISO) formaldehyde (ISO) gallium nitrate (ISO) gentamycin (ISO) glutathione (EXP,ISO) heme b (EXP) hydrogen peroxide (EXP) inulin (EXP) lead diacetate (ISO) lipopolysaccharide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mefloquine (ISO) mercury atom (ISO) mercury(0) (ISO) metam (EXP) methylmercury chloride (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (EXP,ISO) nickel atom (ISO) nickel sulfate (EXP,ISO) nitroprusside (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (EXP) phenylarsine oxide (EXP) pirinixic acid (EXP) potassium dichromate (ISO) resveratrol (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) S-nitroso-N-acetyl-D-penicillamine (EXP) selenium atom (ISO) silicon dioxide (ISO) silver(1+) nitrate (ISO) sodium arsenate (EXP) sodium arsenite (EXP,ISO) sodium dichromate (EXP) spironolactone (ISO) succimer (ISO) TCEP (ISO) tert-butyl hydroperoxide (ISO) thioacetamide (ISO) thiostrepton (ISO) urethane (ISO) valproic acid (EXP,ISO) vinclozolin (ISO) vitamin E (ISO) zinc atom (EXP,ISO) zinc dichloride (EXP,ISO) zinc pyrithione (EXP) zinc sulfate (EXP,ISO) zinc(0) (EXP,ISO)
Mtf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Build 34 1 36,271,267 - 36,284,160 NCBI GRCm39 4 124,696,342 - 124,743,593 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 124,695,897 - 124,743,593 (+) Ensembl GRCm39 Ensembl GRCm38 4 124,802,549 - 124,849,800 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 124,802,104 - 124,849,800 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 124,479,793 - 124,527,044 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 124,304,876 - 124,349,954 (+) NCBI MGSCv36 mm8 Celera 4 123,124,096 - 123,171,046 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 57.91 NCBI
MTF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 37,809,574 - 37,859,592 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 37,809,574 - 37,859,592 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 38,275,246 - 38,325,264 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 38,047,826 - 38,097,879 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 37,948,943 - 37,994,324 NCBI Celera 1 36,553,063 - 36,603,115 (-) NCBI Celera Cytogenetic Map 1 p34.3 NCBI HuRef 1 36,393,522 - 36,443,287 (-) NCBI HuRef CHM1_1 1 38,391,063 - 38,441,086 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 37,676,462 - 37,726,477 (-) NCBI T2T-CHM13v2.0
Mtf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 142,347,024 - 142,391,810 (+) NCBI GRCr8 mRatBN7.2 5 137,062,319 - 137,107,136 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 137,062,376 - 137,107,136 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 139,767,233 - 139,812,075 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 141,537,246 - 141,582,093 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 141,544,424 - 141,589,269 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 142,797,340 - 142,843,896 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 142,797,366 - 142,842,122 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 142,332,607 - 142,376,370 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 146,567,984 - 146,614,540 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 144,135,674 - 144,180,430 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 144,145,451 - 144,187,287 (+) NCBI Celera 5 135,585,105 - 135,629,881 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
Mtf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 15,580,460 - 15,627,844 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 15,580,460 - 15,627,844 (-) NCBI ChiLan1.0 ChiLan1.0
MTF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 188,977,327 - 189,027,954 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 188,106,469 - 188,152,667 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 37,088,744 - 37,134,318 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 38,432,716 - 38,482,142 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 38,438,294 - 38,482,142 (-) Ensembl panpan1.1 panPan2
MTF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 4,679,945 - 4,723,111 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 4,680,372 - 4,717,561 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 4,921,849 - 4,965,016 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 4,808,453 - 4,851,650 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 4,808,870 - 4,846,324 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 4,668,306 - 4,711,440 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 4,734,863 - 4,777,974 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 4,751,184 - 4,794,296 (+) NCBI UU_Cfam_GSD_1.0
Mtf1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 54,160,425 - 54,202,806 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 19,981,466 - 20,027,536 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 19,981,483 - 20,027,541 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MTF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 93,839,205 - 93,884,409 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 93,837,195 - 93,884,427 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 86,652,512 - 86,655,135 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MTF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 95,002,623 - 95,052,366 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 95,003,504 - 95,046,718 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 21,758,719 - 21,810,019 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mtf1
.
Predicted Target Of
Count of predictions: 5139 Count of miRNA genes: 890 Interacting mature miRNAs: 1271 Transcripts: ENSMUST00000030723, ENSMUST00000106193, ENSMUST00000138807, ENSMUST00000147452, ENSMUST00000175875 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142139 Adip12_m adiposity 12 (mouse) Not determined 4 124621281 156860686 Mouse 10047132 Albq19_m albuminuria QTL 19 (mouse) Not determined 4 112824389 146824389 Mouse 12904002 Opfaq9_m open field activity QTL 9 (mouse) 4 92975790 126975790 Mouse 1301525 Lmb1_m lupus in MRL and B6 F2 cross (mouse) Not determined 4 124264957 150676858 Mouse 14746982 Manh56_m mandible shape 56 (mouse) 4 117815917 151815917 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 14696689 Gdq2_m grooming duration QTL 2, females (mouse) 4 100857197 124893793 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 1302149 Tlsr2_m thymic lymphoma suppressor region 2 (mouse) Not determined 4 124264957 142230960 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 27226757 Femd1_m femur midshaft diameter 1, 5 week (mouse) 4 123993793 144326570 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 4142493 Femwf13_m femur work to failure 13 (mouse) Not determined 116154678 150154782 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300917 Gasa1_m gastritis type A susceptibility locus 1 (mouse) Not determined 4 124055093 142438020 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 10412210 Cypr6_m cytokine production 6 (mouse) Not determined 4 120617848 154617995 Mouse 1302078 Sluc21_m susceptibility to lung cancer 21 (mouse) Not determined 4 117401141 151401275 Mouse 10412072 Ssen1_m suseptibility to Sendai virus 1 (mouse) Not determined 4 109658132 133154782 Mouse 4141065 Shali2_m survival time to hyperoxic acute lung injury 2 (mouse) Not determined 124055093 141572792 Mouse 13503348 Bntq18_m bone traits QTL 18 (mouse) 4 120617848 154617995 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 13208565 Bmiq6_m body mass index QTL 6 (mouse) 4 110857197 125893793 Mouse 1300655 Nidds_m non-insulin-dependent diabetes mellitus in SJL (mouse) Not determined 4 115030777 129465915 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 4141180 Ssic1_m susceptibility to small intestinal cancer 1 (mouse) Not determined 120674005 154674151 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 1302102 Bis1_m beta-carboline-induced seizures 1 (mouse) Not determined 4 119864433 153864536 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 10043985 Stheal12_m soft tissue heal 12 (mouse) Not determined 4 121342649 155342753 Mouse 1301982 Pltiq1_m phospholipid transfer protein inducibility QTL 1 (mouse) Not determined 4 124621281 156860686 Mouse 1301597 Anxty_m anxiety (mouse) Not determined 4 74137574 128009280 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 1300803 Sluc6_m susceptibility to lung cancer 6 (mouse) Not determined 4 120674005 154674151 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 4142061 Chlq16_m circulating hormone level QTL 16 (mouse) Not determined 4 121342649 155342753 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 1301964 Bw8q2_m body weight at 8 weeks QTL 2 (mouse) Not determined 4 119864433 153864536 Mouse 1301452 Elsgp1_m elevated serum gp70 1 (mouse) Not determined 4 121342649 155342753 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 1301233 Sbw2_m splenomegaly-NZB x NZW 2 (mouse) Not determined 4 94957579 128009280 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 1300858 Tafat_m tally ho associated mesenteric fat pad weight (mouse) Not determined 4 124621281 156860686 Mouse 15039368 Nmrs19_m NAFLD-associated magnetic resonance shift 19 (mouse) 4 90882780 124882780 Mouse 10755531 Lymph3_m lymphocyte differential 3 (mouse) 4 124553483 156860686 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 1301731 Cafq2_m caffeine metabolism QTL 2 (mouse) Not determined 4 94732255 128732454 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 4141001 Tgq17_m triglyceride QTL 17 (mouse) Not determined 112523489 146523489 Mouse 1300580 Lbw2_m lupus NZB x NZW 2 (mouse) Not determined 4 98545539 128009280 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27095905 Scvln3_m sacral vertebrae length 2, 5 week (mouse) 4 55600000 128993793 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 15039385 Mvlq3_m macrovesicular liver lesion QTL 3 (mouse) 4 112182386 146182386 Mouse
AW260155
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 124,801,155 - 124,801,260 UniSTS GRCm38 MGSCv37 4 124,478,399 - 124,478,504 UniSTS GRCm37 Celera 4 123,122,702 - 123,122,807 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 4 D2 UniSTS cM Map 4 58.3 UniSTS cM Map 4 56.0 UniSTS Whitehead/MRC_RH 4 1610.98 UniSTS
AF040094
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 124,801,331 - 124,801,415 UniSTS GRCm38 MGSCv37 4 124,478,575 - 124,478,659 UniSTS GRCm37 Celera 4 123,122,878 - 123,122,962 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 4 D2 UniSTS cM Map 4 58.3 UniSTS cM Map 4 56.0 UniSTS Whitehead/MRC_RH 4 1610.41 UniSTS
D4Mit12
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 124,371,164 - 124,371,360 UniSTS GRCm38 MGSCv37 4 124,048,407 - 124,048,603 UniSTS GRCm37 Celera 4 122,696,921 - 122,697,085 UniSTS Cytogenetic Map 4 D1 UniSTS cM Map 4 57.6 UniSTS Whitehead Genetic 4 54.6 UniSTS Whitehead_YAC 4 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000030723 ⟹ ENSMUSP00000030723
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 124,696,342 - 124,743,593 (+) Ensembl GRCm38.p6 Ensembl 4 124,802,549 - 124,849,800 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000106193 ⟹ ENSMUSP00000101799
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 124,695,897 - 124,743,172 (+) Ensembl GRCm38.p6 Ensembl 4 124,802,104 - 124,849,379 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000138807 ⟹ ENSMUSP00000119352
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 124,696,342 - 124,714,020 (+) Ensembl GRCm38.p6 Ensembl 4 124,802,549 - 124,820,227 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147452
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 124,696,375 - 124,699,171 (+) Ensembl GRCm38.p6 Ensembl 4 124,802,582 - 124,805,378 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000175875 ⟹ ENSMUSP00000135260
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 124,696,471 - 124,698,533 (+) Ensembl GRCm38.p6 Ensembl 4 124,802,678 - 124,804,740 (+) Ensembl
RefSeq Acc Id:
NM_008636 ⟹ NP_032662
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 124,696,342 - 124,743,593 (+) NCBI GRCm38 4 124,802,549 - 124,849,800 (+) NCBI MGSCv37 4 124,479,793 - 124,527,044 (+) RGD Celera 4 123,124,096 - 123,171,046 (+) RGD cM Map 4 ENTREZGENE
Sequence:
GAAGCGGAAGTGACGCTAGGGACAGGTGGGGGCAATCATGGTGCCGCTTGGGAGGGGAGAAGCTGCTGCTGCCGCCGTTGCCGGGAGCCGCGGAGAAAGGCCGTTACCTTTCCATTTCTCACAATTGG
hide sequence
RefSeq Acc Id:
NP_032662 ⟸ NM_008636
- UniProtKB:
Q9JJW8 (UniProtKB/Swiss-Prot), Q07243 (UniProtKB/Swiss-Prot), Q8BSY2 (UniProtKB/TrEMBL)
- Sequence:
MGEHSPDDNIIFFKGEEDDLTPHDKMLRFVDDNGLVPSSSGTVYDRTTVLIEQDPGTLEDDEDDGQCGEPLPFLVEGEEGFLIDQEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSEC
hide sequence
Ensembl Acc Id:
ENSMUSP00000119352 ⟸ ENSMUST00000138807
Ensembl Acc Id:
ENSMUSP00000101799 ⟸ ENSMUST00000106193
Ensembl Acc Id:
ENSMUSP00000030723 ⟸ ENSMUST00000030723
Ensembl Acc Id:
ENSMUSP00000135260 ⟸ ENSMUST00000175875
RGD ID: 6835711 Promoter ID: MM_KWN:39575 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000106193, NM_008636, OTTMUST00000020736, UC008URA.1, UC008URC.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 124,479,399 - 124,479,899 (+) MPROMDB
RGD ID: 6884590 Promoter ID: EPDNEW_M5746 Type: multiple initiation site Name: Mtf1_1 Description: Mus musculus metal response element binding transcription factor1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 124,802,582 - 124,802,642 EPDNEW
