Borcs7 (BLOC-1 related complex subunit 7)

Advanced Search (OLGA)

Gene: Borcs7 (BLOC-1 related complex subunit 7) Rattus norvegicus

Analyze

Symbol:

Borcs7

Name:

BLOC-1 related complex subunit 7

RGD ID:

1311783

Description:

Predicted to act upstream of or within several processes, including lysosome localization; motor behavior; and response to cycloheximide. Predicted to be located in membrane. Predicted to be part of BORC complex. Predicted to be active in lysosome. Orthologous to human BORCS7 (BLOC-1 related complex subunit 7); INTERACTS WITH 17beta-estradiol; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BLOC-1-related complex subunit 7; hypothetical protein LOC294012; LOC294012; RGD1311783; similar to RIKEN cDNA 2010012O05; uncharacterized protein LOC294012; UPF0693 protein C10orf32 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BORCS7 (BLOC-1 related complex subunit 7)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Borcs7 (BLOC-1 related complex subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Borcs7 (BLOC-1 related complex subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BORCS7 (BLOC-1 related complex subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BORCS7 (BLOC-1 related complex subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Borcs7 (BLOC-1 related complex subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BORCS7 (BLOC-1 related complex subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BORCS7 (BLOC-1 related complex subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Borcs7 (BLOC-1 related complex subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	BORCS7 (BLOC-1 related complex subunit 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Borcs7 (BLOC-1 related complex subunit 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	borcs7 (BLOC-1 related complex subunit 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18065	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	blos-8	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	borcs7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,505,745 - 255,519,579 (+)	NCBI		GRCr8
mRatBN7.2	1	245,564,347 - 245,578,182 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	245,564,369 - 245,579,343 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	253,697,199 - 253,711,748 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,386,292 - 260,399,972 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,040,147 - 253,054,685 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,451,021 - 266,464,903 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,451,021 - 266,464,903 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	273,881,051 - 273,894,737 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	251,994,318 - 252,009,336 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	252,257,473 - 252,270,917 (+)	NCBI
Celera	1	241,350,210 - 241,364,075 (+)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

desmoplastic/nodular medulloblastoma (ISO)

hereditary spastic paraplegia (ISS)

neuroaxonal dystrophy (ISS)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

17beta-estradiol (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium dichloride (ISO)

caffeine (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

formaldehyde (ISO)

FR900359 (ISO)

gentamycin (EXP)

glafenine (EXP)

inulin (ISO)

methyl methanesulfonate (ISO)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

quercetin (ISO)

sulindac (EXP)

sunitinib (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon development (ISO)

lysosome localization (ISO)

motor behavior (ISO)

neuromuscular process (ISO)

response to cycloheximide (ISO)

vesicle-mediated transport (ISO)

walking behavior (ISO)

Cellular Component

BORC complex (IBA,ISO)

lysosomal membrane (IEA)

lysosome (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:25898167

Genomics

Comparative Map Data

Borcs7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,505,745 - 255,519,579 (+)	NCBI		GRCr8
mRatBN7.2	1	245,564,347 - 245,578,182 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	245,564,369 - 245,579,343 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	253,697,199 - 253,711,748 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,386,292 - 260,399,972 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,040,147 - 253,054,685 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,451,021 - 266,464,903 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,451,021 - 266,464,903 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	273,881,051 - 273,894,737 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	251,994,318 - 252,009,336 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	252,257,473 - 252,270,917 (+)	NCBI
Celera	1	241,350,210 - 241,364,075 (+)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

BORCS7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	102,854,259 - 102,864,961 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	102,854,259 - 102,864,961 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	104,614,016 - 104,624,718 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	104,604,009 - 104,613,960 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	104,604,008 - 104,613,956	NCBI
Celera	10	98,354,550 - 98,365,297 (+)	NCBI		Celera
Cytogenetic Map	10	q24.32	NCBI
HuRef	10	98,248,739 - 98,259,486 (+)	NCBI		HuRef
CHM1_1	10	104,897,182 - 104,907,929 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	103,740,043 - 103,750,745 (+)	NCBI		T2T-CHM13v2.0

Borcs7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	46,678,345 - 46,691,821 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	46,678,345 - 46,691,821 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	46,689,906 - 46,703,382 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	46,689,906 - 46,703,382 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	46,764,396 - 46,777,872 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	46,743,217 - 46,756,693 (+)	NCBI		MGSCv36	mm8
Celera	19	47,459,890 - 47,473,265 (+)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	38.97	NCBI

Borcs7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955485	7,605,277 - 7,615,924 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955485	7,605,277 - 7,615,924 (-)	NCBI	ChiLan1.0	ChiLan1.0

BORCS7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	114,739,440 - 114,749,632 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	114,744,369 - 114,754,937 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	99,455,004 - 99,466,304 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	102,918,103 - 102,929,188 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

BORCS7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	15,314,219 - 15,324,522 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	15,314,266 - 15,350,714 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	15,486,064 - 15,496,397 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	15,788,519 - 15,798,798 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	15,788,533 - 15,990,025 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	15,332,377 - 15,342,656 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	15,371,989 - 15,382,271 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	15,504,505 - 15,514,854 (+)	NCBI		UU_Cfam_GSD_1.0

Borcs7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	31,472,530 - 31,484,775 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936600	3,074,987 - 3,088,524 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936600	3,074,857 - 3,088,294 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BORCS7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	113,831,363 - 113,844,301 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	113,809,368 - 113,848,555 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	123,777,128 - 123,816,115 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BORCS7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	95,895,775 - 95,906,861 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	95,895,551 - 95,905,320 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	57,007,981 - 57,018,644 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Borcs7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624831	2,179,724 - 2,188,991 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624831	2,179,671 - 2,189,215 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Borcs7
114 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	576
Count of miRNA genes:	263
Interacting mature miRNAs:	310
Transcripts:	ENSRNOT00000027196
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
631690	Scl5	Serum cholesterol level QTL 5	2.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	236125214	260522016	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	238699859	259647894	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	237147813	260522016	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228985440	245907899	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	223262787	260522016	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	232156370	259647894	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	233948574	260522016	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233190394	258625266	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

Markers in Region

RH140273

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	245,577,820 - 245,578,013 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	266,464,542 - 266,464,734	NCBI	Rnor6.0
Rnor_5.0	1	273,894,376 - 273,894,568	UniSTS	Rnor5.0
RGSC_v3.4	1	252,008,975 - 252,009,167	UniSTS	RGSC3.4
Celera	1	241,363,714 - 241,363,906	UniSTS
RH 3.4 Map	1	1625.0	UniSTS
Cytogenetic Map	1	q54	UniSTS

RH133471

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	1	1623.4	UniSTS
Cytogenetic Map	1	q54	UniSTS

BE118988

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	245,575,393 - 245,575,552 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	266,462,116 - 266,462,274	NCBI	Rnor6.0
Rnor_5.0	1	273,891,950 - 273,892,108	UniSTS	Rnor5.0
RGSC_v3.4	1	252,006,549 - 252,006,707	UniSTS	RGSC3.4
Celera	1	241,360,971 - 241,361,129	UniSTS
RH 3.4 Map	1	1623.7	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027196 ⟹ ENSRNOP00000027196

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	245,564,371 - 245,578,186 (+)	Ensembl
Rnor_6.0 Ensembl	1	266,451,021 - 266,464,903 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115674 ⟹ ENSRNOP00000079119

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	245,564,369 - 245,579,343 (+)	Ensembl

RefSeq Acc Id:

NM_001134509 ⟹ NP_001127981

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,505,745 - 255,519,579 (+)	NCBI
mRatBN7.2	1	245,564,347 - 245,578,182 (+)	NCBI
Rnor_6.0	1	266,451,021 - 266,464,903 (+)	NCBI
Rnor_5.0	1	273,881,051 - 273,894,737 (+)	NCBI
RGSC_v3.4	1	251,994,318 - 252,009,336 (+)	RGD
Celera	1	241,350,210 - 241,364,075 (+)	RGD

Sequence:

show sequence

AGGGACTCGCCGTCGTCCGGCTGAGGCGTTCGCTAGTTGAGATGATGGCGAGTGGGACGCCGGA
TTCGCAAGCCCGATTTGGTCAGTCGGTGAAGGGGCTTCTCACGGAAAAGGTGAACACCTGCGGC
ACCGACGTAATCGCGCTCACCAAGCAGGTGCTGAAAGGCTCGCGAAGCTCTGAGCTGCTGGGGC
AGGCAGCTCGAAACATGGTGCTACAGGAAGATGCCATCTTGCACTCAGAAGATAGTTTAAGGAA
GATGGCGATAATAACAACACACCTTCAGTACCAGCAAGAAGCTATTCAGAAGAACGTTGAACAG
TCGCCTGACCTGCAAGACCAGCTGAGTCATTTACTGAAGTAGCTCTCGCCAGAACAGCAGTTGA
CTTCTTTGCCTGATGCTGAGAAGGACGCGGCCTTGGTTTCCATTTTCATCTCCAAAAATTCATC
TAGAAAAGACTTGTGAAAAGAAGAAGCCAAGTGACCAAACGTGAAAGCACTTCTTAAGTTGGAG
TAACTCATCTTCAAGTGGTTTTATATTAAAATTAATAGGTTGAATCATTAGCATCAGATCCCTC
TCTCTGTCTCTCTCTGTCTCTCTCTCTGTCTCTCTCTCTGTCTCTCTCTCTCTCCCTCCTGTGT
AGCCCGCTGCTTTTGAACTCATAATCCCCGTGCCGTAGCCTCTCAAGTAGTGAGATTAAAAACC
ACCATACCTGGCCACTGAGTAACACATAGTCGCAGATACTTGGGAGGCTGAGGCAGGAGGATCC
TGTGAGCCCCAAACGTTGAGTCCATCCAGGGCAACACAGAAAGAACCTATCTCCAAGAAGAAGA
AGGGGCAGGGGAAGGGGCTTCTACTGTGATCACGTGAGAGTGCTTTCTCTTTAAAAGATGTTTA
TCATTCACTCGAGAGTCTTCATTTAATGGACGCAGAGCATGGGTAATGGCCGTTCCCTTTCTCT
CTGCAAATTCTCTTATGAAAGTCAGAGAGTGGGTCCTCTCTGGCAGCTGCAGCTCTTCCTTGAC
CTTTGTTTCTGGCTTCTCTCTCTCTCTGTGACCTTTGATTAAGTGACCTCGGCTCGTTCTGTAA
TCATTCGTAGCCATTCCATTCCCTTCGCATCTGGCAGTAAAGCCCCACAAGTGCATCTGCTGAT
GATTAAGTAACGTTACAGAATGAGCTGCATAGACCCAATCTCAGACAAGACCAAAAGGCTAAAA
AGATAGAAAACCAGTAAGTAGTTATTACATATTTGTTTGTTAAAATGTCACCTCAACCATTAAA
CTGTAAATTAAGAGATGTATCACTGGGGTTGGGGACTTAGCTCAGTGGTAGAGCGCTTGCCTAG
CAAGCGCAAGGCCCTGGGTTCGGTCCCCAGCTCCGAAAAAAAGAAAAAAAAAAAAAAAAAAAAA
AAGAGATGTATCACTGACCATGACATGTATAAAATGAATTAGATTTGAAAAGAGTTCTCTCTCA
GCTGGATGCTAAAAATTTGATCAATATGAAAATGTCTGTCTCCTTATAAAGATATGACATCACA
AAATTAGTATTTGAAAGGACCAAAGAGAAAGCCCTTAAAATGGCATTTGCTTGTGGTCCCATTC
CTGTGACTTCCACAGACTGTTAAAGAACAGACCCTTTCCTTATACTCCCAGCATATAAAACATG
ACCATTAAAACTGGTGAGTGGCTAGAGAGATGGCTCAGTGGTTAAGAGCACTGACTGCTCTTCC
AGAGGTCCTGAGTTCAGTTCCCAGCAACCACACGGTGTTTCACAACCATCTGCAATGGGATCCG
ATACCCTCTTCTGGTATGTCTGAAGACAGCTACAGTGTACTCATATACATAAAATAAATTAATT
TTCAAAAAGCCAGTGAAATGGCTCAGCAGTTAAAATCACTTGCTGCTTTTGGAGAGGACCCAGG
TCCAGTTCCCAGCAGTCGCTTCAGAAGCTCACTGCTGTCTGACTGTAGCTCCGAGGGATCTGAC
TCCTTGGACTCCTTGGACACCTGCATTCATATGCATATGCCTGAACACAGACACGTGCTGATAT
ATATGACAAAAAACATATATATTGCTAAATTATTAAAAATCCATCTGCTAAGAAAAATGTAGTT
TTCATTTAAAATAAAAAACAAGATGATACAAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001127981	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94360	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027196.6
	ENSRNOP00000079119.1

RefSeq Acc Id:	NP_001127981 ⟸ NM_001134509
- UniProtKB:	D3ZLX2 (UniProtKB/TrEMBL), A0A8I5ZM67 (UniProtKB/TrEMBL), A6JHN6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMASGTPDSQARFGQSVKGLLTEKVNTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAIL HSEDSLRKMAIITTHLQYQQEAIQKNVEQSPDLQDQLSHLLK hide sequence

Ensembl Acc Id:

ENSRNOP00000027196 ⟸ ENSRNOT00000027196

Ensembl Acc Id:

ENSRNOP00000079119 ⟸ ENSRNOT00000115674

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZLX2-F1-model_v2	AlphaFold	D3ZLX2	1-106	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690972

Promoter ID:

EPDNEW_R1496

Type:

multiple initiation site

Name:

Borcs7_1

Description:

BLOC-1 related complex subunit 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	266,451,048 - 266,451,108	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311783	AgrOrtholog
BioCyc Gene	G2FUF-55499	BioCyc
Ensembl Genes	ENSRNOG00000020076	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027196.6	UniProtKB/TrEMBL
	ENSRNOT00000115674.1	UniProtKB/TrEMBL
InterPro	UPF0693	UniProtKB/TrEMBL
KEGG Report	rno:294012	UniProtKB/TrEMBL
NCBI Gene	294012	ENTREZGENE
PANTHER	BLOC-1-RELATED COMPLEX SUBUNIT 7	UniProtKB/TrEMBL
	PTHR31397	UniProtKB/TrEMBL
Pfam	UPF0693	UniProtKB/TrEMBL
PhenoGen	Borcs7	PhenoGen
RatGTEx	ENSRNOG00000020076	RatGTEx
UniProt	A0A8I5ZM67	ENTREZGENE, UniProtKB/TrEMBL
	A6JHN6	ENTREZGENE, UniProtKB/TrEMBL
	D3ZLX2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-13	Borcs7	BLOC-1 related complex subunit 7	RGD1311783	similar to RIKEN cDNA 2010012O05	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1311783	similar to RIKEN cDNA 2010012O05	RGD1311783_predicted	similar to RIKEN cDNA 2010012O05 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1311783_predicted	similar to RIKEN cDNA 2010012O05 (predicted)	LOC294012_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC294012_predicted	similar to RIKEN cDNA 2010012O05 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI