Symbol:
Tenm3
Name:
teneurin transmembrane protein 3
RGD ID:
1315372
MGI Page
MGI
Description:
Enables protein heterodimerization activity and protein homodimerization activity. Involved in several processes, including homophilic cell adhesion via plasma membrane adhesion molecules; regulation of homophilic cell adhesion; and synaptic membrane adhesion. Located in plasma membrane. Is active in glutamatergic synapse and presynaptic active zone membrane. Is expressed in several structures, including alimentary system; branchial arch; genitourinary system; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in cocaine dependence. Orthologous to human TENM3 (teneurin transmembrane protein 3).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2610100B16Rik; mKIAA1455; odd Oz/ten-m homolog 3; Odz; Odz1; Odz3; ten-3; Ten-m; Ten-m3; tenascin-M3; teneurin-3; teneurin-3 transcript variant A0B0; teneurin-3 transcript variant A0B1; teneurin-3 transcript variant A1B0; teneurin-3 transcript variant A1B1; teneurin-3 transcript variant A2B0; teneurin-3 transcript variant A2B1; teneurin-3 transcript variant A3B0; teneurin-3 transcript variant A3B1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TENM3 (teneurin transmembrane protein 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Tenm3 (teneurin transmembrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tenm3 (teneurin transmembrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TENM3 (teneurin transmembrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TENM3 (teneurin transmembrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tenm3 (teneurin transmembrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TENM3 (teneurin transmembrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TENM3 (teneurin transmembrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tenm3 (teneurin transmembrane protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TENM2 (teneurin transmembrane protein 2) HGNC
OrthoMCL
Homo sapiens (human):
TENM4 (teneurin transmembrane protein 4) HGNC
OrthoMCL
Homo sapiens (human):
TENM1 (teneurin transmembrane protein 1) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tenm3 (teneurin transmembrane protein 3)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TENM3 (teneurin transmembrane protein 3)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-237h12.3
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
tenm3 (teneurin transmembrane protein 3)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ten-a
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ten-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ten-m
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tenm2
Alliance
DIOPT (OMA|OrthoFinder)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 48,678,700 - 51,370,255 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 48,680,717 - 49,296,986 (-) Ensembl GRCm39 Ensembl GRCm38 8 48,225,665 - 49,522,824 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 48,227,682 - 48,843,951 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 49,311,019 - 49,760,044 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 49,726,501 - 50,173,507 (-) NCBI MGSCv36 mm8 Celera 8 50,895,477 - 51,344,899 (-) NCBI Celera Cytogenetic Map 8 B1.2- B1.3 NCBI cM Map 8 27.02 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tenm3 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of TENM3 mRNA CTD PMID:28960355 Tenm3 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of TENM3 mRNA CTD PMID:22206623 Tenm3 Mouse 17beta-estradiol multiple interactions ISO RGD:1315371 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of TENM3 mRNA CTD PMID:19619570 Tenm3 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TENM3 mRNA CTD PMID:39298647 Tenm3 Mouse 17beta-estradiol decreases expression ISO RGD:1315371 6480464 Estradiol results in decreased expression of TENM3 mRNA CTD PMID:19619570|PMID:21185374 Tenm3 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl decreases expression ISO RGD:1315371 6480464 2,4,5,2',4',5'-hexachlorobiphenyl results in decreased expression of TENM3 mRNA CTD PMID:23146750 Tenm3 Mouse 2,3',4,4',5-Pentachlorobiphenyl decreases expression EXP 6480464 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of TENM3 mRNA CTD PMID:31388691 Tenm3 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1315371 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of TENM3 mRNA CTD PMID:19619570 Tenm3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1306641 6480464 Tetrachlorodibenzodioxin results in decreased expression of TENM3 mRNA CTD PMID:33387578 Tenm3 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1306641 6480464 Tetrachlorodibenzodioxin results in increased expression of TENM3 mRNA CTD PMID:34747641 Tenm3 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1306641 6480464 Tetrachlorodibenzodioxin affects the expression of TENM3 mRNA CTD PMID:22298810 Tenm3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1315371 6480464 Tetrachlorodibenzodioxin results in decreased expression of TENM3 mRNA CTD PMID:19619570 Tenm3 Mouse 2,4,6-tribromophenol increases expression ISO RGD:1315371 6480464 2,4,6-tribromophenol results in increased expression of TENM3 mRNA CTD PMID:31675489 Tenm3 Mouse 2-bromohexadecanoic acid multiple interactions ISO RGD:1315371 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Tenm3 Mouse 2-methylcholine affects expression ISO RGD:1315371 6480464 beta-methylcholine affects the expression of TENM3 mRNA CTD PMID:21179406 Tenm3 Mouse 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO RGD:1315371 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of TENM3 mRNA CTD PMID:23146750 Tenm3 Mouse 3,3',5,5'-tetrabromobisphenol A increases expression ISO RGD:1315371 6480464 tetrabromobisphenol A results in increased expression of TENM3 protein CTD PMID:31675489 Tenm3 Mouse 4,4'-diaminodiphenylmethane affects expression EXP 6480464 4,4'-diaminodiphenylmethane affects the expression of TENM3 mRNA CTD PMID:18648102 Tenm3 Mouse 4,4'-sulfonyldiphenol decreases expression ISO RGD:1315371 6480464 bisphenol S results in decreased expression of TENM3 mRNA CTD PMID:25912373 Tenm3 Mouse 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1315371 6480464 bisphenol S results in decreased methylation of TENM3 gene CTD PMID:31601247 Tenm3 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of TENM3 exon CTD PMID:33297965 Tenm3 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of TENM3 mRNA CTD PMID:39298647 Tenm3 Mouse 6-propyl-2-thiouracil increases expression ISO RGD:1306641 6480464 Propylthiouracil results in increased expression of TENM3 mRNA CTD PMID:24780913 Tenm3 Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:1306641 6480464 Propylthiouracil results in decreased expression of TENM3 mRNA CTD PMID:30047161 Tenm3 Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of TENM3 mRNA CTD PMID:19770486 Tenm3 Mouse aflatoxin B1 increases methylation ISO RGD:1315371 6480464 Aflatoxin B1 results in increased methylation of TENM3 gene; Aflatoxin B1 results in increased methylation more ... CTD PMID:27153756|PMID:30157460 Tenm3 Mouse all-trans-retinoic acid decreases expression ISO RGD:1315371 6480464 Tretinoin results in decreased expression of TENM3 mRNA CTD PMID:21934132 Tenm3 Mouse alpha-Zearalanol multiple interactions ISO RGD:1306641 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TENM3 mRNA CTD PMID:35163327 Tenm3 Mouse amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of TENM3 mRNA CTD PMID:24535564 Tenm3 Mouse antirheumatic drug increases expression ISO RGD:1315371 6480464 Antirheumatic Agents results in increased expression of TENM3 mRNA CTD PMID:24449571 Tenm3 Mouse aristolochic acid A decreases expression ISO RGD:1315371 6480464 aristolochic acid I results in decreased expression of TENM3 mRNA CTD PMID:33212167 Tenm3 Mouse arsane multiple interactions ISO RGD:1315371 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Tenm3 Mouse arsenic atom multiple interactions ISO RGD:1315371 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Tenm3 Mouse arsenite(3-) multiple interactions ISO RGD:1315371 6480464 arsenite inhibits the reaction [G3BP1 protein binds to TENM3 mRNA] CTD PMID:32406909 Tenm3 Mouse atrazine affects methylation ISO RGD:1306641 6480464 Atrazine affects the methylation of TENM3 gene CTD PMID:35440735 Tenm3 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of TENM3 mRNA CTD PMID:19770486 Tenm3 Mouse benzo[a]pyrene decreases methylation ISO RGD:1315371 6480464 Benzo(a)pyrene results in decreased methylation of TENM3 3' UTR; Benzo(a)pyrene results in decreased methylation of more ... CTD PMID:27901495 Tenm3 Mouse benzo[a]pyrene affects methylation ISO RGD:1315371 6480464 Benzo(a)pyrene affects the methylation of TENM3 intron CTD PMID:30157460 Tenm3 Mouse benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of TENM3 intron CTD PMID:27901495 Tenm3 Mouse benzo[a]pyrene increases expression ISO RGD:1306641 6480464 Benzo(a)pyrene results in increased expression of TENM3 mRNA CTD PMID:21839799 Tenm3 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1315371 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of TENM3 mRNA CTD PMID:20382639 Tenm3 Mouse benzo[e]pyrene increases methylation ISO RGD:1315371 6480464 benzo(e)pyrene results in increased methylation of TENM3 3' UTR CTD PMID:30157460 Tenm3 Mouse bis(2-chloroethyl) sulfide increases expression EXP 6480464 Mustard Gas results in increased expression of TENM3 mRNA CTD PMID:15674844 Tenm3 Mouse bisphenol A decreases expression ISO RGD:1315371 6480464 bisphenol A results in decreased expression of TENM3 mRNA CTD PMID:23146750 Tenm3 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TENM3 mRNA CTD PMID:32156529 Tenm3 Mouse bisphenol A multiple interactions ISO RGD:1315371 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TENM3 gene CTD PMID:31601247 Tenm3 Mouse bisphenol A increases expression ISO RGD:1306641 6480464 bisphenol A results in increased expression of TENM3 mRNA CTD PMID:30816183 Tenm3 Mouse bisphenol A increases methylation ISO RGD:1306641 6480464 bisphenol A results in increased methylation of TENM3 gene CTD PMID:28505145 Tenm3 Mouse bisphenol A decreases expression ISO RGD:1306641 6480464 bisphenol A results in decreased expression of TENM3 mRNA CTD PMID:25181051 Tenm3 Mouse bisphenol AF decreases expression ISO RGD:1315371 6480464 bisphenol AF results in decreased expression of TENM3 mRNA CTD PMID:25912373 Tenm3 Mouse bisphenol F decreases methylation ISO RGD:1315371 6480464 bisphenol F results in decreased methylation of TENM3 gene CTD PMID:31601247 Tenm3 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of TENM3 mRNA CTD PMID:38685157 Tenm3 Mouse bisphenol F multiple interactions ISO RGD:1315371 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of TENM3 gene CTD PMID:31601247 Tenm3 Mouse butanal decreases expression ISO RGD:1315371 6480464 butyraldehyde results in decreased expression of TENM3 mRNA CTD PMID:26079696 Tenm3 Mouse cadmium atom multiple interactions ISO RGD:1315371 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:35301059|PMID:38195004 Tenm3 Mouse cadmium dichloride multiple interactions ISO RGD:1315371 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:35301059|PMID:38195004 Tenm3 Mouse calcitriol decreases expression ISO RGD:1315371 6480464 Calcitriol results in decreased expression of TENM3 mRNA CTD PMID:26485663 Tenm3 Mouse CGP 52608 multiple interactions ISO RGD:1315371 6480464 CGP 52608 promotes the reaction [RORA protein binds to TENM3 gene] CTD PMID:28238834 Tenm3 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of TENM3 mRNA CTD PMID:32715474 Tenm3 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Tenm3 Mouse chromium(6+) multiple interactions ISO RGD:1315371 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 Tenm3 Mouse cisplatin decreases expression ISO RGD:1315371 6480464 Cisplatin results in decreased expression of TENM3 mRNA CTD PMID:27392435 Tenm3 Mouse cisplatin multiple interactions ISO RGD:1315371 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of TENM3 mRNA CTD PMID:27392435 Tenm3 Mouse clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of TENM3 mRNA CTD PMID:23811191 Tenm3 Mouse cobalt dichloride decreases expression ISO RGD:1306641 6480464 cobaltous chloride results in decreased expression of TENM3 mRNA CTD PMID:24386269 Tenm3 Mouse cocaine affects response to substance ISO RGD:1315371 6480464 TENM3 gene SNP affects the susceptibility to Cocaine CTD PMID:18438686 Tenm3 Mouse decabromodiphenyl ether increases expression ISO RGD:1315371 6480464 decabromobiphenyl ether results in increased expression of TENM3 protein CTD PMID:31675489 Tenm3 Mouse dichloroacetic acid increases expression EXP 6480464 Dichloroacetic Acid results in increased expression of TENM3 mRNA CTD PMID:28962523 Tenm3 Mouse dioxygen multiple interactions ISO RGD:1306641 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression more ... CTD PMID:33729688 Tenm3 Mouse doxorubicin decreases expression ISO RGD:1315371 6480464 Doxorubicin results in decreased expression of TENM3 mRNA CTD PMID:29803840 Tenm3 Mouse endosulfan decreases expression ISO RGD:1306641 6480464 Endosulfan results in decreased expression of TENM3 mRNA CTD PMID:29391264 Tenm3 Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of TENM3 mRNA CTD PMID:35436446 Tenm3 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of TENM3 mRNA CTD PMID:30319688 Tenm3 Mouse fenvalerate increases expression ISO RGD:1306641 6480464 fenvalerate results in increased expression of TENM3 mRNA CTD PMID:30307764 Tenm3 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Tenm3 Mouse fulvestrant multiple interactions ISO RGD:1315371 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TENM3 gene; [bisphenol F co-treated more ... CTD PMID:31601247 Tenm3 Mouse furan increases expression ISO RGD:1306641 6480464 furan results in increased expression of TENM3 mRNA CTD PMID:27387713 Tenm3 Mouse glyphosate affects methylation ISO RGD:1306641 6480464 Glyphosate affects the methylation of TENM3 gene CTD PMID:35440735 Tenm3 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Tenm3 Mouse lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of TENM3 mRNA CTD PMID:25270620 Tenm3 Mouse manganese atom multiple interactions ISO RGD:1315371 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Tenm3 Mouse manganese(0) multiple interactions ISO RGD:1315371 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Tenm3 Mouse manganese(II) chloride increases expression ISO RGD:1306641 6480464 manganese chloride results in increased expression of TENM3 mRNA CTD PMID:28801915 Tenm3 Mouse manganese(II) chloride multiple interactions ISO RGD:1315371 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Tenm3 Mouse menadione affects expression ISO RGD:1315371 6480464 Vitamin K 3 affects the expression of TENM3 mRNA CTD PMID:20044591 Tenm3 Mouse methapyrilene increases methylation ISO RGD:1315371 6480464 Methapyrilene results in increased methylation of TENM3 3' UTR CTD PMID:30157460 Tenm3 Mouse methimazole decreases expression ISO RGD:1306641 6480464 Methimazole results in decreased expression of TENM3 mRNA CTD PMID:30047161 Tenm3 Mouse methoxychlor affects methylation ISO RGD:1306641 6480464 Methoxychlor affects the methylation of TENM3 gene CTD PMID:35440735 Tenm3 Mouse N,N-diethyl-m-toluamide multiple interactions ISO RGD:1306641 6480464 [Permethrin co-treated with DEET] results in increased methylation of TENM3 gene CTD PMID:33148267 Tenm3 Mouse nickel sulfate decreases expression ISO RGD:1315371 6480464 nickel sulfate results in decreased expression of TENM3 mRNA CTD PMID:22714537 Tenm3 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of TENM3 mRNA CTD PMID:17562736 Tenm3 Mouse paracetamol decreases expression ISO RGD:1306641 6480464 Acetaminophen results in decreased expression of TENM3 mRNA CTD PMID:33387578 Tenm3 Mouse paracetamol increases expression ISO RGD:1315371 6480464 Acetaminophen results in increased expression of TENM3 mRNA CTD PMID:29067470 Tenm3 Mouse perfluorooctanoic acid decreases expression ISO RGD:1315371 6480464 perfluorooctanoic acid results in decreased expression of TENM3 mRNA CTD PMID:23146750 Tenm3 Mouse perfluorooctanoic acid multiple interactions ISO RGD:1306641 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TENM3 mRNA CTD PMID:35163327 Tenm3 Mouse permethrin multiple interactions ISO RGD:1306641 6480464 [Permethrin co-treated with DEET] results in increased methylation of TENM3 gene CTD PMID:33148267 Tenm3 Mouse phenobarbital multiple interactions EXP 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of TENM3 mRNA] CTD PMID:19482888 Tenm3 Mouse phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of TENM3 mRNA CTD PMID:23091169 Tenm3 Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of TENM3 mRNA CTD PMID:19482888 Tenm3 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Tenm3 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of TENM3 mRNA CTD PMID:18301758|PMID:20813756|PMID:23811191 Tenm3 Mouse silver atom decreases expression EXP 6480464 Silver results in decreased expression of TENM3 mRNA CTD PMID:27131904 Tenm3 Mouse silver(0) decreases expression EXP 6480464 Silver results in decreased expression of TENM3 mRNA CTD PMID:27131904 Tenm3 Mouse sodium arsenate increases expression EXP 6480464 sodium arsenate results in increased expression of TENM3 mRNA CTD PMID:21795629 Tenm3 Mouse sodium arsenite decreases expression ISO RGD:1315371 6480464 sodium arsenite results in decreased expression of TENM3 mRNA CTD PMID:22714537 Tenm3 Mouse sodium arsenite multiple interactions ISO RGD:1315371 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Tenm3 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of TENM3 mRNA CTD PMID:25270620 Tenm3 Mouse sulfadimethoxine decreases expression ISO RGD:1306641 6480464 Sulfadimethoxine results in decreased expression of TENM3 mRNA CTD PMID:30047161 Tenm3 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TENM3 mRNA CTD PMID:27339419|PMID:31919559 Tenm3 Mouse tetrachloromethane increases expression ISO RGD:1306641 6480464 Carbon Tetrachloride results in increased expression of TENM3 mRNA CTD PMID:31150632 Tenm3 Mouse thiram increases expression ISO RGD:1315371 6480464 Thiram results in increased expression of TENM3 mRNA CTD PMID:38568856 Tenm3 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of TENM3 mRNA CTD PMID:29264374 Tenm3 Mouse tris(2-butoxyethyl) phosphate affects expression ISO RGD:1315371 6480464 tris(2-butoxyethyl) phosphate affects the expression of TENM3 mRNA CTD PMID:29024780 Tenm3 Mouse triticonazole decreases expression ISO RGD:1306641 6480464 triticonazole results in decreased expression of TENM3 mRNA CTD PMID:36084822 Tenm3 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of TENM3 mRNA CTD PMID:17292431 Tenm3 Mouse valproic acid decreases expression ISO RGD:1306641 6480464 Valproic Acid results in decreased expression of TENM3 mRNA CTD PMID:33150595 Tenm3 Mouse valproic acid increases methylation ISO RGD:1306641 6480464 Valproic Acid results in increased methylation of TENM3 promoter CTD PMID:33150595 Tenm3 Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of TENM3 mRNA CTD PMID:24535564 Tenm3 Mouse valproic acid increases methylation ISO RGD:1315371 6480464 Valproic Acid results in increased methylation of TENM3 gene CTD PMID:29154799 Tenm3 Mouse valproic acid affects expression ISO RGD:1315371 6480464 Valproic Acid affects the expression of TENM3 mRNA CTD PMID:25979313 Tenm3 Mouse vorinostat decreases expression ISO RGD:1315371 6480464 vorinostat results in decreased expression of TENM3 mRNA CTD PMID:27188386
1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2-bromohexadecanoic acid (ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (ISO) amiodarone (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bis(2-chloroethyl) sulfide (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) choline (EXP) chromium(6+) (ISO) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (ISO) cocaine (ISO) decabromodiphenyl ether (ISO) dichloroacetic acid (EXP) dioxygen (ISO) doxorubicin (ISO) endosulfan (ISO) epoxiconazole (EXP) ethanol (EXP) fenvalerate (ISO) folic acid (EXP) fulvestrant (ISO) furan (ISO) glyphosate (ISO) L-methionine (EXP) lead diacetate (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) methapyrilene (ISO) methimazole (ISO) methoxychlor (ISO) N,N-diethyl-m-toluamide (ISO) nickel sulfate (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (ISO) permethrin (ISO) phenobarbital (EXP) pirinixic acid (EXP) silver atom (EXP) silver(0) (EXP) sodium arsenate (EXP) sodium arsenite (EXP,ISO) sulfadimethoxine (ISO) tetrachloromethane (EXP,ISO) thiram (ISO) titanium dioxide (EXP) tris(2-butoxyethyl) phosphate (ISO) triticonazole (ISO) valproic acid (EXP,ISO) vorinostat (ISO)
Tenm3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 48,678,700 - 51,370,255 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 48,680,717 - 49,296,986 (-) Ensembl GRCm39 Ensembl GRCm38 8 48,225,665 - 49,522,824 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 48,227,682 - 48,843,951 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 49,311,019 - 49,760,044 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 49,726,501 - 50,173,507 (-) NCBI MGSCv36 mm8 Celera 8 50,895,477 - 51,344,899 (-) NCBI Celera Cytogenetic Map 8 B1.2- B1.3 NCBI cM Map 8 27.02 NCBI
TENM3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 181,447,613 - 182,803,024 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 182,143,987 - 182,803,024 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 183,065,116 - 183,724,177 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 183,482,131 - 183,961,171 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 183,539,732 - 183,969,496 NCBI Celera 4 180,576,661 - 181,055,801 (+) NCBI Celera Cytogenetic Map 4 q34.3-q35.1 NCBI HuRef 4 179,000,986 - 179,481,448 (+) NCBI HuRef CHM1_1 4 183,221,672 - 183,700,754 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 184,789,727 - 186,144,894 (+) NCBI T2T-CHM13v2.0
Tenm3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 47,984,732 - 50,711,352 (+) NCBI GRCr8 mRatBN7.2 16 41,251,909 - 43,978,594 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 41,252,182 - 43,978,594 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 48,938,379 - 49,382,048 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 52,298,931 - 52,742,613 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 47,588,478 - 48,031,955 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 46,422,676 - 46,929,023 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 46,731,403 - 46,926,245 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 45,990,922 - 46,657,495 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 46,648,771 - 47,149,524 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 46,648,894 - 47,146,821 (+) NCBI Celera 16 41,552,578 - 41,996,819 (+) NCBI Celera Cytogenetic Map 16 q11 NCBI
Tenm3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 25,923,750 - 26,365,894 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 25,920,919 - 26,534,817 (-) NCBI ChiLan1.0 ChiLan1.0
TENM3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 177,814,108 - 180,549,529 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 178,975,800 - 180,909,640 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 173,644,674 - 174,993,218 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 186,559,404 - 187,215,170 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 186,738,624 - 187,214,394 (+) Ensembl panpan1.1 panPan2
TENM3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 47,440,673 - 47,883,311 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 47,441,348 - 48,044,322 (-) NCBI CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 47,441,348 - 48,044,322 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 35,883,742 - 36,484,794 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 49,668,415 - 50,270,109 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 49,667,658 - 50,270,179 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 47,632,059 - 48,232,872 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 48,244,814 - 48,846,192 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 48,385,358 - 48,987,162 (-) NCBI UU_Cfam_GSD_1.0
Tenm3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 31,100,860 - 31,929,099 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936554 6,183,722 - 6,619,982 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936554 6,180,883 - 6,871,178 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TENM3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 43,540,375 - 44,399,711 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 41,818,190 - 44,401,747 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 50,292,659 - 50,995,047 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TENM3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 127,231,840 - 128,792,832 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 128,598,835 - 128,795,211 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 107,641,371 - 108,986,958 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tenm3
.
Predicted Target Of
Count of predictions: 769 Count of miRNA genes: 422 Interacting mature miRNAs: 475 Transcripts: ENSMUST00000033965, ENSMUST00000110343, ENSMUST00000110345, ENSMUST00000110346, ENSMUST00000129821, ENSMUST00000145344 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301139 Lmr10_m leishmaniasis resistance 10 (mouse) Not determined 8 35321097 57797633 Mouse 1558870 Eae36_m experimental allergic encephalomyelitis susceptibility 36 (mouse) Not determined 8 14773160 71498244 Mouse 11049577 Lmr10b_m leishmaniasis resistance 10b (mouse) 8 35321097 57797633 Mouse 4141437 W10q14_m weight 10 weeks QTL 14 (mouse) Not determined 32506572 71740637 Mouse 11049578 Lmr10c_m leishmaniasis resistance 10c (mouse) 8 35321097 57797633 Mouse 11041902 Lmr10a_m leishmaniasis resistance 10a (mouse) 8 35321097 57797633 Mouse 1301013 Capsq4_m capsaicin sensitivity related QTL 4 (mouse) Not determined 8 36630154 93455280 Mouse 1301717 Adip4_m adiposity 4 (mouse) Not determined 8 48090064 82090180 Mouse 1357715 Alaa3_m alopecia areata 3 (mouse) Not determined 8 49245591 83245673 Mouse 14746987 Manh64_m mandible shape 64 (mouse) 8 50505958 84505958 Mouse 4141172 W6q9_m weight 6 weeks QTL 9 (mouse) Not determined 32506572 71740637 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 10043990 Hbnr12_m Heligmosomoides bakeri nematode resistance 12 (mouse) Not determined 8 33277016 51290537 Mouse 10766453 Char11_m P. chabaudi malaria resistance QTL 11 (mouse) 8 48090064 82090180 Mouse 1301441 Skull11_m skull morphology 11 (mouse) Not determined 8 48190168 82190288 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 4140966 Egq12_m early growth QTL 12 (mouse) Not determined 32506572 71740637 Mouse 14747005 Mancz7_m mandible centroid size 7 (mouse) 8 50505958 84505958 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 10043974 Obq30_m obesity QTL 30 (mouse) Not determined 8 26583322 60583322 Mouse 1301298 Pgia4_m proteoglycan induced arthritis 4 (mouse) Not determined 8 16569373 50569697 Mouse 1300912 Daq19_m directional asymmetry QTL 19 (mouse) Not determined 8 15506572 49506729 Mouse 1301936 Trigq2_m triglyceride QTL 2 (mouse) Not determined 8 34290397 68290537 Mouse 1357811 Orq3_m ovulation rate QTL 3 (mouse) Not determined 8 32506572 71740637 Mouse 1300603 Cd8ts2_m CD8 T cell subset 2 (mouse) Not determined 8 19455018 53455150 Mouse 12904744 Carcdq1_m cardiac collagen deposition QTL 1 (mouse) 8 40162297 95416226 Mouse 1301088 Alcw6_m alcohol withdrawal 6 (mouse) Not determined 8 15506572 49506729 Mouse 1301160 Eae14_m susceptibility to experimental allergic encephalomyelitis 14 (mouse) Not determined 8 19455018 53455150 Mouse 1301544 Iba3_m induction of brown adipocytes 3 (mouse) Not determined 8 44747914 78748059 Mouse 1301550 Fembrs2_m femur breaking strength 2 (mouse) Not determined 8 18321097 52321225 Mouse
D8Mit127
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 48,535,288 - 48,535,438 UniSTS GRCm38 MGSCv37 8 49,620,642 - 49,620,792 UniSTS GRCm37 Celera 8 51,205,858 - 51,206,008 UniSTS Cytogenetic Map 8 B2 UniSTS cM Map 8 29.0 UniSTS Whitehead Genetic 8 30.6 UniSTS Whitehead/MRC_RH 8 581.14 UniSTS Whitehead_YAC 8 UniSTS
D8Mit298
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 48,286,279 - 48,286,401 UniSTS GRCm38 MGSCv37 8 49,371,633 - 49,371,755 UniSTS GRCm37 Celera 8 50,956,001 - 50,956,123 UniSTS Cytogenetic Map 8 B2 UniSTS cM Map 8 29.0 UniSTS Whitehead Genetic 8 30.6 UniSTS Whitehead/MRC_RH 8 569.04 UniSTS Whitehead_YAC 8 UniSTS
D8Mit53
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 48,347,029 - 48,347,166 UniSTS GRCm38 MGSCv37 8 49,432,383 - 49,432,520 UniSTS GRCm37 Celera 8 51,016,787 - 51,016,924 UniSTS Cytogenetic Map 8 B2 UniSTS cM Map 8 29.0 UniSTS Whitehead Genetic 8 30.6 UniSTS Whitehead/MRC_RH 8 569.04 UniSTS Whitehead_YAC 8 UniSTS
Odz3
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 B2 UniSTS cM Map 8 UniSTS cM Map 8 27.02 UniSTS
Odz3
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 B2 UniSTS cM Map 8 27.02 UniSTS cM Map 8 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000033965 ⟹ ENSMUSP00000033965
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 48,680,717 - 49,127,725 (-) Ensembl GRCm38.p6 Ensembl 8 48,227,682 - 48,674,690 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000110343 ⟹ ENSMUSP00000105972
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 48,848,471 - 49,009,074 (-) Ensembl GRCm38.p6 Ensembl 8 48,395,436 - 48,556,039 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000110345 ⟹ ENSMUSP00000105974
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 48,848,471 - 49,008,881 (-) Ensembl GRCm38.p6 Ensembl 8 48,395,436 - 48,555,846 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000110346 ⟹ ENSMUSP00000105975
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 48,788,228 - 49,008,348 (-) Ensembl GRCm38.p6 Ensembl 8 48,335,193 - 48,555,313 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000145344
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 48,728,950 - 48,753,134 (-) Ensembl GRCm38.p6 Ensembl 8 48,275,915 - 48,300,099 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000190840 ⟹ ENSMUSP00000140141
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 48,680,961 - 49,127,719 (-) Ensembl GRCm38.p6 Ensembl 8 48,227,926 - 48,674,684 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000211812 ⟹ ENSMUSP00000148666
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 49,099,296 - 49,296,986 (-) Ensembl GRCm38.p6 Ensembl 8 48,646,261 - 48,843,951 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000211976 ⟹ ENSMUSP00000148613
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 48,820,357 - 49,008,348 (-) Ensembl GRCm38.p6 Ensembl 8 48,367,322 - 48,555,313 (-) Ensembl
RefSeq Acc Id:
NM_001145937 ⟹ NP_001139409
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,700 - 49,127,725 (-) NCBI GRCm38 8 48,225,665 - 48,674,690 (-) NCBI MGSCv37 8 49,311,019 - 49,760,044 (-) RGD Celera 8 50,895,477 - 51,344,899 (-) RGD cM Map 8 ENTREZGENE
Sequence:
AAGTTCTAAGAAGCCGGACCGATGTGCACAGAGAAGGAATGAAGGAAGTATGGATGTGAAGGAACGCAGGCCTTACTGCTCCTTGACCAAGAGCAGACGGGAAAAGGAAAGGCGCTATACAAACTCGT
hide sequence
RefSeq Acc Id:
NM_011857 ⟹ NP_035987
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,700 - 49,127,725 (-) NCBI GRCm38 8 48,225,665 - 48,674,690 (-) NCBI MGSCv37 8 49,311,019 - 49,760,044 (-) RGD Celera 8 50,895,477 - 51,344,899 (-) RGD cM Map 8 ENTREZGENE
Sequence:
AAGTTCTAAGAAGCCGGACCGATGTGCACAGAGAAGGAATGAAGGAAGTATGGATGTGAAGGAACGCAGGCCTTACTGCTCCTTGACCAAGAGCAGACGGGAAAAGGAAAGGCGCTATACAAACTCGT
hide sequence
RefSeq Acc Id:
XM_006509404 ⟹ XP_006509467
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,296,376 (-) NCBI GRCm38 8 48,225,673 - 48,843,348 (-) NCBI
Sequence:
CATCACCGGCCCCCTCCCCCGCGCCCGGCGCCTTTGAATTTGGCCAGGCGAGCGCAGGGGCGGACGCGGCGGCGGTGGCCGGGGAGCGAGCGGGCGAGCGGGCGGCGCGGGCGAGCAGAGCGCGCCCC
hide sequence
RefSeq Acc Id:
XM_006509405 ⟹ XP_006509468
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 51,370,255 (-) NCBI GRCm38 8 48,225,673 - 49,522,824 (-) NCBI
Sequence:
GATTTCCTTGAGCCCAAATGGGTTTCTTGGTGGAGAACAGCTATCAGATTGTGGAGGAATGGGG
hide sequence
RefSeq Acc Id:
XM_006509409 ⟹ XP_006509472
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,033,694 (-) NCBI GRCm38 8 48,225,673 - 48,580,663 (-) NCBI
Sequence:
AGGGTTTATTGACAAGGGGATTCTTATTAGACTCTAGGTATATTGAGGTAATGACTGAGATGCA
hide sequence
RefSeq Acc Id:
XM_011242216 ⟹ XP_011240518
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,297,210 (-) NCBI GRCm38 8 48,225,673 - 48,844,175 (-) NCBI
Sequence:
GGCAGACCCCTCATCAGAGCCGAAAGCCGGCAAGAGCCATTCATCAGCATGAAGTGTTATTCATGGATGACCCCTAAATCACGGCGAGAGTAGTAGATACACTGATTGGTCACAGCATGGGAGCCTCG
hide sequence
RefSeq Acc Id:
XM_011242217 ⟹ XP_011240519
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,296,987 (-) NCBI GRCm38 8 48,225,673 - 48,843,958 (-) NCBI
Sequence:
AAAAAAGGCAGAAAACCGGGAATCTGATTTTTTGAATAAAGAAGAAGAAGAAATAAAGTACCTGTCATCTTGACAAGTGGCTGAGCGGAGGAGTCAAGGATTATAAATGATCACAGCCAGGTCCAGCT
hide sequence
RefSeq Acc Id:
XM_011242218 ⟹ XP_011240520
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,297,008 (-) NCBI GRCm38 8 48,225,673 - 48,844,013 (-) NCBI
Sequence:
GGCAAATCCCATTTGACAGCGAAAAAAGGCAGAAAACCGGGAATCTGATTTTTTGAATAAAGAAGAAGAAGAAATAAAGTACCTGTCATCTTGACAAGTGGCTGAGCGGAGGAGTCAAGGATTATAAA
hide sequence
RefSeq Acc Id:
XM_017312772 ⟹ XP_017168261
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,296,206 (-) NCBI GRCm38 8 48,225,673 - 48,843,348 (-) NCBI
Sequence:
CCCGGGCCTCGGGCGGGCGGGCGGAGAGCGAGCGAGCGAGCGAGCGAGTGAGCAGGGAAGCGCGGTTCCCTTTCCCAGGCACTGCTCCGAGGGGCGGCTGCGAGTTGGCCAGCCCTACAGGCGGCGGA
hide sequence
RefSeq Acc Id:
XM_017312778 ⟹ XP_017168267
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,881 (-) NCBI GRCm38 8 48,225,673 - 48,555,862 (-) NCBI
Sequence:
GTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGGGTGTGATGAAGCCTG
hide sequence
RefSeq Acc Id:
XM_030243525 ⟹ XP_030099385
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,033,693 (-) NCBI GRCm38 8 48,225,673 - 48,580,663 (-) NCBI
Sequence:
GGGTTTATTGACAAGGGGATTCTTATTAGACTCTAGGTATATTGAGGTAATGACTGAGATGCAG
hide sequence
RefSeq Acc Id:
XM_030243526 ⟹ XP_030099386
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,033,693 (-) NCBI GRCm38 8 48,225,673 - 48,580,663 (-) NCBI
Sequence:
GGGTTTATTGACAAGGGGATTCTTATTAGACTCTAGGTATATTGAGGTAATGACTGAGATGCAGAGTTAGAGGCACTGTGGCTAATCAATTGATTAGTAGCGTGCAATTCTGTTTGTGGCTCTCTGTT
hide sequence
RefSeq Acc Id:
XM_030243527 ⟹ XP_030099387
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,156 (-) NCBI GRCm38 8 48,225,673 - 48,555,123 (-) NCBI
Sequence:
GCGGTTCCACGCGCGGCTCCGAGCTCTCTCTCGGGCGCGCGGGGACCCCCGACTCCGCGGTCCCCTCGGCGCGGGTCCCGCGGTCCGTCCTCCCCGGTGGCGGCGGGATGGGAGGAGGCTTCGCGCCG
hide sequence
RefSeq Acc Id:
XM_030243528 ⟹ XP_030099388
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,033,690 (-) NCBI GRCm38 8 48,225,673 - 48,580,660 (-) NCBI
Sequence:
TTTATTGACAAGGGGATTCTTATTAGACTCTAGGTATATTGAGGTAATGACTGAGATGCAGAGTTAGAGGCACTGTGGCTAATCAATTGATTAGTAGCGTGCAATTCTGTTTGTGGCTCTCTGTTCTT
hide sequence
RefSeq Acc Id:
XM_036153984 ⟹ XP_036009877
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,896 (-) NCBI
Sequence:
CTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGG
hide sequence
RefSeq Acc Id:
XM_036153985 ⟹ XP_036009878
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,896 (-) NCBI
Sequence:
CTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGGGTGTGATGAAGCCTGTGCTGTGCAAGAAAGGTGGCGGAGCAGGGCTCGGGATTCAGGATGCGCG
hide sequence
RefSeq Acc Id:
XM_036153986 ⟹ XP_036009879
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,896 (-) NCBI
Sequence:
CTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGG
hide sequence
RefSeq Acc Id:
XM_036153987 ⟹ XP_036009880
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,896 (-) NCBI
Sequence:
CTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGG
hide sequence
RefSeq Acc Id:
XM_036153988 ⟹ XP_036009881
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,896 (-) NCBI
Sequence:
CTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGG
hide sequence
RefSeq Acc Id:
XM_036153989 ⟹ XP_036009882
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,896 (-) NCBI
Sequence:
CTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGG
hide sequence
RefSeq Acc Id:
XM_036153990 ⟹ XP_036009883
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,896 (-) NCBI
Sequence:
CTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGG
hide sequence
RefSeq Acc Id:
XM_036153991 ⟹ XP_036009884
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,896 (-) NCBI
Sequence:
CTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGG
hide sequence
RefSeq Acc Id:
XM_036153992 ⟹ XP_036009885
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 51,370,255 (-) NCBI
Sequence:
GATTTCCTTGAGCCCAAATGGGTTTCTTGGTGGAGAACAGCTATCAGATTGTGGAGGAATGGGGGAGGGCAGCTGGCTTTAAGGTCATCTCTTCTGCAGGTTTGGAAAAGGTTAGGCTGTGACTGAAA
hide sequence
RefSeq Acc Id:
XM_036153993 ⟹ XP_036009886
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 51,370,255 (-) NCBI
Sequence:
GATTTCCTTGAGCCCAAATGGGTTTCTTGGTGGAGAACAGCTATCAGATTGTGGAGGAATGGGGGAGGGCAGCTGGCTTTAAGGTCATCTCTTCTGCAGGTTTGGAAAAGGTTAGGCTGTGACTGAAA
hide sequence
RefSeq Acc Id:
XM_036153994 ⟹ XP_036009887
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 51,370,255 (-) NCBI
Sequence:
GATTTCCTTGAGCCCAAATGGGTTTCTTGGTGGAGAACAGCTATCAGATTGTGGAGGAATGGGGGAGGGCAGCTGGCTTTAAGGTCATCTCTTCTGCAGGTTTGGAAAAGGTTAGGCTGTGACTGAAA
hide sequence
RefSeq Acc Id:
XM_036153995 ⟹ XP_036009888
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 51,370,255 (-) NCBI
Sequence:
GATTTCCTTGAGCCCAAATGGGTTTCTTGGTGGAGAACAGCTATCAGATTGTGGAGGAATGGGG
hide sequence
RefSeq Acc Id:
XM_036153996 ⟹ XP_036009889
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 51,370,255 (-) NCBI
Sequence:
GATTTCCTTGAGCCCAAATGGGTTTCTTGGTGGAGAACAGCTATCAGATTGTGGAGGAATGGGGGAGGGCAGCTGGCTTTAAGGTCATCTCTTCTGCAGGTTTGGAAAAGGTTAGGCTGTGACTGAAA
hide sequence
RefSeq Acc Id:
XM_036153997 ⟹ XP_036009890
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,296,376 (-) NCBI
Sequence:
CATCACCGGCCCCCTCCCCCGCGCCCGGCGCCTTTGAATTTGGCCAGGCGAGCGCAGGGGCGGA
hide sequence
RefSeq Acc Id:
XM_036153998 ⟹ XP_036009891
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 51,370,255 (-) NCBI
Sequence:
GATTTCCTTGAGCCCAAATGGGTTTCTTGGTGGAGAACAGCTATCAGATTGTGGAGGAATGGGGGAGGGCAGCTGGCTTTAAGGTCATCTCTTCTGCAGGTTTGGAAAAGGTTAGGCTGTGACTGAAA
hide sequence
RefSeq Acc Id:
XM_036153999 ⟹ XP_036009892
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,297,210 (-) NCBI
Sequence:
GGCAGACCCCTCATCAGAGCCGAAAGCCGGCAAGAGCCATTCATCAGCATGAAGTGTTATTCAT
hide sequence
RefSeq Acc Id:
XM_036154000 ⟹ XP_036009893
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,297,048 (-) NCBI
Sequence:
GATGGGAGGGAGGGGCGGCGGTGTGGACGTGGTTCAGTCCGGCAAATCCCATTTGACAGCGAAAAAAGGCAGAAAACCGGGAATCTGATTTTTTGAATAAAGAAGAAGAAGAAATAAAGTACCTGTCA
hide sequence
RefSeq Acc Id:
XM_036154002 ⟹ XP_036009895
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,297,210 (-) NCBI
Sequence:
GGCAGACCCCTCATCAGAGCCGAAAGCCGGCAAGAGCCATTCATCAGCATGAAGTGTTATTCATGGATGACCCCTAAATCACGGCGAGAGTAGTAGATACACTGATTGGTCACAGCATGGGAGCCTCG
hide sequence
RefSeq Acc Id:
XM_036154003 ⟹ XP_036009896
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,296,375 (-) NCBI
Sequence:
ATCACCGGCCCCCTCCCCCGCGCCCGGCGCCTTTGAATTTGGCCAGGCGAGCGCAGGGGCGGAC
hide sequence
RefSeq Acc Id:
XM_036154004 ⟹ XP_036009897
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,296,374 (-) NCBI
Sequence:
TCACCGGCCCCCTCCCCCGCGCCCGGCGCCTTTGAATTTGGCCAGGCGAGCGCAGGGGCGGACG
hide sequence
RefSeq Acc Id:
XM_036154005 ⟹ XP_036009898
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 51,370,255 (-) NCBI
Sequence:
GATTTCCTTGAGCCCAAATGGGTTTCTTGGTGGAGAACAGCTATCAGATTGTGGAGGAATGGGGGAGGGCAGCTGGCTTTAAGGTCATCTCTTCTGCAGGTTTGGAAAAGGTTAGGCTGTGACTGAAA
hide sequence
RefSeq Acc Id:
XM_036154006 ⟹ XP_036009899
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 50,615,093 (-) NCBI
Sequence:
CTGAGACAACTCTTCCAAGTGGCACCTACAATTCAGATGTTAAGGATTTCAGCTTTTGGATACCTTCTCTGATTTCACGATGAGTTCATAAGTTAAATCGCTTTGATATGAAGCTATGTCCTACTGGG
hide sequence
RefSeq Acc Id:
XM_036154007 ⟹ XP_036009900
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,297,210 (-) NCBI
Sequence:
GGCAGACCCCTCATCAGAGCCGAAAGCCGGCAAGAGCCATTCATCAGCATGAAGTGTTATTCATGGATGACCCCTAAATCACGGCGAGAGTAGTAGATACACTGATTGGTCACAGCATGGGAGCCTCG
hide sequence
RefSeq Acc Id:
XM_036154008 ⟹ XP_036009901
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,158 (-) NCBI
Sequence:
GCGCGGTTCCACGCGCGGCTCCGAGCTCTCTCTCGGGCGCGCGGGGACCCCCGACTCCGCGGTC
hide sequence
RefSeq Acc Id:
XM_036154009 ⟹ XP_036009902
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,895 (-) NCBI
Sequence:
TCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGGGTGTGATGAAGCCTGTGCTGTGCAAGAAAGGTGGCGGAGCAGGGCTCGGGATTCAGGATGCGCGC
hide sequence
RefSeq Acc Id:
XM_036154010 ⟹ XP_036009903
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,895 (-) NCBI
Sequence:
TCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGGG
hide sequence
RefSeq Acc Id:
XM_036154011 ⟹ XP_036009904
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,895 (-) NCBI
Sequence:
TCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGGGTGTGATGAAGCCTGTGCTGTGCAAGAAAGGTGGCGGAGCAGGGCTCGGGATTCAGGATGCGCGC
hide sequence
RefSeq Acc Id:
XM_036154012 ⟹ XP_036009905
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,678,708 - 49,008,894 (-) NCBI
Sequence:
CTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGGGT
hide sequence
RefSeq Acc Id:
XM_036154013 ⟹ XP_036009906
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,710,049 - 49,008,906 (-) NCBI
Sequence:
GCTGGCGCGCCTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTG
hide sequence
RefSeq Acc Id:
XM_036154014 ⟹ XP_036009907
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 48,710,049 - 49,008,906 (-) NCBI
Sequence:
GCTGGCGCGCCTCTGCCGGGACTTAGTTGGGCCGACCAGAGGAGAAGTGGCGGTCCCCTGGGTGTGGGGTGGGGGTGTGATGAAGCCTGTGCTGTGCAAGAAAGGTGGCGGAGCAGGGCTCGGGATTC
hide sequence
RefSeq Acc Id:
NP_035987 ⟸ NM_011857
- Peptide Label:
isoform 1
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot), G3X907 (UniProtKB/TrEMBL)
- Sequence:
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVKDLVHREADEYTRQGQNFTLRQLGVCESATRRGVAFCAEMGLPHRGYSISAGSDADTENEAVMSP
hide sequence
RefSeq Acc Id:
NP_001139409 ⟸ NM_001145937
- Peptide Label:
isoform 2
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot), B7ZNJ5 (UniProtKB/TrEMBL)
- Sequence:
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVK
hide sequence
RefSeq Acc Id:
XP_006509468 ⟸ XM_006509405
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
- Sequence:
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVKDLVHREADEYTRQGQNFTLRQLGVCESATRRGVAFCAEMGLPHRGYSISAGSDADTENEAVMSP
hide sequence
RefSeq Acc Id:
XP_006509467 ⟸ XM_006509404
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
- Sequence:
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVK
hide sequence
RefSeq Acc Id:
XP_006509472 ⟸ XM_006509409
- Peptide Label:
isoform X15
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
- Sequence:
MASGSVYSPPTRPLPRNTLSRSAFKFKKSSKYCSWRCTALCAVGVSVLLAILLSYFIAMHLFGLNWHLQQTENDTFENGKVNSDTVPTNTVSLPSGDNGKLGGFTHENNTIDSGELDIGRRAIQEVPP
hide sequence
RefSeq Acc Id:
XP_011240520 ⟸ XM_011242218
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
- Sequence:
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVK
hide sequence
RefSeq Acc Id:
XP_011240519 ⟸ XM_011242217
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
- Sequence:
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVKDLVHREADEYTRQGQNFTLRQLGVCESATRRGVAFCAEMGLPHRGYSISAGSDADTENEAVMSP
hide sequence
RefSeq Acc Id:
XP_011240518 ⟸ XM_011242216
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
- Sequence:
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVK
hide sequence
RefSeq Acc Id:
XP_017168261 ⟸ XM_017312772
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
- Sequence:
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVKDLVHREADEYTRQGQNFTLRQLGVCESATRRGVAFCAEMGLPHRGYSISAGSDADTENEAVMSP
hide sequence
RefSeq Acc Id:
XP_017168267 ⟸ XM_017312778
- Peptide Label:
isoform X15
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
- Sequence:
MASGSVYSPPTRPLPRNTLSRSAFKFKKSSKYCSWRCTALCAVGVSVLLAILLSYFIAMHLFGL
hide sequence
RefSeq Acc Id:
XP_030099386 ⟸ XM_030243526
- Peptide Label:
isoform X17
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030099385 ⟸ XM_030243525
- Peptide Label:
isoform X16
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030099388 ⟸ XM_030243528
- Peptide Label:
isoform X23
RefSeq Acc Id:
XP_030099387 ⟸ XM_030243527
- Peptide Label:
isoform X22
Ensembl Acc Id:
ENSMUSP00000105972 ⟸ ENSMUST00000110343
Ensembl Acc Id:
ENSMUSP00000105974 ⟸ ENSMUST00000110345
Ensembl Acc Id:
ENSMUSP00000105975 ⟸ ENSMUST00000110346
Ensembl Acc Id:
ENSMUSP00000148613 ⟸ ENSMUST00000211976
Ensembl Acc Id:
ENSMUSP00000148666 ⟸ ENSMUST00000211812
Ensembl Acc Id:
ENSMUSP00000033965 ⟸ ENSMUST00000033965
Ensembl Acc Id:
ENSMUSP00000140141 ⟸ ENSMUST00000190840
RefSeq Acc Id:
XP_036009891 ⟸ XM_036153998
- Peptide Label:
isoform X11
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot), G3X907 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036009889 ⟸ XM_036153996
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009888 ⟸ XM_036153995
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009898 ⟸ XM_036154005
- Peptide Label:
isoform X14
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009885 ⟸ XM_036153992
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009886 ⟸ XM_036153993
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009887 ⟸ XM_036153994
- Peptide Label:
isoform X9
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009899 ⟸ XM_036154006
- Peptide Label:
isoform X14
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009900 ⟸ XM_036154007
- Peptide Label:
isoform X14
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009895 ⟸ XM_036154002
- Peptide Label:
isoform X12
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009892 ⟸ XM_036153999
- Peptide Label:
isoform X11
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot), G3X907 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036009893 ⟸ XM_036154000
- Peptide Label:
isoform X11
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot), G3X907 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036009890 ⟸ XM_036153997
- Peptide Label:
isoform X10
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009896 ⟸ XM_036154003
- Peptide Label:
isoform X13
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot), B7ZNJ5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036009897 ⟸ XM_036154004
- Peptide Label:
isoform X14
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009884 ⟸ XM_036153991
- Peptide Label:
isoform X8
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009883 ⟸ XM_036153990
- Peptide Label:
isoform X7
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009882 ⟸ XM_036153989
- Peptide Label:
isoform X6
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009880 ⟸ XM_036153987
- Peptide Label:
isoform X4
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009881 ⟸ XM_036153988
- Peptide Label:
isoform X5
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009878 ⟸ XM_036153985
- Peptide Label:
isoform X2
- UniProtKB:
A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot), Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009879 ⟸ XM_036153986
- Peptide Label:
isoform X3
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009877 ⟸ XM_036153984
- Peptide Label:
isoform X1
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009904 ⟸ XM_036154011
- Peptide Label:
isoform X20
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009903 ⟸ XM_036154010
- Peptide Label:
isoform X19
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009902 ⟸ XM_036154009
- Peptide Label:
isoform X18
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009905 ⟸ XM_036154012
- Peptide Label:
isoform X21
RefSeq Acc Id:
XP_036009901 ⟸ XM_036154008
- Peptide Label:
isoform X15
- UniProtKB:
Q9WTS6 (UniProtKB/Swiss-Prot), Q9JLC1 (UniProtKB/Swiss-Prot), Q9CSV2 (UniProtKB/Swiss-Prot), Q8BSL5 (UniProtKB/Swiss-Prot), Q80TD2 (UniProtKB/Swiss-Prot), Q3UX72 (UniProtKB/Swiss-Prot), Q3UVR9 (UniProtKB/Swiss-Prot), A0A2K9QL87 (UniProtKB/Swiss-Prot), A0A2K9QL36 (UniProtKB/Swiss-Prot), A0A2K9QL11 (UniProtKB/Swiss-Prot), A0A2K9QL04 (UniProtKB/Swiss-Prot), A0A2K9QL03 (UniProtKB/Swiss-Prot), A0A2K9QL01 (UniProtKB/Swiss-Prot), A0A2K9QKZ0 (UniProtKB/Swiss-Prot), A0A2K9QKY6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_036009907 ⟸ XM_036154014
- Peptide Label:
isoform X25
RefSeq Acc Id:
XP_036009906 ⟸ XM_036154013
- Peptide Label:
isoform X24
RGD ID: 8667073 Promoter ID: EPDNEW_M11568 Type: single initiation site Name: Tenm3_2 Description: Mus musculus teneurin transmembrane protein 3 , transcript variant2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M11569 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 48,552,897 - 48,552,957 EPDNEW
RGD ID: 8667075 Promoter ID: EPDNEW_M11569 Type: initiation region Name: Tenm3_1 Description: Mus musculus teneurin transmembrane protein 3 , transcript variant2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M11568 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 48,555,209 - 48,555,269 EPDNEW
RGD ID: 6843568 Promoter ID: MM_KWN:54400 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Liver Transcripts: ENSMUST00000110343, ENSMUST00000110345, ENSMUST00000110346 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 49,640,601 - 49,641,101 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-09
Tenm3
teneurin transmembrane protein 3
Odz3
odd Oz/ten-m homolog 3 (Drosophila)
Symbol and/or name change
5135510 APPROVED
