Advanced Search (OLGA)

Gene: Lrrc52 (leucine rich repeat containing 52) Rattus norvegicus

Analyze

Symbol:

Lrrc52

Name:

leucine rich repeat containing 52

RGD ID:

1312014

Description:

Predicted to enable potassium channel activator activity; transmembrane transporter binding activity; and voltage-gated potassium channel activity. Predicted to be involved in positive regulation of voltage-gated potassium channel activity and potassium ion transmembrane transport. Predicted to act upstream of or within establishment of localization in cell and potassium ion transport. Predicted to be part of voltage-gated potassium channel complex. Orthologous to human LRRC52 (leucine rich repeat containing 52); INTERACTS WITH bisphenol A; furan; genistein.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

leucine-rich repeat-containing protein 52; LOC289199; MGC156754; RGD1312014; similar to hypothetical protein MGC37548

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LRRC52 (leucine rich repeat containing 52)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Lrrc52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lrrc52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LRRC52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LRRC52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lrrc52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LRRC52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LRRC52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lrrc52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Lrrc52 (leucine rich repeat containing 52)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	LRRC52 (leucine rich repeat containing 52)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5888	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	lrrc52	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	82,130,174 - 82,153,569 (-)	NCBI		GRCr8
mRatBN7.2	13	79,597,244 - 79,620,640 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	79,597,245 - 79,620,640 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	82,227,101 - 82,250,496 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	83,534,093 - 83,557,496 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	80,772,063 - 80,795,499 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	85,672,013 - 85,695,421 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	85,672,014 - 85,695,421 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	90,314,702 - 90,337,972 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	83,108,268 - 83,132,075 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	83,122,456 - 83,146,220 (-)	NCBI
Celera	13	79,302,036 - 79,325,429 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

gastrointestinal stromal tumor (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

furan (EXP)

genistein (EXP)

isoprenaline (ISO)

N-nitrosodiethylamine (ISO)

piperonyl butoxide (ISO)

resveratrol (ISO)

tetrachloromethane (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

establishment of localization in cell (ISO)

positive regulation of voltage-gated potassium channel activity (ISO)

potassium ion transmembrane transport (ISO)

potassium ion transport (ISO)

Cellular Component

voltage-gated potassium channel complex (IBA,ISO)

Molecular Function

potassium channel activator activity (IBA,ISO)

potassium channel activity (ISO)

protein binding (ISO)

transmembrane transporter binding (IBA,ISO)

voltage-gated potassium channel activity (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:22547800	PMID:25675513

Genomics

Comparative Map Data

Lrrc52
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	82,130,174 - 82,153,569 (-)	NCBI		GRCr8
mRatBN7.2	13	79,597,244 - 79,620,640 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	79,597,245 - 79,620,640 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	82,227,101 - 82,250,496 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	83,534,093 - 83,557,496 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	80,772,063 - 80,795,499 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	85,672,013 - 85,695,421 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	85,672,014 - 85,695,421 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	90,314,702 - 90,337,972 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	83,108,268 - 83,132,075 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	83,122,456 - 83,146,220 (-)	NCBI
Celera	13	79,302,036 - 79,325,429 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

LRRC52
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	165,544,000 - 165,563,957 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	165,544,000 - 165,563,957 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	165,513,237 - 165,533,194 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	163,779,868 - 163,799,822 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	138,618,739 - 138,638,444 (+)	NCBI		Celera
Cytogenetic Map	1	q24.1	NCBI
HuRef	1	136,760,341 - 136,780,048 (+)	NCBI		HuRef
CHM1_1	1	166,936,208 - 166,955,908 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	164,890,480 - 164,910,436 (+)	NCBI		T2T-CHM13v2.0

Lrrc52
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	167,273,244 - 167,294,349 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	167,273,238 - 167,294,349 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	167,445,675 - 167,466,780 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	167,445,669 - 167,466,780 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	169,375,806 - 169,396,911 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	169,282,350 - 169,303,455 (-)	NCBI		MGSCv36	mm8
Celera	1	169,867,807 - 169,898,118 (-)	NCBI		Celera
Cytogenetic Map	1	H2.3	NCBI
cM Map	1	74.83	NCBI

Lrrc52
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	11,115,821 - 11,137,204 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955462	11,115,888 - 11,137,501 (-)	NCBI	ChiLan1.0	ChiLan1.0

LRRC52
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	84,202,329 - 84,222,304 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	83,870,877 - 83,890,840 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	140,975,474 - 140,995,414 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	144,765,637 - 144,785,631 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	144,765,637 - 144,786,666 (+)	Ensembl	panpan1.1		panPan2

LRRC52
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	17,755,380 - 17,776,296 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	17,755,382 - 17,776,016 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	17,811,450 - 17,832,257 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	17,815,144 - 17,836,033 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	17,815,145 - 17,836,278 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	17,808,306 - 17,829,109 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	18,159,598 - 18,180,429 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	18,454,274 - 18,475,482 (-)	NCBI		UU_Cfam_GSD_1.0

Lrrc52
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	101,854,276 - 101,869,731 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	19,701,141 - 19,716,313 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	19,701,141 - 19,716,313 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LRRC52
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	85,188,066 - 85,205,946 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	85,187,934 - 85,205,778 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	92,844,632 - 92,862,465 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LRRC52
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	63,325,815 - 63,345,737 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666055	65,086,397 - 65,106,335 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lrrc52
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624826	3,883,538 - 3,905,341 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624826	3,883,796 - 3,904,887 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	33
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000005768
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	71610804	89333251	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	47601426	92601426	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	71610804	89333251	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	71610804	89333251	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
5	11	41	47	59	60	30	25	30	3	156	84	33	29	34	30

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001077434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC126099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005768 ⟹ ENSRNOP00000005768

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	79,597,245 - 79,620,640 (-)	Ensembl
Rnor_6.0 Ensembl	13	85,672,014 - 85,695,421 (-)	Ensembl

RefSeq Acc Id:

NM_001077434 ⟹ NP_001070902

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	82,130,174 - 82,153,569 (-)	NCBI
mRatBN7.2	13	79,597,244 - 79,620,640 (-)	NCBI
Rnor_6.0	13	85,672,013 - 85,695,421 (-)	NCBI
Rnor_5.0	13	90,314,702 - 90,337,972 (-)	NCBI
RGSC_v3.4	13	83,108,268 - 83,132,075 (-)	RGD
Celera	13	79,302,036 - 79,325,429 (-)	RGD

Sequence:

show sequence

CTGGCAACCTCATTGTCAGGCGGTTCTCCCCTGGCTCCCCTTCACTTACAAAGGCAGGGAAAGG
GTGAGACCTTTCAAAGCTGCCAAGTGGGCAAACTTCCAACAGCACTCCGGACTGAGCTAGCAGC
AGAGCCACCAAGCCGGCAGCAGGGCACTGGGCCTCGTGTTTCAACTTCTGTTCAGTTCTCCTGT
AATGGAAAATTGCTTTGCACAAAGCTAGAGTGTTACAGTTTTTTCCAGCACCCATCCCCTGCCC
TGCCCCACCCCTCGGCAGCCTTCAGATCCGAAGGACAGCTTGCACCCGCCCTCAGGAAGGTAGA
AGGAGGGGAACTGTGGCTTCTTACTATGTCCCTTGCTTCAGGCCCTAGCCCCAAGTTGTTACTC
TTTTCTCTTGGAATGGGGCTGGTATCAGGGTCCAAGTGTCCCAACAACTGTCTGTGTCAAGACC
AAGAAGTAGCCTGCACGGATTTGCAGCTAACGGAATACCCAACTGACATTCCTCTCAACACCCG
GAGGCTATACCTGAACAATAACAAAATCACTAGCTTACCAGCTCTCCAGCTAGGATTCCTCAGT
GACCTCGTTTACTTGGACTGTCAGAACAACCGGATTCGAGAGGTGATGGATTACACGTTCATCG
GGATCTTCAAACTCCTCTACCTTGACCTCAGCTCCAACAACCTAACTTCCATTTCCCCATTCAG
TTTCTCCATTCTCACCAACCTGGTGCGGCTGAACATTTCAAACAACCCTCACCTCCTCTATCTT
GACAAATACATCTTTGCCAACACCACCTCTTTGAGGTACCTGGACCTCAGAAACACCGGAATGC
AGATCATCGACCATACTGGCTTCCACCACCTGGTGGTGCTCCAGACCCTGTACCTAAGTGGAAA
CCCGTGGAAGTGCAACTGCTCCTTCTTGGACTTCACCATCCACTTGTTAGTGTCCCATATGGAC
CACCCAGATGCCCAGAATGCCACGTGTACGGAGCCCCCCGAGCTGAAAGGGTGGCCCATCACGA
AGGTGGGGAATCCACTCCAGTACATGTGCATCACACACCTGGACCACCAGGACTACATCTTCTT
ACTGCTCATCGGCTTCTGCATCTTCGCTGCAGGCACCGTGGCCGCCTGGCTCACGGGTGTGTGT
GCTGTGCTGTACCAGAATGCCCTCCGGAAGTCGAGCGGGGACGATACCGAGGATGAAACTGGGA
ATAGGATCACCAACCAGATGTTTCGAAGCAACACGCACTTAGCCCCAGTCCGTCGGTTCCCTGA
ACTGATCTAGCTGTCAGAGAGCACCACCGACTGTGCCTTCCCTGGTCTGGCTCCCTGCTTTCTC
TCTTGCCCTCCCATCTTACCATCACTGTCTTGGAGACTGAGGCCTTCTAGTAAAATAAAATATT
TGGTGGTCATTTCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001070902	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI26100	(Get FASTA)	NCBI Sequence Viewer
	EDM09281	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005768.4

RefSeq Acc Id:	NP_001070902 ⟸ NM_001077434
- Peptide Label:	precursor
- UniProtKB:	A0JN28 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSLASGPSPKLLLFSLGMGLVSGSKCPNNCLCQDQEVACTDLQLTEYPTDIPLNTRRLYLNNNK ITSLPALQLGFLSDLVYLDCQNNRIREVMDYTFIGIFKLLYLDLSSNNLTSISPFSFSILTNLV RLNISNNPHLLYLDKYIFANTTSLRYLDLRNTGMQIIDHTGFHHLVVLQTLYLSGNPWKCNCSF LDFTIHLLVSHMDHPDAQNATCTEPPELKGWPITKVGNPLQYMCITHLDHQDYIFLLLIGFCIF AAGTVAAWLTGVCAVLYQNALRKSSGDDTEDETGNRITNQMFRSNTHLAPVRRFPELI hide sequence

Ensembl Acc Id:

ENSRNOP00000005768 ⟸ ENSRNOT00000005768

Protein Domains

LRRNT

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0JN28-F1-model_v2	AlphaFold	A0JN28	1-314	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698977

Promoter ID:

EPDNEW_R9500

Type:

single initiation site

Name:

Lrrc52_1

Description:

leucine rich repeat containing 52

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	85,695,378 - 85,695,438	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1312014	AgrOrtholog
BioCyc Gene	G2FUF-17516	BioCyc
Ensembl Genes	ENSRNOG00000004356	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005768.8	UniProtKB/TrEMBL
Gene3D-CATH	3.80.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7112275	IMAGE-MGC_LOAD
InterPro	KCNMA1_auxiliary	UniProtKB/TrEMBL
	L_dom-like	UniProtKB/TrEMBL
	Leu-rich_rpt	UniProtKB/TrEMBL
	Leu-rich_rpt_typical-subtyp	UniProtKB/TrEMBL
	LRR-contain_N	UniProtKB/TrEMBL
KEGG Report	rno:289199	UniProtKB/TrEMBL
MGC_CLONE	MGC:156754	IMAGE-MGC_LOAD
NCBI Gene	289199	ENTREZGENE
PANTHER	GH08155P	UniProtKB/TrEMBL
	LEUCINE-RICH REPEAT-CONTAINING PROTEIN 52	UniProtKB/TrEMBL
Pfam	LRR_8	UniProtKB/TrEMBL
PhenoGen	Lrrc52	PhenoGen
PROSITE	LRR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004356	RatGTEx
SMART	LRR_TYP	UniProtKB/TrEMBL
	LRRNT	UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/TrEMBL
UniProt	A0JN28	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Lrrc52	leucine rich repeat containing 52	RGD1312014_predicted	similar to hypothetical protein MGC37548 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1312014_predicted	similar to hypothetical protein MGC37548 (predicted)	LOC289199_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC289199_predicted	similar to hypothetical protein MGC37548 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar