Advanced Search (OLGA)

Gene: Lrrc52 (leucine rich repeat containing 52) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Lrrc52

Name:

leucine rich repeat containing 52

RGD ID:

1312014

Description:

Predicted to enable potassium channel activator activity; transmembrane transporter binding activity; and voltage-gated potassium channel activity. Predicted to be involved in positive regulation of voltage-gated potassium channel activity and potassium ion transmembrane transport. Predicted to act upstream of or within establishment of localization in cell and potassium ion transport. Predicted to be part of voltage-gated potassium channel complex. Orthologous to human LRRC52 (leucine rich repeat containing 52); INTERACTS WITH bisphenol A; furan; genistein.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

leucine-rich repeat-containing protein 52; LOC289199; MGC156754; RGD1312014; similar to hypothetical protein MGC37548

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LRRC52 (leucine rich repeat containing 52)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Lrrc52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lrrc52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LRRC52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LRRC52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lrrc52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LRRC52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LRRC52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lrrc52 (leucine rich repeat containing 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Lrrc52 (leucine rich repeat containing 52)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	LRRC52 (leucine rich repeat containing 52)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5888	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	lrrc52	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	82,130,174 - 82,153,569 (-)	NCBI		GRCr8
mRatBN7.2	13	79,597,244 - 79,620,640 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	79,597,245 - 79,620,640 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	82,227,101 - 82,250,496 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	83,534,093 - 83,557,496 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	80,772,063 - 80,795,499 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	85,672,013 - 85,695,421 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	85,672,014 - 85,695,421 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	90,314,702 - 90,337,972 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	83,108,268 - 83,132,075 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	83,122,456 - 83,146,220 (-)	NCBI
Celera	13	79,302,036 - 79,325,429 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lrrc52	Rat	gastrointestinal stromal tumor		ISO	RGD:1603449	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Lrrc52	Rat	parathyroid carcinoma		ISO	RGD:1603449	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lrrc52	Rat	antirheumatic drug	increases expression	ISO	RGD:1603449	6480464	Antirheumatic Agents results in increased expression of LRRC52 mRNA	CTD	PMID:24449571
Lrrc52	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1551915	6480464	Benzo(a)pyrene results in decreased expression of LRRC52 mRNA	CTD	PMID:22228805
Lrrc52	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1551915	6480464	Benzo(a)pyrene results in increased methylation of LRRC52 3' UTR; Benzo(a)pyrene results in increased methylation of more ...	CTD	PMID:27901495
Lrrc52	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of LRRC52 mRNA	CTD	PMID:25181051
Lrrc52	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of LRRC52 gene	CTD	PMID:28505145
Lrrc52	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Genistein] results in increased methylation of LRRC52 gene	CTD	PMID:28505145
Lrrc52	Rat	CGP 52608	multiple interactions	ISO	RGD:1603449	6480464	CGP 52608 promotes the reaction [RORA protein binds to LRRC52 gene]	CTD	PMID:28238834
Lrrc52	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of LRRC52 gene	CTD	PMID:22079235
Lrrc52	Rat	genistein	multiple interactions	EXP		6480464	[bisphenol A co-treated with Genistein] results in increased methylation of LRRC52 gene	CTD	PMID:28505145
Lrrc52	Rat	isoprenaline	increases expression	ISO	RGD:1551915	6480464	Isoproterenol results in increased expression of LRRC52 mRNA	CTD	PMID:20003209
Lrrc52	Rat	N-nitrosodiethylamine	multiple interactions	ISO	RGD:1551915	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of LRRC52 gene	CTD	PMID:23968726
Lrrc52	Rat	piperonyl butoxide	multiple interactions	ISO	RGD:1551915	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of LRRC52 gene	CTD	PMID:23968726
Lrrc52	Rat	resveratrol	multiple interactions	ISO	RGD:1603449	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of LRRC52 mRNA	CTD	PMID:23557933
Lrrc52	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of LRRC52 mRNA	CTD	PMID:30723492

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lrrc52	Rat	establishment of localization in cell	acts_upstream_of_or_within	ISO	RGD:1551915	1624291	MGI:4881116 PMID:25675513	RGD	PMID:25675513
Lrrc52	Rat	monoatomic ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0407	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lrrc52	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lrrc52	Rat	positive regulation of voltage-gated potassium channel activity	involved_in	ISO	RGD:1603449	1624291	PMID:22547800	RGD	PMID:22547800
Lrrc52	Rat	potassium ion transmembrane transport	involved_in	ISO	RGD:1603449	1624291	PMID:22547800	RGD	PMID:22547800
Lrrc52	Rat	potassium ion transport	acts_upstream_of_or_within	ISO	RGD:1551915	1624291	MGI:4881116 PMID:25675513	RGD	PMID:25675513

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lrrc52	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lrrc52	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Lrrc52	Rat	voltage-gated potassium channel complex	part_of	ISO	RGD:1603449	1624291	PMID:22547800	RGD	PMID:22547800
Lrrc52	Rat	voltage-gated potassium channel complex	part_of	IBA	PANTHER:PTN002925264\|UniProtKB:Q2I0M4\|UniProtKB:Q5VT99\|UniProtKB:Q6ZSA7\|UniProtKB:Q8N7C0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lrrc52	Rat	potassium channel activator activity	enables	ISO	RGD:1603449	1624291	PMID:22547800	RGD	PMID:22547800
Lrrc52	Rat	potassium channel activator activity	enables	IBA	PANTHER:PTN002925264\|UniProtKB:Q2I0M4\|UniProtKB:Q5VT99\|UniProtKB:Q6ZSA7\|UniProtKB:Q8N7C0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lrrc52	Rat	potassium channel activity	enables	ISO	RGD:1551915	1624291	MGI:4881116 PMID:25675513	RGD	PMID:25675513
Lrrc52	Rat	protein binding	enables	ISO	RGD:1603449	1624291	UniProtKB:Q6FHY5 PMID:32296183	RGD	PMID:32296183
Lrrc52	Rat	transmembrane transporter binding	enables	ISO	RGD:1603449	1624291	UniProtKB:Q12791 PMID:22547800	RGD	PMID:22547800
Lrrc52	Rat	transmembrane transporter binding	enables	IBA	PANTHER:PTN002925264\|UniProtKB:Q2I0M4\|UniProtKB:Q5VT99\|UniProtKB:Q6ZSA7\|UniProtKB:Q8N7C0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lrrc52	Rat	voltage-gated potassium channel activity	enables	ISO	RGD:1603449	1624291	PMID:22547800	RGD	PMID:22547800
Lrrc52	Rat	voltage-gated potassium channel activity	enables	IBA	PANTHER:PTN002925264\|UniProtKB:Q2I0M4\|UniProtKB:Q6ZSA7\|UniProtKB:Q8N7C0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:22547800	PMID:25675513

Lrrc52
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	82,130,174 - 82,153,569 (-)	NCBI		GRCr8
mRatBN7.2	13	79,597,244 - 79,620,640 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	79,597,245 - 79,620,640 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	82,227,101 - 82,250,496 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	83,534,093 - 83,557,496 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	80,772,063 - 80,795,499 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	85,672,013 - 85,695,421 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	85,672,014 - 85,695,421 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	90,314,702 - 90,337,972 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	83,108,268 - 83,132,075 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	83,122,456 - 83,146,220 (-)	NCBI
Celera	13	79,302,036 - 79,325,429 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

LRRC52
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	165,544,000 - 165,563,957 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	165,544,000 - 165,563,957 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	165,513,237 - 165,533,194 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	163,779,868 - 163,799,822 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	138,618,739 - 138,638,444 (+)	NCBI		Celera
Cytogenetic Map	1	q24.1	NCBI
HuRef	1	136,760,341 - 136,780,048 (+)	NCBI		HuRef
CHM1_1	1	166,936,208 - 166,955,908 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	164,890,480 - 164,910,436 (+)	NCBI		T2T-CHM13v2.0

Lrrc52
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	167,273,244 - 167,294,349 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	167,273,238 - 167,294,349 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	167,445,675 - 167,466,780 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	167,445,669 - 167,466,780 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	169,375,806 - 169,396,911 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	169,282,350 - 169,303,455 (-)	NCBI		MGSCv36	mm8
Celera	1	169,867,807 - 169,898,118 (-)	NCBI		Celera
Cytogenetic Map	1	H2.3	NCBI
cM Map	1	74.83	NCBI

Lrrc52
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	11,115,821 - 11,137,204 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955462	11,115,888 - 11,137,501 (-)	NCBI	ChiLan1.0	ChiLan1.0

LRRC52
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	84,202,329 - 84,222,304 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	83,870,877 - 83,890,840 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	140,975,474 - 140,995,414 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	144,765,637 - 144,785,631 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	144,765,637 - 144,786,666 (+)	Ensembl	panpan1.1		panPan2

LRRC52
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	17,755,380 - 17,776,296 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	17,755,382 - 17,776,016 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	17,811,450 - 17,832,257 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	17,815,144 - 17,836,033 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	17,815,145 - 17,836,278 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	17,808,306 - 17,829,109 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	18,159,598 - 18,180,429 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	18,454,274 - 18,475,482 (-)	NCBI		UU_Cfam_GSD_1.0

Lrrc52
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	101,854,276 - 101,869,731 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	19,701,141 - 19,716,313 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	19,701,141 - 19,716,313 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LRRC52
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	85,188,066 - 85,205,946 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	85,187,934 - 85,205,778 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	92,844,632 - 92,862,465 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LRRC52
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	63,325,815 - 63,345,737 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666055	65,086,397 - 65,106,335 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lrrc52
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624826	3,883,538 - 3,905,341 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624826	3,883,796 - 3,904,887 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Lrrc52
116 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	33
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000005768
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	37415584	80753406	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	66451204	106807694	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	74862117	85581182	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	74023918	80753406	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
5	11	41	47	59	60	30	25	30	3	156	84	33	29	34	30


RefSeq Transcripts	NM_001077434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC126099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005768 ⟹ ENSRNOP00000005768

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	79,597,245 - 79,620,640 (-)	Ensembl
Rnor_6.0 Ensembl	13	85,672,014 - 85,695,421 (-)	Ensembl

RefSeq Acc Id:

NM_001077434 ⟹ NP_001070902

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	82,130,174 - 82,153,569 (-)	NCBI
mRatBN7.2	13	79,597,244 - 79,620,640 (-)	NCBI
Rnor_6.0	13	85,672,013 - 85,695,421 (-)	NCBI
Rnor_5.0	13	90,314,702 - 90,337,972 (-)	NCBI
RGSC_v3.4	13	83,108,268 - 83,132,075 (-)	RGD
Celera	13	79,302,036 - 79,325,429 (-)	RGD

Sequence:

show sequence

CTGGCAACCTCATTGTCAGGCGGTTCTCCCCTGGCTCCCCTTCACTTACAAAGGCAGGGAAAGGGTGAGACCTTTCAAAGCTGCCAAGTGGGCAAACTTCCAACAGCACTCCGGACTGAGCTAGCAGC
AGAGCCACCAAGCCGGCAGCAGGGCACTGGGCCTCGTGTTTCAACTTCTGTTCAGTTCTCCTGTAATGGAAAATTGCTTTGCACAAAGCTAGAGTGTTACAGTTTTTTCCAGCACCCATCCCCTGCCC
TGCCCCACCCCTCGGCAGCCTTCAGATCCGAAGGACAGCTTGCACCCGCCCTCAGGAAGGTAGAAGGAGGGGAACTGTGGCTTCTTACTATGTCCCTTGCTTCAGGCCCTAGCCCCAAGTTGTTACTC
TTTTCTCTTGGAATGGGGCTGGTATCAGGGTCCAAGTGTCCCAACAACTGTCTGTGTCAAGACCAAGAAGTAGCCTGCACGGATTTGCAGCTAACGGAATACCCAACTGACATTCCTCTCAACACCCG
GAGGCTATACCTGAACAATAACAAAATCACTAGCTTACCAGCTCTCCAGCTAGGATTCCTCAGTGACCTCGTTTACTTGGACTGTCAGAACAACCGGATTCGAGAGGTGATGGATTACACGTTCATCG
GGATCTTCAAACTCCTCTACCTTGACCTCAGCTCCAACAACCTAACTTCCATTTCCCCATTCAGTTTCTCCATTCTCACCAACCTGGTGCGGCTGAACATTTCAAACAACCCTCACCTCCTCTATCTT
GACAAATACATCTTTGCCAACACCACCTCTTTGAGGTACCTGGACCTCAGAAACACCGGAATGCAGATCATCGACCATACTGGCTTCCACCACCTGGTGGTGCTCCAGACCCTGTACCTAAGTGGAAA
CCCGTGGAAGTGCAACTGCTCCTTCTTGGACTTCACCATCCACTTGTTAGTGTCCCATATGGACCACCCAGATGCCCAGAATGCCACGTGTACGGAGCCCCCCGAGCTGAAAGGGTGGCCCATCACGA
AGGTGGGGAATCCACTCCAGTACATGTGCATCACACACCTGGACCACCAGGACTACATCTTCTTACTGCTCATCGGCTTCTGCATCTTCGCTGCAGGCACCGTGGCCGCCTGGCTCACGGGTGTGTGT
GCTGTGCTGTACCAGAATGCCCTCCGGAAGTCGAGCGGGGACGATACCGAGGATGAAACTGGGAATAGGATCACCAACCAGATGTTTCGAAGCAACACGCACTTAGCCCCAGTCCGTCGGTTCCCTGA
ACTGATCTAGCTGTCAGAGAGCACCACCGACTGTGCCTTCCCTGGTCTGGCTCCCTGCTTTCTCTCTTGCCCTCCCATCTTACCATCACTGTCTTGGAGACTGAGGCCTTCTAGTAAAATAAAATATT
TGGTGGTCATTTCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001070902	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI26100	(Get FASTA)	NCBI Sequence Viewer
	EDM09281	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005768.4

RefSeq Acc Id:	NP_001070902 ⟸ NM_001077434
- Peptide Label:	precursor
- UniProtKB:	A0JN28 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSLASGPSPKLLLFSLGMGLVSGSKCPNNCLCQDQEVACTDLQLTEYPTDIPLNTRRLYLNNNKITSLPALQLGFLSDLVYLDCQNNRIREVMDYTFIGIFKLLYLDLSSNNLTSISPFSFSILTNLV RLNISNNPHLLYLDKYIFANTTSLRYLDLRNTGMQIIDHTGFHHLVVLQTLYLSGNPWKCNCSFLDFTIHLLVSHMDHPDAQNATCTEPPELKGWPITKVGNPLQYMCITHLDHQDYIFLLLIGFCIF AAGTVAAWLTGVCAVLYQNALRKSSGDDTEDETGNRITNQMFRSNTHLAPVRRFPELI hide sequence

Ensembl Acc Id:

ENSRNOP00000005768 ⟸ ENSRNOT00000005768

Protein Domains

LRRNT

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0JN28-F1-model_v2	AlphaFold	A0JN28	1-314	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698977

Promoter ID:

EPDNEW_R9500

Type:

single initiation site

Name:

Lrrc52_1

Description:

leucine rich repeat containing 52

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	85,695,378 - 85,695,438	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-17516	BioCyc
Ensembl Genes	ENSRNOG00000004356	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005768.8	UniProtKB/TrEMBL
Gene3D-CATH	3.80.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7112275	IMAGE-MGC_LOAD
InterPro	KCNMA1_auxiliary	UniProtKB/TrEMBL
	L_dom-like	UniProtKB/TrEMBL
	Leu-rich_rpt	UniProtKB/TrEMBL
	Leu-rich_rpt_typical-subtyp	UniProtKB/TrEMBL
	LRR-contain_N	UniProtKB/TrEMBL
KEGG Report	rno:289199	UniProtKB/TrEMBL
MGC_CLONE	MGC:156754	IMAGE-MGC_LOAD
NCBI Gene	289199	ENTREZGENE
PANTHER	GH08155P	UniProtKB/TrEMBL
	LEUCINE-RICH REPEAT-CONTAINING PROTEIN 52	UniProtKB/TrEMBL
Pfam	LRR_8	UniProtKB/TrEMBL
PhenoGen	Lrrc52	PhenoGen
PROSITE	LRR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004356	RatGTEx
SMART	LRR_TYP	UniProtKB/TrEMBL
	LRRNT	UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/TrEMBL
UniProt	A0JN28	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Lrrc52	leucine rich repeat containing 52	RGD1312014_predicted	similar to hypothetical protein MGC37548 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1312014_predicted	similar to hypothetical protein MGC37548 (predicted)	LOC289199_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC289199_predicted	similar to hypothetical protein MGC37548 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar