Symbol:
Trp53bp2
Name:
transformation related protein 53 binding protein 2
RGD ID:
1313501
MGI Page
MGI
Description:
Predicted to enable NF-kappaB binding activity; p53 binding activity; and protein homodimerization activity. Acts upstream of or within several processes, including embryo development; heart development; and response to ionizing radiation. Predicted to be located in cell junction and cytosol. Predicted to be active in nucleus. Predicted to colocalize with perinuclear region of cytoplasm. Is expressed in several structures, including alimentary system; brain; respiratory system; sensory organ; and urinary system. Used to study chromosome 1q41-q42 deletion syndrome. Orthologous to human TP53BP2 (tumor protein p53 binding protein 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
53BP; 53BP2; A; AI746547; apoptosis-stimulating of p53 protein 2; ASPP2; expressed sequence AI746547; p53-binding protein 2; p53BP2; PPP1R13A; Tp53bp2; tumor protein p53 binding protein, 2; tumor suppressor p53-binding protein 2; X98550
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TP53BP2 (tumor protein p53 binding protein 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
Tp53bp2 (tumor protein p53 binding protein, 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tp53bp2 (tumor protein p53 binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TP53BP2 (tumor protein p53 binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TP53BP2 (tumor protein p53 binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tp53bp2 (tumor protein p53 binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TP53BP2 (tumor protein p53 binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TP53BP2 (tumor protein p53 binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tp53bp2 (tumor protein p53 binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PPP1R13B (protein phosphatase 1 regulatory subunit 13B) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tp53bp2 (tumor protein p53 binding protein, 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TP53BP2 (tumor protein p53 binding protein 2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tp53bp2a (tumor protein p53 binding protein, 2a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
tp53bp2b (tumor protein p53 binding protein, 2b)
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Drosophila melanogaster (fruit fly):
ASPP
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ape-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
tp53bp2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 182,236,737 - 182,289,997 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 182,236,737 - 182,289,997 (+) Ensembl GRCm39 Ensembl GRCm38 1 182,409,167 - 182,462,436 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 182,409,172 - 182,462,432 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 184,339,298 - 184,392,567 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 184,265,679 - 184,299,107 (+) NCBI MGSCv36 mm8 Celera 1 189,451,621 - 189,504,880 (+) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 84.93 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Trp53bp2 Mouse (S)-naringenin multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 [naringenin metabolite co-treated with bisphenol A] results in increased expression of TP53BP2 mRNA CTD PMID:36235125 Trp53bp2 Mouse 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 o and p'-DDT results in increased expression of TP53BP2 mRNA CTD PMID:22937105 Trp53bp2 Mouse 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane decreases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 o and p'-DDT analog results in decreased expression of TP53BP2 mRNA CTD PMID:22937105 Trp53bp2 Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of TRP53BP2 mRNA CTD PMID:26682919 Trp53bp2 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of TRP53BP2 mRNA CTD PMID:22206623 Trp53bp2 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of TRP53BP2 mRNA CTD PMID:17555576 Trp53bp2 Mouse 17beta-estradiol increases expression ISO TP53BP2 (Homo sapiens) 6480464 Estradiol results in increased expression of TP53BP2 mRNA CTD PMID:20106945 Trp53bp2 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TRP53BP2 mRNA CTD PMID:39298647 Trp53bp2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TRP53BP2 mRNA CTD PMID:21570461 Trp53bp2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TP53BP2 mRNA CTD PMID:33387578 Trp53bp2 Mouse 2,4-dinitrotoluene affects expression ISO Tp53bp2 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of TRP53BP2 mRNA CTD PMID:21346803 Trp53bp2 Mouse 2,6-dinitrotoluene affects expression ISO Tp53bp2 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of TRP53BP2 mRNA CTD PMID:21346803 Trp53bp2 Mouse 2-methylcholine affects expression ISO TP53BP2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of TP53BP2 mRNA CTD PMID:21179406 Trp53bp2 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of TRP53BP2 mRNA CTD PMID:26251327 Trp53bp2 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of TP53BP2 mRNA CTD PMID:28628672 Trp53bp2 Mouse 3-methyladenine multiple interactions EXP 6480464 TRP53BP2 protein affects the reaction [3-methyladenine results in increased expression of GPT protein] more ... CTD PMID:31513885 Trp53bp2 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of TP53BP2 mRNA CTD PMID:28628672 Trp53bp2 Mouse 4,4'-sulfonyldiphenol decreases methylation ISO TP53BP2 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of TP53BP2 gene CTD PMID:31601247 Trp53bp2 Mouse 4,4'-sulfonyldiphenol increases expression ISO TP53BP2 (Homo sapiens) 6480464 bisphenol S results in increased expression of TP53BP2 mRNA CTD PMID:33312107 Trp53bp2 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of TRP53BP2 mRNA CTD PMID:39298647 Trp53bp2 Mouse aflatoxin B1 decreases methylation ISO TP53BP2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TP53BP2 intron CTD PMID:30157460 Trp53bp2 Mouse amphetamine decreases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 Amphetamine results in decreased expression of TP53BP2 mRNA CTD PMID:30779732 Trp53bp2 Mouse aristolochic acid A decreases expression ISO TP53BP2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TP53BP2 mRNA CTD PMID:33212167 Trp53bp2 Mouse arsenite(3-) multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to TP53BP2 mRNA] CTD PMID:32406909 Trp53bp2 Mouse benzo[a]pyrene decreases expression ISO TP53BP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TP53BP2 mRNA CTD PMID:26238291 Trp53bp2 Mouse benzo[a]pyrene increases methylation ISO TP53BP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TP53BP2 promoter CTD PMID:27901495 Trp53bp2 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO TP53BP2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Trp53bp2 Mouse bis(2-chloroethyl) sulfide decreases expression EXP 6480464 Mustard Gas results in decreased expression of TRP53BP2 mRNA CTD PMID:18955075 Trp53bp2 Mouse bisphenol A decreases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of TP53BP2 mRNA CTD PMID:25181051 Trp53bp2 Mouse bisphenol A multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 [naringenin metabolite co-treated with bisphenol A] results in increased expression of TP53BP2 mRNA CTD PMID:36235125 Trp53bp2 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TRP53BP2 mRNA CTD PMID:32156529 Trp53bp2 Mouse bisphenol A decreases expression ISO TP53BP2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TP53BP2 mRNA CTD PMID:36235125 Trp53bp2 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TRP53BP2 mRNA CTD PMID:33221593 Trp53bp2 Mouse bisphenol A increases expression ISO TP53BP2 (Homo sapiens) 6480464 bisphenol A results in increased expression of TP53BP2 mRNA CTD PMID:33312107 Trp53bp2 Mouse bisphenol A increases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of TP53BP2 mRNA CTD PMID:30816183 Trp53bp2 Mouse bisphenol F increases expression ISO TP53BP2 (Homo sapiens) 6480464 bisphenol F results in increased expression of TP53BP2 mRNA CTD PMID:33312107 Trp53bp2 Mouse cadmium atom multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TP53BP2 mRNA CTD PMID:35301059 Trp53bp2 Mouse cadmium dichloride increases expression ISO TP53BP2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TP53BP2 mRNA CTD PMID:12160620 Trp53bp2 Mouse cadmium dichloride multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TP53BP2 mRNA CTD PMID:35301059 Trp53bp2 Mouse caffeine increases phosphorylation ISO TP53BP2 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of TP53BP2 protein CTD PMID:35688186 Trp53bp2 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Trp53bp2 Mouse CGP 52608 multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TP53BP2 gene] CTD PMID:28238834 Trp53bp2 Mouse ciguatoxin CTX1B affects expression EXP 6480464 Ciguatoxins affects the expression of TRP53BP2 mRNA CTD PMID:18353800 Trp53bp2 Mouse coumarin increases phosphorylation ISO TP53BP2 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of TP53BP2 protein CTD PMID:35688186 Trp53bp2 Mouse cyclosporin A increases expression ISO TP53BP2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TP53BP2 mRNA CTD PMID:20106945 and PMID:25562108 Trp53bp2 Mouse DDT increases methylation ISO Tp53bp2 (Rattus norvegicus) 6480464 DDT results in increased methylation of TP53BP2 gene CTD PMID:30207508 Trp53bp2 Mouse dexamethasone multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of TP53BP2 mRNA CTD PMID:28628672 Trp53bp2 Mouse diazinon affects expression ISO Tp53bp2 (Rattus norvegicus) 6480464 Diazinon affects the expression of TP53BP2 mRNA CTD PMID:22546817 Trp53bp2 Mouse Dibutyl phosphate affects expression ISO TP53BP2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TP53BP2 mRNA CTD PMID:37042841 Trp53bp2 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TRP53BP2 mRNA CTD PMID:30529165 Trp53bp2 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of TRP53BP2 mRNA CTD PMID:30319688 Trp53bp2 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of TRP53BP2 mRNA CTD PMID:30319688 Trp53bp2 Mouse fluoranthene multiple interactions EXP 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of TRP53BP2 mRNA CTD PMID:28329830 Trp53bp2 Mouse FR900359 affects phosphorylation ISO TP53BP2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TP53BP2 protein CTD PMID:37730182 Trp53bp2 Mouse hexadecanoic acid decreases phosphorylation ISO TP53BP2 (Homo sapiens) 6480464 Palmitic Acid results in decreased phosphorylation of TP53BP2 protein CTD PMID:28073184 Trp53bp2 Mouse hydrogen peroxide multiple interactions EXP 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Trp53bp2 Mouse indometacin multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of TP53BP2 mRNA CTD PMID:28628672 Trp53bp2 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TRP53BP2 mRNA CTD PMID:36331819 Trp53bp2 Mouse kojic acid increases expression ISO TP53BP2 (Homo sapiens) 6480464 kojic acid results in increased expression of TP53BP2 mRNA CTD PMID:16595896 Trp53bp2 Mouse lead(0) affects expression ISO TP53BP2 (Homo sapiens) 6480464 Lead affects the expression of TP53BP2 mRNA CTD PMID:28903495 Trp53bp2 Mouse methyl methanesulfonate increases expression ISO TP53BP2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of TP53BP2 mRNA CTD PMID:23649840 Trp53bp2 Mouse Mitotane increases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 Mitotane results in increased expression of TP53BP2 mRNA CTD PMID:23485034 Trp53bp2 Mouse nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of TP53BP2 mRNA CTD PMID:12540486 Trp53bp2 Mouse okadaic acid increases expression ISO TP53BP2 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of TP53BP2 mRNA CTD PMID:38832940 Trp53bp2 Mouse p-menthan-3-ol increases expression ISO TP53BP2 (Homo sapiens) 6480464 Menthol results in increased expression of TP53BP2 mRNA CTD PMID:26760959 Trp53bp2 Mouse paracetamol increases expression ISO TP53BP2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TP53BP2 mRNA CTD PMID:21420995 Trp53bp2 Mouse paracetamol increases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of TP53BP2 mRNA CTD PMID:33387578 Trp53bp2 Mouse paraquat increases expression ISO TP53BP2 (Homo sapiens) 6480464 Paraquat results in increased expression of TP53BP2 mRNA CTD PMID:18836921 and PMID:19526292 Trp53bp2 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TRP53BP2 mRNA CTD PMID:36331819 Trp53bp2 Mouse phenobarbital affects expression ISO TP53BP2 (Homo sapiens) 6480464 Phenobarbital affects the expression of TP53BP2 mRNA CTD PMID:19159669 Trp53bp2 Mouse phenytoin increases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 Phenytoin results in increased expression of TRP53BP2 mRNA CTD PMID:20345932 Trp53bp2 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of TRP53BP2 mRNA CTD PMID:18301758 Trp53bp2 Mouse quercetin increases expression ISO TP53BP2 (Homo sapiens) 6480464 Quercetin results in increased expression of TP53BP2 mRNA CTD PMID:15309432 Trp53bp2 Mouse resveratrol decreases expression ISO TP53BP2 (Homo sapiens) 6480464 resveratrol results in decreased expression of TP53BP2 protein CTD PMID:18089832 Trp53bp2 Mouse resveratrol multiple interactions ISO TP53BP2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of TP53BP2 mRNA CTD PMID:23557933 Trp53bp2 Mouse resveratrol decreases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 resveratrol results in decreased expression of TP53BP2 mRNA CTD PMID:25905778 Trp53bp2 Mouse silicon dioxide increases expression ISO TP53BP2 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of TP53BP2 mRNA CTD PMID:25351596 Trp53bp2 Mouse sodium arsenite increases expression ISO TP53BP2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TP53BP2 mRNA CTD PMID:38568856 Trp53bp2 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of TRP53BP2 mRNA CTD PMID:17555576 Trp53bp2 Mouse tetrachloromethane increases response to substance EXP 6480464 TRP53BP2 protein results in increased susceptibility to Carbon Tetrachloride CTD PMID:31513885 Trp53bp2 Mouse tetrachloromethane multiple interactions EXP 6480464 [TRP53BP2 protein affects the susceptibility to Carbon Tetrachloride] which affects the expression of ATG5 protein more ... CTD PMID:31513885 Trp53bp2 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TRP53BP2 protein CTD PMID:31513885 Trp53bp2 Mouse thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of TRP53BP2 protein CTD PMID:24648495 Trp53bp2 Mouse thiram increases expression ISO TP53BP2 (Homo sapiens) 6480464 Thiram results in increased expression of TP53BP2 mRNA CTD PMID:38568856 Trp53bp2 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of TRP53BP2 mRNA CTD PMID:27760801 Trp53bp2 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of TRP53BP2 gene CTD PMID:35295148 Trp53bp2 Mouse trichloroethene decreases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of TP53BP2 mRNA CTD PMID:33387578 Trp53bp2 Mouse tunicamycin increases expression ISO TP53BP2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of TP53BP2 mRNA CTD PMID:33545341 Trp53bp2 Mouse urethane increases expression ISO TP53BP2 (Homo sapiens) 6480464 Urethane results in increased expression of TP53BP2 mRNA CTD PMID:28818685 Trp53bp2 Mouse valproic acid affects expression ISO TP53BP2 (Homo sapiens) 6480464 Valproic Acid affects the expression of TP53BP2 mRNA CTD PMID:25979313 Trp53bp2 Mouse vinclozolin decreases expression ISO Tp53bp2 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of TP53BP2 mRNA CTD PMID:23034163 Trp53bp2 Mouse vinclozolin increases methylation ISO Tp53bp2 (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of TP53BP2 gene CTD PMID:31079544 Trp53bp2 Mouse vinclozolin decreases methylation ISO Tp53bp2 (Rattus norvegicus) 6480464 vinclozolin results in decreased methylation of TP53BP2 gene CTD PMID:31079544
(S)-naringenin (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methyladenine (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) aflatoxin B1 (ISO) amphetamine (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) ciguatoxin CTX1B (EXP) coumarin (ISO) cyclosporin A (ISO) DDT (ISO) dexamethasone (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dioxygen (EXP) ethanol (EXP) fluoranthene (EXP) FR900359 (ISO) hexadecanoic acid (ISO) hydrogen peroxide (EXP) indometacin (ISO) inulin (EXP) kojic acid (ISO) lead(0) (ISO) methyl methanesulfonate (ISO) Mitotane (ISO) nickel atom (EXP) okadaic acid (ISO) p-menthan-3-ol (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (ISO) phenytoin (ISO) pirinixic acid (EXP) quercetin (ISO) resveratrol (ISO) silicon dioxide (ISO) sodium arsenite (ISO) tamoxifen (EXP) tetrachloromethane (EXP) thapsigargin (EXP) thiram (ISO) titanium dioxide (EXP) trichloroethene (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (ISO)
Trp53bp2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 182,236,737 - 182,289,997 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 182,236,737 - 182,289,997 (+) Ensembl GRCm39 Ensembl GRCm38 1 182,409,167 - 182,462,436 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 182,409,172 - 182,462,432 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 184,339,298 - 184,392,567 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 184,265,679 - 184,299,107 (+) NCBI MGSCv36 mm8 Celera 1 189,451,621 - 189,504,880 (+) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 84.93 NCBI
TP53BP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 223,779,893 - 223,845,947 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 223,779,893 - 223,845,954 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 223,967,595 - 224,033,649 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 222,034,218 - 222,100,297 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 220,274,525 - 220,340,354 NCBI Celera 1 197,123,518 - 197,189,585 (-) NCBI Celera Cytogenetic Map 1 q41 NCBI HuRef 1 194,580,009 - 194,645,609 (-) NCBI HuRef CHM1_1 1 225,239,932 - 225,305,937 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 222,969,626 - 223,035,675 (-) NCBI T2T-CHM13v2.0
Tp53bp2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 96,620,429 - 96,677,090 (+) NCBI GRCr8 mRatBN7.2 13 94,088,769 - 94,145,436 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 94,088,709 - 94,145,432 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 13 100,817,206 - 100,873,837 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 100,817,359 - 100,873,890 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 105,753,296 - 105,809,937 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 98,432,144 - 98,468,555 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 98,637,078 - 98,657,218 (+) NCBI Celera 13 93,622,140 - 93,678,598 (+) NCBI Celera Cytogenetic Map 13 q26 NCBI
Tp53bp2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955520 1,257,216 - 1,285,322 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955520 1,254,853 - 1,285,118 (+) NCBI ChiLan1.0 ChiLan1.0
TP53BP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 25,522,290 - 25,587,973 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 25,478,188 - 25,543,881 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 199,403,194 - 199,469,079 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 204,414,218 - 204,455,684 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 204,414,218 - 204,457,739 (-) Ensembl panpan1.1 panPan2
TP53BP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 40,296,278 - 40,329,818 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 40,252,697 - 40,329,828 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 39,756,134 - 39,812,065 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 40,106,096 - 40,162,517 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 40,106,090 - 40,162,517 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 39,948,627 - 40,004,493 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 39,956,926 - 40,012,835 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 40,225,931 - 40,281,873 (+) NCBI UU_Cfam_GSD_1.0
Tp53bp2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 53,747,260 - 53,810,316 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936526 936,359 - 1,000,076 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936526 936,981 - 1,000,070 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TP53BP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 19,823,936 - 19,889,869 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 19,823,932 - 19,889,883 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 24,461,166 - 24,527,522 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TP53BP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 5,774,037 - 5,841,620 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 5,774,063 - 5,841,709 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 5,987,406 - 6,055,398 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tp53bp2
.
Predicted Target Of
Count of predictions: 224 Count of miRNA genes: 183 Interacting mature miRNAs: 198 Transcripts: ENSMUST00000117245 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357620 Aaj1_m anxiety in A/J 1 (mouse) Not determined 1 180832317 191851043 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 1357692 Axtq1_m anxiety QTL 1 (mouse) Not determined 1 180832317 191851043 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse
D1Mit360
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 182,422,914 - 182,423,027 UniSTS GRCm38 MGSCv37 1 184,353,045 - 184,353,158 UniSTS GRCm37 Celera 1 189,465,371 - 189,465,484 UniSTS Cytogenetic Map 1 H5 UniSTS cM Map 1 101.2 UniSTS Whitehead Genetic 1 102.7 UniSTS Whitehead/MRC_RH 1 2280.06 UniSTS
RH125309
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 182,448,820 - 182,448,925 UniSTS GRCm38 MGSCv37 1 184,378,951 - 184,379,056 UniSTS GRCm37 Celera 1 189,491,243 - 189,491,348 UniSTS Cytogenetic Map 1 H5 UniSTS cM Map 1 95.0 UniSTS
Trp53bp2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 H5 UniSTS cM Map 1 95.0 UniSTS
AI746547
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 182,461,954 - 182,462,047 UniSTS GRCm38 MGSCv37 1 184,392,085 - 184,392,178 UniSTS GRCm37 Celera 1 189,504,398 - 189,504,491 UniSTS Cytogenetic Map 1 H5 UniSTS cM Map 1 95.0 UniSTS Whitehead/MRC_RH 1 2280.06 UniSTS
Tp53bp2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 H5 UniSTS cM Map 1 95.0 UniSTS cM Map 1 UniSTS
Trp53bp2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 H5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000117245 ⟹ ENSMUSP00000112508
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,236,737 - 182,289,997 (+) Ensembl GRCm38.p6 Ensembl 1 182,409,172 - 182,462,432 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000191626 ⟹ ENSMUSP00000141889
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,272,337 - 182,276,080 (+) Ensembl GRCm38.p6 Ensembl 1 182,444,772 - 182,448,515 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000191804
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,269,641 - 182,289,347 (+) Ensembl GRCm38.p6 Ensembl 1 182,442,076 - 182,461,782 (+) Ensembl
RefSeq Acc Id:
NM_173378 ⟹ NP_775554
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,236,737 - 182,289,997 (+) NCBI GRCm38 1 182,409,167 - 182,462,436 (+) ENTREZGENE MGSCv37 1 184,339,298 - 184,392,567 (+) RGD Celera 1 189,451,621 - 189,504,880 (+) RGD cM Map 1 ENTREZGENE
Sequence:
GGATTAGTTGGTTTCGGCGAGAAGGAGGAGGAGGAGGTGGGAGTCGCGAGCGCCGAGACAAAGCCGCGTCCCGGAGACGGGCGAGGGGATTGGGCCCCGGACTCGGTGGCGTCCCGGTCCGCTGAGGG
hide sequence
RefSeq Acc Id:
NP_775554 ⟸ NM_173378
- UniProtKB:
Q8K2L5 (UniProtKB/Swiss-Prot), Q8CG79 (UniProtKB/Swiss-Prot), Q3UYM7 (UniProtKB/Swiss-Prot), E9QJU8 (UniProtKB/TrEMBL)
- Sequence:
MRFGSKMMPMFLTVYLSNSEQHFTEVPVTPETICRDVVDLCKEPGENDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFLRHERPPNRDIVSGPRSQDPSVKRNGVKVPGEHRRKENGVNSP
hide sequence
Ensembl Acc Id:
ENSMUSP00000141889 ⟸ ENSMUST00000191626
Ensembl Acc Id:
ENSMUSP00000112508 ⟸ ENSMUST00000117245
RGD ID: 6875970 Promoter ID: EPDNEW_M1436 Type: multiple initiation site Name: Trp53bp2_1 Description: Mus musculus transformation related protein 53 binding protein2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 182,409,172 - 182,409,232 EPDNEW
RGD ID: 6818653 Promoter ID: MM_KWN:3186 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: AK138310_GM10517, NM_173378 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 184,338,989 - 184,339,489 (+) MPROMDB
RGD ID: 6818650 Promoter ID: MM_KWN:3187 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Lung Transcripts: UC007DYD.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 184,371,806 - 184,372,306 (+) MPROMDB
RGD ID: 6846668 Promoter ID: MM_ACW:3519 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney, Liver, Lung Transcripts: TRP53BP2.FSEP07 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 184,388,756 - 184,389,256 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-26
Trp53bp2
transformation related protein 53 binding protein 2
Tp53bp2
tumor protein p53 binding protein, 2
Symbol and/or name updated
27372883 PROVISIONAL
2024-08-21
Tp53bp2
tumor protein p53 binding protein, 2
Trp53bp2
transformation related protein 53 binding protein 2
Symbol and/or name change
5135510 APPROVED
