Symbol:
RACGAP1
Name:
Rac GTPase activating protein 1
RGD ID:
1314228
HGNC Page
HGNC:9804
Description:
Enables several functions, including GTPase activator activity; phosphatidylinositol-3,4,5-trisphosphate binding activity; and tubulin binding activity. Involved in several processes, including cytoskeleton-dependent cytokinesis; mitotic spindle midzone assembly; and regulation of cell cycle process. Located in several cellular components, including cleavage furrow; midbody; and spindle. Part of centralspindlin complex. Implicated in congenital dyserythropoietic anemia type IIIb.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
CDAN3B; CYK4; GTPase activating protein; HsCYK-4; ID-GAP; male germ cell RacGap; MgcRacGAP; protein CYK4 homolg; protein CYK4 homolog; rac GTPase-activating protein 1; RCGAP1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Racgap1 (Rac GTPase-activating protein 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Racgap1 (Rac GTPase-activating protein 1) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Racgap1 (Rac GTPase activating protein 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
RACGAP1 (Rac GTPase activating protein 1) NCBI
Ortholog
Canis lupus familiaris (dog):
RACGAP1 (Rac GTPase activating protein 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Racgap1 (Rac GTPase activating protein 1) NCBI
Ortholog
Sus scrofa (pig):
RACGAP1 (Rac GTPase activating protein 1) HGNC
EggNOG, Ensembl, NCBI, OrthoDB, Panther
Chlorocebus sabaeus (green monkey):
RACGAP1 (Rac GTPase activating protein 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Racgap1 (Rac GTPase activating protein 1) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Racgap1 (Rac GTPase-activating protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Racgap1 (Rac GTPase-activating protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
racgap1 (Rac GTPase activating protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
cyk-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
RacGAP84C
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Drosophila melanogaster (fruit fly):
tum
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
racgap1.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
racgap1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
racgap1.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
racgap1.2.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
RACGAP1P1
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 49,989,162 - 50,033,440 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 49,976,923 - 50,033,136 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 50,382,945 - 50,419,277 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 48,669,212 - 48,705,488 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 48,669,211 - 48,705,488 NCBI Celera 12 49,179,065 - 49,215,304 (-) NCBI Celera Cytogenetic Map 12 q13.12 NCBI HuRef 12 47,414,446 - 47,451,548 (-) NCBI HuRef CHM1_1 12 50,349,102 - 50,385,463 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 49,952,172 - 49,996,504 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
RACGAP1 Human (1->4)-beta-D-glucan multiple interactions ISO Racgap1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RACGAP1 mRNA CTD PMID:36331819 RACGAP1 Human 1,1-dichloroethene increases expression ISO Racgap1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of RACGAP1 mRNA CTD PMID:26682919 RACGAP1 Human 1,2-dimethylhydrazine increases expression ISO Racgap1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of RACGAP1 mRNA CTD PMID:22206623 RACGAP1 Human 1-naphthyl isothiocyanate increases expression ISO Racgap1 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in increased expression of RACGAP1 mRNA CTD PMID:30723492 RACGAP1 Human 17alpha-ethynylestradiol affects expression ISO Racgap1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of RACGAP1 mRNA CTD PMID:17555576 RACGAP1 Human 17alpha-ethynylestradiol multiple interactions ISO Racgap1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RACGAP1 mRNA CTD PMID:17942748 RACGAP1 Human 17alpha-ethynylestradiol increases expression ISO Racgap1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of RACGAP1 mRNA CTD PMID:17942748 RACGAP1 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of RACGAP1 mRNA CTD PMID:16474171 more ... RACGAP1 Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Racgap1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 RACGAP1 Human 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Racgap1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 RACGAP1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Racgap1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RACGAP1 mRNA and AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of RACGAP1 mRNA] CTD PMID:15034205 and PMID:17942748 RACGAP1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Racgap1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of RACGAP1 mRNA CTD PMID:34747641 RACGAP1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Racgap1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RACGAP1 mRNA CTD PMID:15034205 RACGAP1 Human 2,3-dimethoxynaphthalene-1,4-dione increases expression EXP 6480464 2 more ... CTD PMID:17547211 RACGAP1 Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Racgap1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 RACGAP1 Human 2-amino-2-deoxy-D-glucopyranose decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 Glucosamine results in decreased expression of RACGAP1 mRNA CTD PMID:17109745 RACGAP1 Human 2-palmitoylglycerol increases expression EXP 6480464 2-palmitoylglycerol results in increased expression of RACGAP1 mRNA CTD PMID:37199045 RACGAP1 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of RACGAP1 mRNA CTD PMID:28628672 RACGAP1 Human 3-methylcholanthrene increases expression ISO Racgap1 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of RACGAP1 mRNA CTD PMID:20713471 RACGAP1 Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of RACGAP1 mRNA CTD PMID:28628672 RACGAP1 Human 4,4'-sulfonyldiphenol decreases expression ISO Racgap1 (Mus musculus) 6480464 bisphenol S results in decreased expression of RACGAP1 mRNA CTD PMID:39298647 RACGAP1 Human 4-hydroxyphenyl retinamide increases expression ISO Racgap1 (Mus musculus) 6480464 Fenretinide results in increased expression of RACGAP1 mRNA CTD PMID:28973697 RACGAP1 Human 5-azacytidine increases expression EXP 6480464 Azacitidine results in increased expression of RACGAP1 mRNA CTD PMID:20823114 RACGAP1 Human 6-propyl-2-thiouracil increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of RACGAP1 mRNA CTD PMID:24780913 and PMID:30047161 RACGAP1 Human acetamide increases expression ISO Racgap1 (Rattus norvegicus) 6480464 acetamide results in increased expression of RACGAP1 mRNA CTD PMID:31881176 RACGAP1 Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RACGAP1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of RACGAP1 mRNA CTD PMID:32699268 RACGAP1 Human acrylamide increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Acrylamide results in increased expression of RACGAP1 mRNA CTD PMID:28959563 RACGAP1 Human afimoxifene decreases expression EXP 6480464 afimoxifene results in decreased expression of RACGAP1 mRNA CTD PMID:16514628 RACGAP1 Human aflatoxin B1 affects expression EXP 6480464 Aflatoxin B1 affects the expression of RACGAP1 protein CTD PMID:20106945 RACGAP1 Human aflatoxin B1 increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Aflatoxin B1 results in increased expression of RACGAP1 mRNA CTD PMID:23630614 and PMID:25378103 RACGAP1 Human aldehydo-D-glucosamine decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 Glucosamine results in decreased expression of RACGAP1 mRNA CTD PMID:17109745 RACGAP1 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of RACGAP1 mRNA CTD PMID:33167477 RACGAP1 Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RACGAP1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of RACGAP1 mRNA CTD PMID:32699268 RACGAP1 Human AM-251 decreases expression EXP 6480464 AM 251 results in decreased expression of RACGAP1 mRNA CTD PMID:16500647 RACGAP1 Human amitrole increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Amitrole results in increased expression of RACGAP1 mRNA CTD PMID:30047161 RACGAP1 Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of RACGAP1 protein CTD PMID:33212167 RACGAP1 Human Aroclor 1254 decreases expression ISO Racgap1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of RACGAP1 mRNA CTD PMID:23650126 RACGAP1 Human arsane multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of RACGAP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of RACGAP1 mRNA CTD PMID:39836092 RACGAP1 Human arsenic atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of RACGAP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of RACGAP1 mRNA CTD PMID:39836092 RACGAP1 Human arsenite(3-) decreases expression ISO Racgap1 (Mus musculus) 6480464 arsenite results in decreased expression of RACGAP1 mRNA CTD PMID:18929588 RACGAP1 Human arsenite(3-) multiple interactions EXP 6480464 arsenite inhibits the reaction [G3BP1 protein binds to RACGAP1 mRNA] CTD PMID:32406909 RACGAP1 Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of RACGAP1 mRNA CTD PMID:17547211 RACGAP1 Human azathioprine decreases expression EXP 6480464 Azathioprine results in decreased expression of RACGAP1 mRNA CTD PMID:22623647 RACGAP1 Human benzo[a]pyrene multiple interactions ISO Racgap1 (Mus musculus) 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in decreased expression of RACGAP1 mRNA] and Benzo(a)pyrene promotes the reaction [AHR protein binds to RACGAP1 promoter] CTD PMID:15034205 and PMID:19654925 RACGAP1 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of RACGAP1 promoter CTD PMID:27901495 RACGAP1 Human benzo[a]pyrene decreases expression ISO Racgap1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RACGAP1 mRNA CTD PMID:15034205 RACGAP1 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of RACGAP1 mRNA CTD PMID:20064835 RACGAP1 Human benzo[a]pyrene increases expression ISO Racgap1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of RACGAP1 mRNA CTD PMID:20713471 and PMID:32417428 RACGAP1 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7 more ... CTD PMID:20382639 RACGAP1 Human benzo[b]fluoranthene increases expression ISO Racgap1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of RACGAP1 mRNA CTD PMID:26377693 RACGAP1 Human beta-D-glucosamine decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 Glucosamine results in decreased expression of RACGAP1 mRNA CTD PMID:17109745 RACGAP1 Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of RACGAP1 mRNA CTD PMID:38218311 RACGAP1 Human bicalutamide decreases expression EXP 6480464 bicalutamide results in decreased expression of RACGAP1 mRNA CTD PMID:15638997 RACGAP1 Human bis(2-chloroethyl) sulfide decreases expression EXP 6480464 Mustard Gas results in decreased expression of RACGAP1 mRNA CTD PMID:25102026 RACGAP1 Human bis(2-ethylhexyl) phthalate increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Diethylhexyl Phthalate results in increased expression of RACGAP1 mRNA CTD PMID:33789034 RACGAP1 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RACGAP1 mRNA CTD PMID:16474171 RACGAP1 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RACGAP1 mRNA CTD PMID:29275510 RACGAP1 Human bisphenol A decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of RACGAP1 mRNA CTD PMID:25181051 more ... RACGAP1 Human bisphenol AF affects expression ISO Racgap1 (Mus musculus) 6480464 bisphenol AF affects the expression of RACGAP1 mRNA CTD PMID:36625514 RACGAP1 Human cadmium atom decreases expression EXP 6480464 Cadmium results in decreased expression of RACGAP1 mRNA CTD PMID:21120746 and PMID:24376830 RACGAP1 Human cadmium dichloride decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of RACGAP1 mRNA CTD PMID:25993096 RACGAP1 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of RACGAP1 mRNA CTD PMID:38568856 RACGAP1 Human caffeine decreases phosphorylation EXP 6480464 Caffeine results in decreased phosphorylation of RACGAP1 protein CTD PMID:35688186 RACGAP1 Human calcitriol decreases expression EXP 6480464 Calcitriol results in decreased expression of RACGAP1 mRNA CTD PMID:21592394 RACGAP1 Human calcitriol multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of RACGAP1 mRNA CTD PMID:21592394 RACGAP1 Human carbon nanotube affects expression ISO Racgap1 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of RACGAP1 mRNA CTD PMID:25554681 RACGAP1 Human carbon nanotube increases expression ISO Racgap1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of RACGAP1 mRNA CTD PMID:25554681 RACGAP1 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to RACGAP1 gene] CTD PMID:28238834 RACGAP1 Human chromium(6+) multiple interactions EXP 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of RACGAP1 mRNA CTD PMID:38479592 RACGAP1 Human cisplatin multiple interactions EXP 6480464 Cisplatin inhibits the reaction [Piroxicam results in increased expression of RACGAP1 mRNA] CTD PMID:21858171 RACGAP1 Human cisplatin decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 Cisplatin results in decreased expression of RACGAP1 mRNA CTD PMID:22023808 RACGAP1 Human copper atom multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in decreased expression of RACGAP1 mRNA CTD PMID:20971185 RACGAP1 Human copper atom increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Copper results in increased expression of RACGAP1 mRNA CTD PMID:30556269 RACGAP1 Human copper(0) multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in decreased expression of RACGAP1 mRNA CTD PMID:20971185 RACGAP1 Human copper(0) increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Copper results in increased expression of RACGAP1 mRNA CTD PMID:30556269 RACGAP1 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of RACGAP1 mRNA CTD PMID:19549813 RACGAP1 Human coumarin decreases phosphorylation EXP 6480464 coumarin results in decreased phosphorylation of RACGAP1 protein CTD PMID:35688186 RACGAP1 Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:18310284 and PMID:19167446 RACGAP1 Human coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of RACGAP1 mRNA CTD PMID:19167446 RACGAP1 Human CU-O LINKAGE decreases expression EXP 6480464 cupric oxide results in decreased expression of RACGAP1 mRNA CTD PMID:22077320 RACGAP1 Human Cuprizon increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of RACGAP1 mRNA CTD PMID:26577399 RACGAP1 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of RACGAP1 mRNA CTD PMID:20106945 more ... RACGAP1 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of RACGAP1 mRNA CTD PMID:28628672 RACGAP1 Human diallyl trisulfide decreases expression EXP 6480464 diallyl trisulfide results in decreased expression of RACGAP1 mRNA CTD PMID:34995734 RACGAP1 Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of RACGAP1 mRNA CTD PMID:17547211 RACGAP1 Human dibenz[a,h]anthracene increases expression ISO Racgap1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 RACGAP1 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of RACGAP1 mRNA CTD PMID:37042841 RACGAP1 Human dibutyl phthalate decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of RACGAP1 mRNA CTD PMID:21266533 RACGAP1 Human dichloroacetic acid increases expression ISO Racgap1 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of RACGAP1 mRNA CTD PMID:28962523 RACGAP1 Human dioxygen multiple interactions ISO Racgap1 (Rattus norvegicus) 6480464 [dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of RACGAP1 mRNA] and [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of RACGAP1 mRNA CTD PMID:33729688 RACGAP1 Human doxorubicin affects response to substance EXP 6480464 RACGAP1 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 RACGAP1 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of RACGAP1 mRNA CTD PMID:29803840 and PMID:30031762 RACGAP1 Human Enterolactone increases expression EXP 6480464 2 and 3-bis(3'-hydroxybenzyl)butyrolactone results in increased expression of RACGAP1 mRNA CTD PMID:19167446 RACGAP1 Human Enterolactone multiple interactions EXP 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RACGAP1 mRNA CTD PMID:19167446 RACGAP1 Human folic acid decreases expression ISO Racgap1 (Mus musculus) 6480464 Folic Acid results in decreased expression of RACGAP1 mRNA CTD PMID:25629700 RACGAP1 Human FR900359 affects phosphorylation EXP 6480464 FR900359 affects the phosphorylation of RACGAP1 protein CTD PMID:37730182 RACGAP1 Human fulvestrant decreases expression EXP 6480464 fulvestrant results in decreased expression of RACGAP1 mRNA CTD PMID:16514628 RACGAP1 Human furan increases expression ISO Racgap1 (Rattus norvegicus) 6480464 furan results in increased expression of RACGAP1 mRNA CTD PMID:25539665 RACGAP1 Human gallic acid decreases expression EXP 6480464 Gallic Acid results in decreased expression of RACGAP1 mRNA CTD PMID:34408198 RACGAP1 Human genistein increases expression EXP 6480464 Genistein results in increased expression of RACGAP1 mRNA CTD PMID:16474171 RACGAP1 Human geraniol decreases expression EXP 6480464 geraniol results in decreased expression of RACGAP1 mRNA CTD PMID:27683099 RACGAP1 Human hexadecanoic acid decreases phosphorylation EXP 6480464 Palmitic Acid results in decreased phosphorylation of RACGAP1 protein CTD PMID:28073184 RACGAP1 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of RACGAP1 mRNA CTD PMID:28628672 RACGAP1 Human isoflavones decreases expression EXP 6480464 Isoflavones results in decreased expression of RACGAP1 mRNA CTD PMID:17374662 RACGAP1 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of RACGAP1 protein CTD PMID:32959892 RACGAP1 Human leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of RACGAP1 mRNA CTD PMID:28988120 RACGAP1 Human lidocaine increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Lidocaine results in increased expression of RACGAP1 mRNA CTD PMID:35283115 RACGAP1 Human lithium atom increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Lithium results in increased expression of RACGAP1 mRNA CTD PMID:21711903 RACGAP1 Human lithium hydride increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Lithium results in increased expression of RACGAP1 mRNA CTD PMID:21711903 RACGAP1 Human lucanthone decreases expression EXP 6480464 Lucanthone results in decreased expression of RACGAP1 mRNA CTD PMID:21148553 RACGAP1 Human manganese atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of RACGAP1 mRNA CTD PMID:39836092 RACGAP1 Human manganese(0) multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of RACGAP1 mRNA CTD PMID:39836092 RACGAP1 Human manganese(II) chloride multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of RACGAP1 mRNA CTD PMID:39836092 RACGAP1 Human mercury atom increases expression EXP 6480464 Mercury results in increased expression of RACGAP1 mRNA CTD PMID:17547211 RACGAP1 Human mercury(0) increases expression EXP 6480464 Mercury results in increased expression of RACGAP1 mRNA CTD PMID:17547211 RACGAP1 Human methimazole increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Methimazole results in increased expression of RACGAP1 mRNA CTD PMID:30047161 RACGAP1 Human methylphenidate decreases expression ISO Racgap1 (Mus musculus) 6480464 Methylphenidate results in decreased expression of RACGAP1 mRNA CTD PMID:22470460 RACGAP1 Human N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Racgap1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in increased expression of RACGAP1 mRNA CTD PMID:19840844 RACGAP1 Human N-nitrosodiethylamine multiple interactions ISO Racgap1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of RACGAP1 mRNA CTD PMID:24535843 RACGAP1 Human N-nitrosodiethylamine increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Diethylnitrosamine results in increased expression of RACGAP1 mRNA CTD PMID:19041683 RACGAP1 Human N-Nitrosopyrrolidine decreases expression EXP 6480464 N-Nitrosopyrrolidine results in decreased expression of RACGAP1 mRNA CTD PMID:32234424 RACGAP1 Human nickel dichloride increases expression EXP 6480464 nickel chloride results in increased expression of RACGAP1 mRNA CTD PMID:17547211 RACGAP1 Human okadaic acid multiple interactions ISO Racgap1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in increased expression of RACGAP1 mRNA CTD PMID:19840844 RACGAP1 Human oxaliplatin multiple interactions ISO Racgap1 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RACGAP1 mRNA CTD PMID:25729387 RACGAP1 Human oxaliplatin decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 oxaliplatin results in decreased expression of RACGAP1 mRNA CTD PMID:25729387 RACGAP1 Human ozone increases expression ISO Racgap1 (Mus musculus) 6480464 Ozone results in increased expression of RACGAP1 mRNA CTD PMID:19555225 and PMID:25658374 RACGAP1 Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RACGAP1 mRNA more ... CTD PMID:32699268 RACGAP1 Human ozone multiple interactions ISO Racgap1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of RACGAP1 mRNA more ... CTD PMID:25658374 more ... RACGAP1 Human palbociclib decreases expression EXP 6480464 palbociclib results in decreased expression of RACGAP1 mRNA CTD PMID:22869556 RACGAP1 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of RACGAP1 mRNA CTD PMID:22230336 RACGAP1 Human PCB138 multiple interactions ISO Racgap1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 RACGAP1 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Racgap1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RACGAP1 mRNA CTD PMID:36331819 RACGAP1 Human phenobarbital multiple interactions ISO Racgap1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of RACGAP1 mRNA and NR1I3 protein affects the reaction [Phenobarbital results in increased expression of RACGAP1 mRNA] CTD PMID:19482888 and PMID:24535843 RACGAP1 Human phenobarbital increases expression ISO Racgap1 (Mus musculus) 6480464 Phenobarbital results in increased expression of RACGAP1 mRNA CTD PMID:19482888 and PMID:23091169 RACGAP1 Human PhIP increases expression ISO Racgap1 (Rattus norvegicus) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of RACGAP1 mRNA CTD PMID:29877212 RACGAP1 Human piperonyl butoxide increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Piperonyl Butoxide results in increased expression of RACGAP1 mRNA CTD PMID:22484513 RACGAP1 Human pirinixic acid increases expression ISO Racgap1 (Mus musculus) 6480464 pirinixic acid results in increased expression of RACGAP1 mRNA CTD PMID:17950772 and PMID:18301758 RACGAP1 Human pirinixic acid multiple interactions ISO Racgap1 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of RACGAP1 mRNA] CTD PMID:17950772 RACGAP1 Human piroxicam multiple interactions EXP 6480464 Cisplatin inhibits the reaction [Piroxicam results in increased expression of RACGAP1 mRNA] CTD PMID:21858171 RACGAP1 Human piroxicam increases expression EXP 6480464 Piroxicam results in increased expression of RACGAP1 mRNA CTD PMID:21858171 RACGAP1 Human pregnenolone 16alpha-carbonitrile increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in increased expression of RACGAP1 mRNA CTD PMID:30047161 RACGAP1 Human progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of RACGAP1 mRNA CTD PMID:21795739 RACGAP1 Human raloxifene decreases expression EXP 6480464 Raloxifene Hydrochloride results in decreased expression of RACGAP1 mRNA CTD PMID:16514628 RACGAP1 Human resveratrol multiple interactions EXP 6480464 [Coumestrol co-treated with Resveratrol] results in increased expression of RACGAP1 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of RACGAP1 mRNA CTD PMID:19167446 and PMID:23557933 RACGAP1 Human resveratrol increases expression EXP 6480464 resveratrol results in increased expression of RACGAP1 mRNA CTD PMID:19167446 RACGAP1 Human rotenone increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Rotenone results in increased expression of RACGAP1 mRNA CTD PMID:19013527 RACGAP1 Human rotenone decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 Rotenone results in decreased expression of RACGAP1 mRNA CTD PMID:28374803 RACGAP1 Human silicon dioxide increases expression ISO Racgap1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of RACGAP1 mRNA CTD PMID:29341224 RACGAP1 Human simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of RACGAP1 mRNA CTD PMID:17428261 RACGAP1 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of RACGAP1 mRNA CTD PMID:29301061 RACGAP1 Human sodium arsenite multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of RACGAP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of RACGAP1 mRNA CTD PMID:39836092 RACGAP1 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of RACGAP1 mRNA CTD PMID:38568856 RACGAP1 Human Soman increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Soman results in increased expression of RACGAP1 mRNA CTD PMID:19281266 RACGAP1 Human sulfadimethoxine increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of RACGAP1 mRNA CTD PMID:30047161 RACGAP1 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of RACGAP1 mRNA CTD PMID:31533062 RACGAP1 Human tamoxifen affects expression ISO Racgap1 (Mus musculus) 6480464 Tamoxifen affects the expression of RACGAP1 mRNA CTD PMID:17555576 RACGAP1 Human testosterone multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of RACGAP1 mRNA CTD PMID:21592394 RACGAP1 Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of RACGAP1 mRNA CTD PMID:21592394 RACGAP1 Human tetrachloromethane affects expression ISO Racgap1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of RACGAP1 mRNA CTD PMID:17484886 RACGAP1 Human tetrachloromethane increases expression ISO Racgap1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of RACGAP1 mRNA CTD PMID:27339419 and PMID:31919559 RACGAP1 Human thioacetamide increases expression ISO Racgap1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of RACGAP1 mRNA CTD PMID:23411599 and PMID:34492290 RACGAP1 Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of RACGAP1 mRNA CTD PMID:38568856 RACGAP1 Human titanium dioxide increases expression ISO Racgap1 (Mus musculus) 6480464 titanium dioxide results in increased expression of RACGAP1 mRNA CTD PMID:23557971 and PMID:29264374 RACGAP1 Human titanium dioxide increases expression ISO Racgap1 (Rattus norvegicus) 6480464 titanium dioxide results in increased expression of RACGAP1 mRNA CTD PMID:30012374 RACGAP1 Human titanium dioxide affects expression ISO Racgap1 (Mus musculus) 6480464 titanium dioxide affects the expression of RACGAP1 mRNA CTD PMID:17656681 RACGAP1 Human topotecan multiple interactions ISO Racgap1 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RACGAP1 mRNA CTD PMID:25729387 RACGAP1 Human topotecan decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 Topotecan results in decreased expression of RACGAP1 mRNA CTD PMID:25729387 RACGAP1 Human trichloroethene increases expression ISO Racgap1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of RACGAP1 mRNA CTD PMID:25549359 RACGAP1 Human trichloroethene decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of RACGAP1 mRNA CTD PMID:33387578 RACGAP1 Human trimellitic anhydride increases expression ISO Racgap1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of RACGAP1 mRNA CTD PMID:19042947 RACGAP1 Human trovafloxacin decreases expression ISO Racgap1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of RACGAP1 mRNA CTD PMID:35537566 RACGAP1 Human urethane increases expression EXP 6480464 Urethane results in increased expression of RACGAP1 mRNA CTD PMID:28818685 RACGAP1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of RACGAP1 mRNA CTD PMID:29154799 RACGAP1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of RACGAP1 mRNA CTD PMID:25979313 RACGAP1 Human vincaleukoblastine affects response to substance EXP 6480464 RACGAP1 protein affects the susceptibility to Vinblastine CTD PMID:16217747 RACGAP1 Human zaragozic acid A decreases expression ISO Racgap1 (Mus musculus) 6480464 squalestatin 1 results in decreased expression of RACGAP1 mRNA CTD PMID:27225895 RACGAP1 Human zaragozic acid A decreases expression ISO Racgap1 (Rattus norvegicus) 6480464 squalestatin 1 results in decreased expression of RACGAP1 mRNA CTD PMID:27225895
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3-dimethoxynaphthalene-1,4-dione (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-palmitoylglycerol (EXP) 3-isobutyl-1-methyl-7H-xanthine (EXP) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 5-azacytidine (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acrolein (EXP) acrylamide (ISO) afimoxifene (EXP) aflatoxin B1 (EXP,ISO) aldehydo-D-glucosamine (ISO) all-trans-retinoic acid (EXP) alpha-pinene (EXP) AM-251 (EXP) amitrole (ISO) aristolochic acid A (EXP) Aroclor 1254 (ISO) arsane (EXP) arsenic atom (EXP) arsenite(3-) (EXP,ISO) arsenous acid (EXP) azathioprine (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) benzo[b]fluoranthene (ISO) beta-D-glucosamine (ISO) beta-lapachone (EXP) bicalutamide (EXP) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium atom (EXP) cadmium dichloride (EXP,ISO) caffeine (EXP) calcitriol (EXP) carbon nanotube (ISO) CGP 52608 (EXP) chromium(6+) (EXP) cisplatin (EXP,ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (EXP) coumarin (EXP) coumestrol (EXP) CU-O LINKAGE (EXP) Cuprizon (ISO) cyclosporin A (EXP) dexamethasone (EXP) diallyl trisulfide (EXP) diarsenic trioxide (EXP) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) dichloroacetic acid (ISO) dioxygen (ISO) doxorubicin (EXP) Enterolactone (EXP) folic acid (ISO) FR900359 (EXP) fulvestrant (EXP) furan (ISO) gallic acid (EXP) genistein (EXP) geraniol (EXP) hexadecanoic acid (EXP) indometacin (EXP) isoflavones (EXP) ivermectin (EXP) leflunomide (EXP) lidocaine (ISO) lithium atom (ISO) lithium hydride (ISO) lucanthone (EXP) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) mercury atom (EXP) mercury(0) (EXP) methimazole (ISO) methylphenidate (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (ISO) N-Nitrosopyrrolidine (EXP) nickel dichloride (EXP) okadaic acid (ISO) oxaliplatin (ISO) ozone (EXP,ISO) palbociclib (EXP) paracetamol (EXP) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) PhIP (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) piroxicam (EXP) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP) raloxifene (EXP) resveratrol (EXP) rotenone (ISO) silicon dioxide (ISO) simvastatin (EXP) sodium arsenite (EXP) Soman (ISO) sulfadimethoxine (ISO) sunitinib (EXP) tamoxifen (ISO) testosterone (EXP) tetrachloromethane (ISO) thioacetamide (ISO) thiram (EXP) titanium dioxide (ISO) topotecan (ISO) trichloroethene (ISO) trimellitic anhydride (ISO) trovafloxacin (ISO) urethane (EXP) valproic acid (EXP) vincaleukoblastine (EXP) zaragozic acid A (ISO)
RACGAP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 49,989,162 - 50,033,440 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 49,976,923 - 50,033,136 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 50,382,945 - 50,419,277 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 48,669,212 - 48,705,488 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 48,669,211 - 48,705,488 NCBI Celera 12 49,179,065 - 49,215,304 (-) NCBI Celera Cytogenetic Map 12 q13.12 NCBI HuRef 12 47,414,446 - 47,451,548 (-) NCBI HuRef CHM1_1 12 50,349,102 - 50,385,463 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 49,952,172 - 49,996,504 (-) NCBI T2T-CHM13v2.0
Racgap1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 99,518,377 - 99,549,504 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 99,518,377 - 99,549,537 (-) Ensembl GRCm39 Ensembl GRCm38 15 99,620,496 - 99,651,656 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 99,620,496 - 99,651,656 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 99,450,927 - 99,482,052 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 99,448,530 - 99,479,655 (-) NCBI MGSCv36 mm8 Celera 15 101,775,878 - 101,807,252 (-) NCBI Celera Cytogenetic Map 15 F1 NCBI cM Map 15 56.13 NCBI
Racgap1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 132,629,789 - 132,659,738 (-) NCBI GRCr8 mRatBN7.2 7 130,750,936 - 130,780,891 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 130,750,936 - 130,780,831 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 132,555,040 - 132,584,440 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 134,780,620 - 134,810,026 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 134,693,146 - 134,722,541 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 141,277,303 - 141,308,849 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 141,277,312 - 141,307,233 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 138,713,215 - 138,728,271 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 138,366,356 - 138,395,716 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 138,443,204 - 138,463,026 (-) NCBI Celera 7 127,232,693 - 127,262,334 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
Racgap1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955547 581,134 - 616,087 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955547 584,885 - 615,883 (-) NCBI ChiLan1.0 ChiLan1.0
RACGAP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 44,163,317 - 44,199,581 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 44,160,108 - 44,196,343 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 38,729,885 - 38,766,063 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 39,625,763 - 39,660,040 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 39,625,796 - 39,672,256 (+) Ensembl panpan1.1 panPan2
RACGAP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 4,689,914 - 4,718,181 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 4,689,483 - 4,727,933 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 41,541,242 - 41,569,279 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 4,737,980 - 4,766,051 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 4,738,129 - 4,775,802 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 4,702,991 - 4,731,034 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 4,692,808 - 4,720,859 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 41,935,897 - 41,964,171 (-) NCBI UU_Cfam_GSD_1.0
Racgap1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 65,468,262 - 65,499,692 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 7,665,208 - 7,689,112 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 7,665,144 - 7,696,615 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RACGAP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 15,904,712 - 15,943,609 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 15,894,314 - 15,943,619 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 16,400,485 - 16,403,961 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RACGAP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 46,218,987 - 46,260,477 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 46,220,090 - 46,254,602 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 199,866,951 - 199,902,603 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Racgap1
.
GRCh38/hg38 12q13.12(chr12:49840075-50315208)x3 copy number gain
See cases [RCV000051958 ]
Chr12:49840075..50315208 [GRCh38]
uncertain significance
GRCh38/hg38 12p13.33-q24.33(chr12:121271-133196807)x3 copy number gain
See cases [RCV000139555 ]
Chr12:121271..133196807 [GRCh38]
pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:1-133851895)x3 copy number gain
See cases [RCV000258805 ]
Chr12:1..133851895 [GRCh37]
pathogenic|likely pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:173787-133777902)x3 copy number gain
See cases [RCV000510482 ]
Chr12:173787..133777902 [GRCh37]
pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:173787-133777902) copy number gain
See cases [RCV000511643 ]
Chr12:173787..133777902 [GRCh37]
pathogenic
NC_000012.11:g.26370251_54361538inv inversion
not specified [RCV000714265 ]
Chr12:26370251..54361538 [GRCh37]
uncertain significance
GRCh37/hg19 12p13.33-q24.33(chr12:621220-133779118)x3 copy number gain
not provided [RCV000750253 ]
Chr12:621220..133779118 [GRCh37]
pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:191619-133777645)x3 copy number gain
not provided [RCV000750246 ]
Chr12:191619..133777645 [GRCh37]
pathogenic
NM_001319999.2(RACGAP1):c.1578+13G>A single nucleotide variant
not provided [RCV001667253 ]
Chr12:49992232 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.1823+118A>G single nucleotide variant
not provided [RCV001609534 ]
Chr12:49990566 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.-4-31G>A single nucleotide variant
not provided [RCV001678754 ]
Chr12:50016750 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.194G>A (p.Arg65Gln) single nucleotide variant
not specified [RCV004311068 ]
Chr12:50006528 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1714+118A>G single nucleotide variant
not provided [RCV001656455 ]
Chr12:49991880 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.1821T>C (p.Pro607=) single nucleotide variant
not provided [RCV001621042 ]
Chr12:49990686 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.880-194G>A single nucleotide variant
not provided [RCV001672317 ]
Chr12:49997398 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.1445+38dup duplication
not provided [RCV001721795 ]
Chr12:49992505..49992506 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.880-70_880-69del deletion
not provided [RCV001675551 ]
Chr12:49997273..49997274 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.1824-45A>G single nucleotide variant
not provided [RCV001614542 ]
Chr12:49990388 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.1339+44G>A single nucleotide variant
not provided [RCV001721821 ]
Chr12:49994087 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.425+126T>C single nucleotide variant
not provided [RCV001708439 ]
Chr12:50005130 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.549+29A>T single nucleotide variant
not provided [RCV001680875 ]
Chr12:50002218 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.880-69del deletion
not provided [RCV001651946 ]
Chr12:49997273 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.748+27C>A single nucleotide variant
not provided [RCV001611994 ]
Chr12:49999589 [GRCh38]
benign
NM_001319999.2(RACGAP1):c.1187T>A (p.Leu396Gln) single nucleotide variant
Anemia, congenital dyserythropoietic, type IIIb [RCV004564729 ]
Chr12:49994283 [GRCh38]
pathogenic
NM_001319999.2(RACGAP1):c.1294C>T (p.Pro432Ser) single nucleotide variant
Anemia, congenital dyserythropoietic, type IIIb [RCV003320382 ]|Anemia, congenital dyserythropoietic, type IIIb, autosomal recessive [RCV001848616 ]
Chr12:49994176 [GRCh38]
pathogenic
GRCh37/hg19 12q13.12(chr12:50331947-50439383)x3 copy number gain
not provided [RCV002291539 ]
Chr12:50331947..50439383 [GRCh37]
uncertain significance
NM_001319999.2(RACGAP1):c.658A>G (p.Thr220Ala) single nucleotide variant
Anemia, congenital dyserythropoietic, type IIIb [RCV003320490 ]|Anemia, congenital dyserythropoietic, type IIIb, autosomal recessive [RCV002463185 ]
Chr12:49999706 [GRCh38]
pathogenic
NM_001319999.2(RACGAP1):c.49C>T (p.Arg17Cys) single nucleotide variant
not specified [RCV004208633 ]
Chr12:50016667 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1651G>A (p.Asp551Asn) single nucleotide variant
not specified [RCV004217736 ]
Chr12:49992061 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.395A>C (p.Gln132Pro) single nucleotide variant
not specified [RCV004217875 ]
Chr12:50005286 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1724T>C (p.Leu575Pro) single nucleotide variant
not specified [RCV004235339 ]
Chr12:49990783 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.991T>G (p.Cys331Gly) single nucleotide variant
not specified [RCV004088735 ]
Chr12:49997093 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.868G>A (p.Val290Ile) single nucleotide variant
not specified [RCV004154049 ]
Chr12:49999152 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.988C>G (p.Arg330Gly) single nucleotide variant
not specified [RCV004187580 ]
Chr12:49997096 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1532A>G (p.Asn511Ser) single nucleotide variant
not specified [RCV004112040 ]
Chr12:49992291 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.563G>A (p.Arg188Gln) single nucleotide variant
not specified [RCV004209666 ]
Chr12:50001239 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.586G>A (p.Gly196Arg) single nucleotide variant
not specified [RCV004194083 ]
Chr12:50001216 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1084A>T (p.Ile362Phe) single nucleotide variant
not specified [RCV004161006 ]
Chr12:49994470 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1627A>T (p.Met543Leu) single nucleotide variant
not specified [RCV004274854 ]
Chr12:49992085 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1234G>C (p.Val412Leu) single nucleotide variant
not specified [RCV004275828 ]
Chr12:49994236 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.776C>G (p.Ser259Cys) single nucleotide variant
not specified [RCV004337794 ]
Chr12:49999244 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1419A>G (p.Leu473=) single nucleotide variant
not provided [RCV003391804 ]
Chr12:49992576 [GRCh38]
likely benign
NM_001319999.2(RACGAP1):c.60G>C (p.Glu20Asp) single nucleotide variant
not specified [RCV004443390 ]
Chr12:50016656 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.341G>T (p.Ser114Ile) single nucleotide variant
not specified [RCV004443388 ]
Chr12:50005340 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1298T>C (p.Leu433Pro) single nucleotide variant
not specified [RCV004443382 ]
Chr12:49994172 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.236T>G (p.Val79Gly) single nucleotide variant
not specified [RCV004443387 ]
Chr12:50006486 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.982C>T (p.Arg328Trp) single nucleotide variant
not specified [RCV004443391 ]
Chr12:49997102 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1391A>G (p.Glu464Gly) single nucleotide variant
not specified [RCV004443383 ]
Chr12:49992604 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1660C>T (p.His554Tyr) single nucleotide variant
not specified [RCV004443385 ]
Chr12:49992052 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1832G>A (p.Ser611Asn) single nucleotide variant
not specified [RCV004443386 ]
Chr12:49990335 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1796G>A (p.Arg599His) single nucleotide variant
not specified [RCV004665102 ]
Chr12:49990711 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1172G>A (p.Arg391His) single nucleotide variant
not specified [RCV004669444 ]
Chr12:49994298 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.100G>A (p.Ala34Thr) single nucleotide variant
not specified [RCV004846854 ]
Chr12:50006622 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.724T>C (p.Trp242Arg) single nucleotide variant
not specified [RCV004846855 ]
Chr12:49999640 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.325T>C (p.Cys109Arg) single nucleotide variant
not specified [RCV004846856 ]
Chr12:50005356 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.682G>A (p.Gly228Arg) single nucleotide variant
not specified [RCV004846857 ]
Chr12:49999682 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1460C>T (p.Pro487Leu) single nucleotide variant
not specified [RCV004846859 ]
Chr12:49992363 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.25C>G (p.Arg9Gly) single nucleotide variant
not specified [RCV004846860 ]
Chr12:50016691 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.467T>C (p.Ile156Thr) single nucleotide variant
not specified [RCV004846861 ]
Chr12:50004263 [GRCh38]
uncertain significance
NM_001319999.2(RACGAP1):c.1778C>T (p.Ser593Phe) single nucleotide variant
not specified [RCV004846862 ]
Chr12:49990729 [GRCh38]
uncertain significance
Confirmed Target Of
MIR192 hsa-miR-192-5p Mirtarbase external_info Luciferase reporter assay//qRT-PCR//Microarray//Re Functional MTI 19074876
Predicted Target Of
Count of predictions: 4804 Count of miRNA genes: 1073 Interacting mature miRNAs: 1303 Transcripts: ENST00000312377, ENST00000427314, ENST00000434422, ENST00000454520, ENST00000546595, ENST00000546723, ENST00000546764, ENST00000546786, ENST00000547061, ENST00000547905, ENST00000548158, ENST00000548247, ENST00000548320, ENST00000548598, ENST00000548644, ENST00000548824, ENST00000548961, ENST00000549342, ENST00000549777, ENST00000550149, ENST00000550651, ENST00000551016, ENST00000551145, ENST00000551260, ENST00000551876, ENST00000552004, ENST00000552157, ENST00000552310, ENST00000552921 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597116586 GWAS1212660_H clostridium difficile infection QTL GWAS1212660 (human) 0.000003 clostridium difficile infection 12 49990566 49990567 Human 597306068 GWAS1402142_H sphingomyelin measurement QTL GWAS1402142 (human) 2e-14 sphingomyelin measurement 12 50001009 50001010 Human 597304916 GWAS1400990_H sphingomyelin measurement QTL GWAS1400990 (human) 4e-08 sphingomyelin measurement 12 50001009 50001010 Human 597272582 GWAS1368656_H X-12063 measurement QTL GWAS1368656 (human) 5e-08 X-12063 measurement 12 49991853 49991854 Human
RACGAP1_9584
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 50,383,080 - 50,383,647 UniSTS GRCh37 Build 36 12 48,669,347 - 48,669,914 RGD NCBI36 Celera 12 49,179,200 - 49,179,767 RGD HuRef 12 47,414,581 - 47,415,148 UniSTS
D12S2183
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 50,420,307 - 50,420,399 UniSTS GRCh37 Build 36 12 48,706,574 - 48,706,666 RGD NCBI36 Celera 12 49,216,304 - 49,216,396 RGD HuRef 12 47,452,548 - 47,452,640 UniSTS
STS-W72501
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 50,383,003 - 50,383,228 UniSTS GRCh37 GRCh37 12 45,456,204 - 45,456,430 UniSTS GRCh37 Build 36 12 43,742,471 - 43,742,697 RGD NCBI36 Celera 12 44,259,879 - 44,260,105 RGD Celera 12 49,179,123 - 49,179,348 UniSTS Cytogenetic Map 12 q12 UniSTS Cytogenetic Map 12 q13.12 UniSTS HuRef 12 47,414,504 - 47,414,729 UniSTS HuRef 12 42,484,548 - 42,484,774 UniSTS GeneMap99-GB4 RH Map 12 195.96 UniSTS
WI-17598
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 50,419,477 - 50,419,626 UniSTS GRCh37 Build 36 12 48,705,744 - 48,705,893 RGD NCBI36 Celera 12 49,215,474 - 49,215,623 RGD Cytogenetic Map 12 q13.12 UniSTS HuRef 12 47,451,718 - 47,451,867 UniSTS GeneMap99-GB4 RH Map 12 226.06 UniSTS Whitehead-RH Map 12 324.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2251
4973
1726
2351
5
624
1951
465
2269
7303
6469
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000312377 ⟹ ENSP00000309871
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,989,162 - 50,025,494 (-) Ensembl
Ensembl Acc Id:
ENST00000427314 ⟹ ENSP00000404190
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,989,162 - 50,025,438 (-) Ensembl
Ensembl Acc Id:
ENST00000454520 ⟹ ENSP00000404808
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,989,164 - 50,025,400 (-) Ensembl
Ensembl Acc Id:
ENST00000546595 ⟹ ENSP00000449963
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,001,172 - 50,025,416 (-) Ensembl
Ensembl Acc Id:
ENST00000546723 ⟹ ENSP00000449669
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,004,265 - 50,025,436 (-) Ensembl
Ensembl Acc Id:
ENST00000546764 ⟹ ENSP00000447177
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,005,264 - 50,025,483 (-) Ensembl
Ensembl Acc Id:
ENST00000546786 ⟹ ENSP00000447429
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,001,171 - 50,025,463 (-) Ensembl
Ensembl Acc Id:
ENST00000547061
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,997,069 - 50,002,691 (-) Ensembl
Ensembl Acc Id:
ENST00000547905 ⟹ ENSP00000449370
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,990,268 - 50,025,494 (-) Ensembl
Ensembl Acc Id:
ENST00000548158
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,999,310 - 50,004,271 (-) Ensembl
Ensembl Acc Id:
ENST00000548247 ⟹ ENSP00000450074
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,005,256 - 50,033,136 (-) Ensembl
Ensembl Acc Id:
ENST00000548320 ⟹ ENSP00000448507
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,997,131 - 50,025,493 (-) Ensembl
Ensembl Acc Id:
ENST00000548598 ⟹ ENSP00000449574
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,997,160 - 50,025,461 (-) Ensembl
Ensembl Acc Id:
ENST00000548644 ⟹ ENSP00000449620
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,004,234 - 50,025,451 (-) Ensembl
Ensembl Acc Id:
ENST00000548824 ⟹ ENSP00000449170
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,002,272 - 50,025,434 (-) Ensembl
Ensembl Acc Id:
ENST00000548961 ⟹ ENSP00000446889
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,976,923 - 49,992,358 (-) Ensembl
Ensembl Acc Id:
ENST00000549342 ⟹ ENSP00000449565
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,992,079 - 49,999,736 (-) Ensembl
Ensembl Acc Id:
ENST00000549777 ⟹ ENSP00000448707
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,005,294 - 50,025,435 (-) Ensembl
Ensembl Acc Id:
ENST00000550149 ⟹ ENSP00000446642
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,999,675 - 50,025,477 (-) Ensembl
Ensembl Acc Id:
ENST00000550651 ⟹ ENSP00000449959
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,005,347 - 50,025,494 (-) Ensembl
Ensembl Acc Id:
ENST00000551016 ⟹ ENSP00000449374
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,989,979 - 50,016,720 (-) Ensembl
Ensembl Acc Id:
ENST00000551145 ⟹ ENSP00000450064
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,002,248 - 50,025,518 (-) Ensembl
Ensembl Acc Id:
ENST00000551260 ⟹ ENSP00000448860
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,004,234 - 50,025,435 (-) Ensembl
Ensembl Acc Id:
ENST00000551876 ⟹ ENSP00000449186
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,005,291 - 50,017,084 (-) Ensembl
Ensembl Acc Id:
ENST00000552004 ⟹ ENSP00000448136
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,005,358 - 50,025,488 (-) Ensembl
Ensembl Acc Id:
ENST00000552157 ⟹ ENSP00000448968
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,005,256 - 50,025,443 (-) Ensembl
Ensembl Acc Id:
ENST00000552310 ⟹ ENSP00000448697
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 49,999,139 - 50,025,448 (-) Ensembl
Ensembl Acc Id:
ENST00000552921 ⟹ ENSP00000447393
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 50,004,278 - 50,025,557 (-) Ensembl
RefSeq Acc Id:
NM_001126103 ⟹ NP_001119575
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI GRCh37 12 50,382,945 - 50,425,586 (-) NCBI HuRef 12 47,414,446 - 47,451,548 (-) ENTREZGENE CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTGAAGGGTGGCCCAGGTGGGGCCAGGCTGACTGAATGTATCTCCTAGCTATGGACTAAATAATACA
hide sequence
RefSeq Acc Id:
NM_001126104 ⟹ NP_001119576
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI GRCh37 12 50,382,945 - 50,425,586 (-) NCBI HuRef 12 47,414,446 - 47,451,548 (-) ENTREZGENE CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTGAAGGGTGGCCCAGGTGGGGCCAGGCTGACTGAAGTGAGTAGTGGGGGTGCCAGACCAGGTGCGT
hide sequence
RefSeq Acc Id:
NM_001319999 ⟹ NP_001306928
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTGAAGGGTGGCCCAGGTGGGGCCAGGCTGACTGAAAAAGATGGATACTATGATGCTGAATGTGCGG
hide sequence
RefSeq Acc Id:
NM_001320000 ⟹ NP_001306929
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTG
hide sequence
RefSeq Acc Id:
NM_001320001 ⟹ NP_001306930
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTG
hide sequence
RefSeq Acc Id:
NM_001320002 ⟹ NP_001306931
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTG
hide sequence
RefSeq Acc Id:
NM_001320003 ⟹ NP_001306932
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTGAAGGGTGGCCCAGGTGGGGCCAGGCTGACTGAAATGGATACTATGATGCTGAATGTGCGGAATC
hide sequence
RefSeq Acc Id:
NM_001320004 ⟹ NP_001306933
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGAAAGATGGATACTATGATGC
hide sequence
RefSeq Acc Id:
NM_001320005 ⟹ NP_001306934
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTG
hide sequence
RefSeq Acc Id:
NM_001320006 ⟹ NP_001306935
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTG
hide sequence
RefSeq Acc Id:
NM_001320007 ⟹ NP_001306936
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTG
hide sequence
RefSeq Acc Id:
NM_013277 ⟹ NP_037409
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI GRCh37 12 50,382,945 - 50,425,586 (-) NCBI Build 36 12 48,669,212 - 48,705,488 (-) NCBI Archive HuRef 12 47,414,446 - 47,451,548 (-) ENTREZGENE CHM1_1 12 50,349,102 - 50,385,496 (-) NCBI T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
Sequence:
GTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTG
hide sequence
RefSeq Acc Id:
XM_006719359 ⟹ XP_006719422
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
Sequence:
AGTGAAGGGTGGCCCAGGTGGGGCCAGGCTGACTGAAGTGAGTAGTGGGGGTGCCAGACCAGAT
hide sequence
RefSeq Acc Id:
XM_011538238 ⟹ XP_011536540
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,031,715 (-) NCBI
Sequence:
AGTTTAAACTGTCTAGAGGATGGATACTATGATGCTGAATGTGCGGAATCTGTTTGAGCAGCTT
hide sequence
RefSeq Acc Id:
XM_017019221 ⟹ XP_016874710
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
Sequence:
TGGTTGGTGAAGGTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCG
hide sequence
RefSeq Acc Id:
XM_017019222 ⟹ XP_016874711
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
Sequence:
TGGTTGGTGAAGGTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCGCGGAGCGAAGTGAAGGGTGGCCCAGGTGGGGCCAGGCTGACTGAAGTGAGTAGTGGGGGTGCCA
hide sequence
RefSeq Acc Id:
XM_017019223 ⟹ XP_016874712
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
Sequence:
GAAGTGAGTAGTGGGGGTGCCAGACCAGGTGCGTCTGCCGCTGGATTGTGATAGGAAGCAGAGTGTTCGTGTGATGGATACTATGATGCTGAATGTGCGGAATCTGTTTGAGCAGCTTGTGCGCCGGG
hide sequence
RefSeq Acc Id:
XM_017019224 ⟹ XP_016874713
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
Sequence:
TGGTTGGTGAAGGTTTTCAAACCGGAGCTGTGGGCGCGGCGCTGCTCTGCCGTTGGGTGAGGCG
hide sequence
RefSeq Acc Id:
XM_017019225 ⟹ XP_016874714
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
Sequence:
GGGGGTGCCAGACCAGATGGATACTATGATGCTGAATGTGCGGAATCTGTTTGAGCAGCTTGTG
hide sequence
RefSeq Acc Id:
XM_017019226 ⟹ XP_016874715
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,018,589 (-) NCBI
Sequence:
GAGAGCCAAAGGAAATCAACATTTGAATTGACTACCCAATGTCCTGCCCCTGTTTCTGTCCTGTAGCACTTAGGAAAGATGGATACTATGATGCTGAATGTGCGGAATCTGTTTGAGCAGCTTGTGCG
hide sequence
RefSeq Acc Id:
XM_017019227 ⟹ XP_016874716
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
Sequence:
GTAGAGGGACGGCGCGGGAGGAATAAATTTCTCTGTGATTGGTTGGTGAAGGTTTTCAAACCGG
hide sequence
RefSeq Acc Id:
XM_024448958 ⟹ XP_024304726
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,033,440 (-) NCBI
Sequence:
GGGGAACGATAATCCTGGATGGGAGGTAGGGAGCCAGACCTCCAGAGGGCAAGTGAGAAGGCCA
hide sequence
RefSeq Acc Id:
XM_047428745 ⟹ XP_047284701
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
RefSeq Acc Id:
XM_047428746 ⟹ XP_047284702
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
RefSeq Acc Id:
XM_047428747 ⟹ XP_047284703
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
RefSeq Acc Id:
XM_047428748 ⟹ XP_047284704
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
RefSeq Acc Id:
XM_047428749 ⟹ XP_047284705
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
RefSeq Acc Id:
XM_047428750 ⟹ XP_047284706
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
RefSeq Acc Id:
XM_047428751 ⟹ XP_047284707
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 49,989,162 - 50,025,494 (-) NCBI
RefSeq Acc Id:
XM_054371859 ⟹ XP_054227834
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,996,504 (-) NCBI
RefSeq Acc Id:
XM_054371860 ⟹ XP_054227835
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371861 ⟹ XP_054227836
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371862 ⟹ XP_054227837
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371863 ⟹ XP_054227838
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371864 ⟹ XP_054227839
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371865 ⟹ XP_054227840
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371866 ⟹ XP_054227841
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371867 ⟹ XP_054227842
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,994,778 (-) NCBI
RefSeq Acc Id:
XM_054371868 ⟹ XP_054227843
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371869 ⟹ XP_054227844
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371870 ⟹ XP_054227845
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371871 ⟹ XP_054227846
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,981,633 (-) NCBI
RefSeq Acc Id:
XM_054371872 ⟹ XP_054227847
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371873 ⟹ XP_054227848
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371874 ⟹ XP_054227849
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
XM_054371875 ⟹ XP_054227850
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 49,952,172 - 49,988,556 (-) NCBI
RefSeq Acc Id:
NP_001119575 ⟸ NM_001126103
- Peptide Label:
isoform a
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFL
hide sequence
RefSeq Acc Id:
NP_037409 ⟸ NM_013277
- Peptide Label:
isoform a
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFL
hide sequence
RefSeq Acc Id:
NP_001119576 ⟸ NM_001126104
- Peptide Label:
isoform a
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFL
hide sequence
RefSeq Acc Id:
XP_006719422 ⟸ XM_006719359
- Peptide Label:
isoform X3
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFL
hide sequence
RefSeq Acc Id:
XP_011536540 ⟸ XM_011538238
- Peptide Label:
isoform X3
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFL
hide sequence
RefSeq Acc Id:
NP_001306933 ⟸ NM_001320004
- Peptide Label:
isoform a
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFL
hide sequence
RefSeq Acc Id:
NP_001306934 ⟸ NM_001320005
- Peptide Label:
isoform b
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRST
hide sequence
RefSeq Acc Id:
NP_001306932 ⟸ NM_001320003
- Peptide Label:
isoform a
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETE
hide sequence
RefSeq Acc Id:
NP_001306936 ⟸ NM_001320007
- Peptide Label:
isoform d
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MCGICLSSLCAGWRFSVKEMKSERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNA
hide sequence
RefSeq Acc Id:
NP_001306928 ⟸ NM_001319999
- Peptide Label:
isoform a
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFL
hide sequence
RefSeq Acc Id:
NP_001306935 ⟸ NM_001320006
- Peptide Label:
isoform c
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MSCPCFCPVALRMDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQ
hide sequence
RefSeq Acc Id:
NP_001306929 ⟸ NM_001320000
- Peptide Label:
isoform a
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETE
hide sequence
RefSeq Acc Id:
NP_001306931 ⟸ NM_001320002
- Peptide Label:
isoform a
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETE
hide sequence
RefSeq Acc Id:
NP_001306930 ⟸ NM_001320001
- Peptide Label:
isoform a
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETE
hide sequence
RefSeq Acc Id:
XP_016874716 ⟸ XM_017019227
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MCGICLSSLCAGWRFSVKEMKSERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNA
hide sequence
RefSeq Acc Id:
XP_016874713 ⟸ XM_017019224
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MCGICLSSLCAGWRFSVKEMKSERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTR
hide sequence
RefSeq Acc Id:
XP_016874711 ⟸ XM_017019222
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MCGICLSSLCAGWRFSVKEMKSERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNA
hide sequence
RefSeq Acc Id:
XP_016874712 ⟸ XM_017019223
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MCGICLSSLCAGWRFSVKEMKSERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTR
hide sequence
RefSeq Acc Id:
XP_016874710 ⟸ XM_017019221
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MCGICLSSLCAGWRFSVKEMKSERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNA
hide sequence
RefSeq Acc Id:
XP_016874714 ⟸ XM_017019225
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MCGICLSSLCAGWRFSVKEMKSERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTR
hide sequence
RefSeq Acc Id:
XP_016874715 ⟸ XM_017019226
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MCGICLSSLCAGWRFSVKEMKSERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNA
hide sequence
RefSeq Acc Id:
XP_024304726 ⟸ XM_024448958
- Peptide Label:
isoform X1
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
- Sequence:
MPKARTQASAFKFKLSRGKMDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMC
hide sequence
Ensembl Acc Id:
ENSP00000404190 ⟸ ENST00000427314
Ensembl Acc Id:
ENSP00000449963 ⟸ ENST00000546595
Ensembl Acc Id:
ENSP00000447429 ⟸ ENST00000546786
Ensembl Acc Id:
ENSP00000447177 ⟸ ENST00000546764
Ensembl Acc Id:
ENSP00000449669 ⟸ ENST00000546723
Ensembl Acc Id:
ENSP00000449370 ⟸ ENST00000547905
Ensembl Acc Id:
ENSP00000404808 ⟸ ENST00000454520
Ensembl Acc Id:
ENSP00000449170 ⟸ ENST00000548824
Ensembl Acc Id:
ENSP00000449620 ⟸ ENST00000548644
Ensembl Acc Id:
ENSP00000449574 ⟸ ENST00000548598
Ensembl Acc Id:
ENSP00000446889 ⟸ ENST00000548961
Ensembl Acc Id:
ENSP00000448507 ⟸ ENST00000548320
Ensembl Acc Id:
ENSP00000450074 ⟸ ENST00000548247
Ensembl Acc Id:
ENSP00000449565 ⟸ ENST00000549342
Ensembl Acc Id:
ENSP00000448707 ⟸ ENST00000549777
Ensembl Acc Id:
ENSP00000309871 ⟸ ENST00000312377
Ensembl Acc Id:
ENSP00000446642 ⟸ ENST00000550149
Ensembl Acc Id:
ENSP00000449959 ⟸ ENST00000550651
Ensembl Acc Id:
ENSP00000450064 ⟸ ENST00000551145
Ensembl Acc Id:
ENSP00000449374 ⟸ ENST00000551016
Ensembl Acc Id:
ENSP00000448860 ⟸ ENST00000551260
Ensembl Acc Id:
ENSP00000449186 ⟸ ENST00000551876
Ensembl Acc Id:
ENSP00000448136 ⟸ ENST00000552004
Ensembl Acc Id:
ENSP00000448697 ⟸ ENST00000552310
Ensembl Acc Id:
ENSP00000448968 ⟸ ENST00000552157
Ensembl Acc Id:
ENSP00000447393 ⟸ ENST00000552921
RefSeq Acc Id:
XP_047284706 ⟸ XM_047428750
- Peptide Label:
isoform X3
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047284704 ⟸ XM_047428748
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047284703 ⟸ XM_047428747
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047284707 ⟸ XM_047428751
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047284702 ⟸ XM_047428746
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047284705 ⟸ XM_047428749
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047284701 ⟸ XM_047428745
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227834 ⟸ XM_054371859
- Peptide Label:
isoform X1
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227842 ⟸ XM_054371867
- Peptide Label:
isoform X3
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227850 ⟸ XM_054371875
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227847 ⟸ XM_054371872
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227841 ⟸ XM_054371866
- Peptide Label:
isoform X3
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227838 ⟸ XM_054371863
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227837 ⟸ XM_054371862
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227849 ⟸ XM_054371874
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227836 ⟸ XM_054371861
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227848 ⟸ XM_054371873
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227840 ⟸ XM_054371865
- Peptide Label:
isoform X3
- UniProtKB:
Q9P250 (UniProtKB/Swiss-Prot), Q9NWN2 (UniProtKB/Swiss-Prot), Q9H0H5 (UniProtKB/Swiss-Prot), Q6PJ26 (UniProtKB/Swiss-Prot), Q9P2W2 (UniProtKB/Swiss-Prot), B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227844 ⟸ XM_054371869
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227839 ⟸ XM_054371864
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227845 ⟸ XM_054371870
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227843 ⟸ XM_054371868
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227835 ⟸ XM_054371860
- Peptide Label:
isoform X2
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054227846 ⟸ XM_054371871
- Peptide Label:
isoform X4
- UniProtKB:
B2RE34 (UniProtKB/TrEMBL)
RGD ID: 6790414 Promoter ID: HG_KWN:15591 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_001126103, NM_001126104, NM_013277, UC001RVU.2 Position: Human Assembly Chr Position (strand) Source Build 36 12 48,705,364 - 48,705,864 (-) MPROMDB
RGD ID: 6852692 Promoter ID: EP74158 Type: single initiation site Name: HS_RACGAP1 Description: Rac GTPase activating protein 1. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning Position: Human Assembly Chr Position (strand) Source Build 36 12 48,705,544 - 48,705,604 EPD
RGD ID: 6810384 Promoter ID: HG_ACW:16884 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: NB4 Transcripts: RACGAP1.VEAPR07 Position: Human Assembly Chr Position (strand) Source Build 36 12 48,713,216 - 48,713,716 (-) MPROMDB
RGD ID: 7223869 Promoter ID: EPDNEW_H17680 Type: initiation region Name: RACGAP1_1 Description: Rac GTPase activating protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 12 50,025,452 - 50,025,512 EPDNEW
