Advanced Search (OLGA)

Gene: Dtx4 (deltex E3 ubiquitin ligase 4) Rattus norvegicus

Analyze

Symbol:

Dtx4

Name:

deltex E3 ubiquitin ligase 4

RGD ID:

1311767

Description:

Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in several processes, including Notch signaling pathway; proteasome-mediated ubiquitin-dependent protein catabolic process; and protein K48-linked ubiquitination. Predicted to be located in cytoplasm. Predicted to be active in centrosome and nucleoplasm. Orthologous to human DTX4 (deltex E3 ubiquitin ligase 4); PARTICIPATES IN Notch signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

deltex 4 homolog; deltex 4 homolog (Drosophila); deltex 4, E3 ubiquitin ligase; deltex homolog 4; deltex homolog 4 (Drosophila); E3 ubiquitin-protein ligase DTX4; LOC293774; LRRGT00037; protein deltex-4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DTX4 (deltex E3 ubiquitin ligase 4)	HGNC	Ensembl, HomoloGene, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Dtx4 (deltex 4, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dtx4 (deltex E3 ubiquitin ligase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DTX4 (deltex E3 ubiquitin ligase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DTX4 (deltex E3 ubiquitin ligase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dtx4 (deltex E3 ubiquitin ligase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DTX4 (deltex E3 ubiquitin ligase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DTX4 (deltex E3 ubiquitin ligase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dtx4 (deltex E3 ubiquitin ligase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DTX1 (deltex E3 ubiquitin ligase 1)	HGNC	OrthoDB
Homo sapiens (human):	PPP2CA (protein phosphatase 2 catalytic subunit alpha)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DTX4 (deltex E3 ubiquitin ligase 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dtx4 (deltex 4, E3 ubiquitin ligase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dtx4b (deltex 4, E3 ubiquitin ligase b)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	dtx4a (deltex 4, E3 ubiquitin ligase a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	dx	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dtx4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	218,882,391 - 218,969,837 (-)	NCBI		GRCr8
mRatBN7.2	1	209,457,719 - 209,545,163 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	209,460,735 - 209,492,818 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	217,832,313 - 217,867,389 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	224,763,932 - 224,799,009 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	217,586,768 - 217,621,842 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	228,729,842 - 228,759,783 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	228,732,985 - 228,755,866 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	235,891,822 - 235,921,624 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	215,396,194 - 215,416,879 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	215,554,445 - 215,571,613 (-)	NCBI
Celera	1	206,877,610 - 206,897,854 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenoid cystic carcinoma (ISO)

intellectual disability (ISO)

leukocyte adhesion deficiency 3 (ISO)

pancreatic ductal carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

amphotericin B (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

caffeine (EXP)

calcitriol (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

chrysene (ISO)

cisplatin (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (ISO)

doxorubicin (ISO)

endosulfan (EXP)

enzalutamide (ISO)

estriol (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

formaldehyde (ISO)

genistein (ISO)

gentamycin (EXP)

isoprenaline (ISO)

ketamine (EXP)

lead(0) (ISO)

leflunomide (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

methotrexate (ISO)

methoxyacetic acid (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (EXP)

Monobutylphthalate (EXP)

Nutlin-3 (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propiconazole (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

sunitinib (ISO)

testosterone (EXP,ISO)

tetraphene (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

Triptolide (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of innate immune response (ISO)

Notch signaling pathway (IBA)

proteasomal protein catabolic process (ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (ISO)

protein K48-linked ubiquitination (ISO)

protein ubiquitination (IBA)

Cellular Component

centrosome (ISO)

cytoplasm (IEA)

nucleoplasm (IBA)

Molecular Function

ubiquitin protein ligase activity (IBA,ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

Notch signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Dtx4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	218,882,391 - 218,969,837 (-)	NCBI		GRCr8
mRatBN7.2	1	209,457,719 - 209,545,163 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	209,460,735 - 209,492,818 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	217,832,313 - 217,867,389 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	224,763,932 - 224,799,009 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	217,586,768 - 217,621,842 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	228,729,842 - 228,759,783 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	228,732,985 - 228,755,866 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	235,891,822 - 235,921,624 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	215,396,194 - 215,416,879 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	215,554,445 - 215,571,613 (-)	NCBI
Celera	1	206,877,610 - 206,897,854 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

DTX4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	59,171,430 - 59,208,588 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	59,171,430 - 59,208,588 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	58,938,903 - 58,976,061 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	58,696,388 - 58,732,636 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	11	56,298,909 - 56,335,157 (+)	NCBI		Celera
Cytogenetic Map	11	q12.1	NCBI
HuRef	11	55,285,883 - 55,322,031 (+)	NCBI		HuRef
CHM1_1	11	58,805,300 - 58,841,550 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	59,120,605 - 59,157,761 (+)	NCBI		T2T-CHM13v2.0

Dtx4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	12,443,700 - 12,479,509 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	12,443,702 - 12,478,818 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	12,466,329 - 12,502,179 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	12,466,338 - 12,501,454 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	12,540,826 - 12,576,486 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	12,533,381 - 12,568,499 (-)	NCBI		MGSCv36	mm8
Celera	19	13,130,334 - 13,193,491 (-)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	8.72	NCBI

Dtx4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955511	3,758,628 - 3,782,560 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955511	3,758,631 - 3,782,560 (+)	NCBI	ChiLan1.0	ChiLan1.0

DTX4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	60,295,472 - 60,331,431 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	61,337,603 - 61,373,577 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	54,389,228 - 54,425,655 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	57,842,178 - 57,877,602 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	57,839,228 - 57,874,337 (+)	Ensembl	panpan1.1		panPan2

DTX4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	37,535,957 - 37,570,937 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	37,538,342 - 37,591,589 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	37,070,737 - 37,105,838 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	38,186,579 - 38,221,705 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	38,186,600 - 38,222,470 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	37,785,681 - 37,820,822 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	37,354,887 - 37,389,987 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	37,978,883 - 38,014,029 (-)	NCBI		UU_Cfam_GSD_1.0

Dtx4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	13,319,923 - 13,354,041 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936581	3,437,489 - 3,467,869 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936581	3,433,760 - 3,467,863 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DTX4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	12,199,231 - 12,237,615 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	12,197,943 - 12,237,884 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	11,812,226 - 11,850,956 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DTX4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	14,354,752 - 14,390,630 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	14,358,001 - 14,390,239 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	111,672,167 - 111,709,420 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dtx4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624864	1,478,059 - 1,498,066 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624864	1,475,383 - 1,502,047 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	66
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000028626
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	207243873	252243873	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	177339686	222339686	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	181059071	226059071	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	181059071	226059071	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	182039247	227039247	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	183564652	228564652	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	193964073	238964073	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	181059071	226059071	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	181059071	226059071	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	194575422	239575422	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	193400541	238400541	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	182535316	227535316	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	181059071	226059071	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	181059071	226059071	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	207243873	252243873	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	209203273	254203273	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	202543537	247543537	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	205674651	250674651	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	207243873	252243873	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	203300512	229359342	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	180739993	225739993	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	191190115	223964326	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	172718770	228180370	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	188241285	250779312	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	208798288	253798288	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
1300168	Bp170	Blood pressure QTL 170	2.76		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	192995199	237995199	Rat
61403	Niddm4	Non-insulin dependent diabetes mellitus QTL 4			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	201464383	246464383	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	203675682	248675682	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	205674651	250674651	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	185979875	230979875	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	197807365	233480676	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	193400541	238400541	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	202851915	223964440	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	173363824	227535316	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	207099883	252099883	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	191260175	236260175	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2325727	Pia41	Pristane induced arthritis QTL 41			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	188241285	233241285	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat

Markers in Region

BE114047

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	209,480,151 - 209,480,331 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	228,752,501 - 228,752,680	NCBI	Rnor6.0
Rnor_5.0	1	235,914,383 - 235,914,562	UniSTS	Rnor5.0
RGSC_v3.4	1	215,415,958 - 215,416,137	UniSTS	RGSC3.4
Celera	1	206,896,933 - 206,897,112	UniSTS
RH 3.4 Map	1	1496.3	UniSTS
Cytogenetic Map	1	q43	UniSTS

AA998636

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	209,460,769 - 209,460,901 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	228,733,132 - 228,733,263	NCBI	Rnor6.0
Rnor_5.0	1	235,895,148 - 235,895,279	UniSTS	Rnor5.0
RGSC_v3.4	1	215,396,144 - 215,396,275	UniSTS	RGSC3.4
Celera	1	206,877,560 - 206,877,691	UniSTS
RH 3.4 Map	1	1500.5	UniSTS
Cytogenetic Map	1	q43	UniSTS

AI030803

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	209,457,751 - 209,457,970 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	228,730,114 - 228,730,332	NCBI	Rnor6.0
Rnor_5.0	1	235,892,130 - 235,892,348	UniSTS	Rnor5.0
RGSC_v3.4	1	215,393,126 - 215,393,344	UniSTS	RGSC3.4
Celera	1	206,874,542 - 206,874,760	UniSTS
RH 3.4 Map	1	1499.9	UniSTS
Cytogenetic Map	1	q43	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001047855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001401393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001401394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006231114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY383692	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028626 ⟹ ENSRNOP00000028626

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	209,460,735 - 209,481,073 (-)	Ensembl
Rnor_6.0 Ensembl	1	228,733,182 - 228,753,422 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083283 ⟹ ENSRNOP00000071301

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	209,460,735 - 209,492,818 (-)	Ensembl
Rnor_6.0 Ensembl	1	228,732,985 - 228,755,866 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101313 ⟹ ENSRNOP00000097092

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	209,460,735 - 209,480,212 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103725 ⟹ ENSRNOP00000087356

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	209,460,735 - 209,478,098 (-)	Ensembl

RefSeq Acc Id:

NM_001047855 ⟹ NP_001041320

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	218,885,492 - 218,905,747 (-)	NCBI
mRatBN7.2	1	209,460,820 - 209,481,073 (-)	NCBI
Rnor_6.0	1	228,733,182 - 228,753,422 (-)	NCBI
Rnor_5.0	1	235,891,822 - 235,921,624 (-)	NCBI
RGSC_v3.4	1	215,396,194 - 215,416,879 (-)	RGD
Celera	1	206,877,610 - 206,897,854 (-)	RGD

Sequence:

show sequence

ATGATGATGATGGTGATGATGATGATGGTGGTGGTGGTATGGGTTCCCACTGTGCCTGTGAAAA
ACTTGAATGGGTCCAGCCCTGTTAATCCTGCCTTGGCAGGAATCACCGGGATCCTCATGAGTGC
AGCGGGATTGCCTGTGTGTCTCACTCGTCCACCAAAGTTGGTCCTCCACCCGCCCCCTGTCAGC
AAGAGTGAGATAAAGTCCATCCCAGGGGTCTCTAACACAAGCCGCAAGACCACCAAAAAACAGG
CTAAGAAAGGTAAAACCCCAGAGGAAGTGCTAAAGAAGTATCTGCAGAAGGTCCGGCACCCACC
AGAAGAGGATTGTACCATCTGTATGGAGCGCCTCACAGCCCCCTCTGGCTACAAGGGCCCACAG
CCCACAGTCAAGCCTGACCTGGTAGGAAAGCTGTCGAAGTGTGGCCACATCTACCACATCTACT
GCCTGGTGGCCATGTACAACAATGGGAACAAGGATGGAAGTTTACAGTGCCCAACATGTAAGAC
CATTTATGGCGTGAAGACAGGCACCCAGCCTCCAGGGAAGATGGAGTACCACCTCATCCCCCAC
TCCTTGCCTGGCCATCCGGATTGCAAGACCATTCGGATTATCTACAGTATCCCCCCTGGCATTC
AGGGACCAGAACATCCGAATCCTGGGAAGAGCTTCAGCGCCCGTGGCTTCCCACGACATTGTTA
CCTTCCAGACAGCGAGAAAGGGAGAAAAGTTCTGAAGCTGCTTCTAGTGGCCTGGGACCGCCGT
CTCATCTTTGCCATTGGAACCTCCAGCACCACGGGCGAGTCTGATACTGTCATCTGGAATGAGG
TGCACCACAAGACAGAATTTGGCTCTAATCTCACTGGCCATGGCTACCCAGATGCCAATTACCT
GGATAACGTGCTGGCTGAACTGGCTGCCCAGGGTATCTCTGAAGACAGCACTTCCCAGGAAAAA
GACTGA

hide sequence

RefSeq Acc Id:

NM_001401393 ⟹ NP_001388322

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	218,882,391 - 218,917,130 (-)	NCBI
mRatBN7.2	1	209,457,719 - 209,492,457 (-)	NCBI

RefSeq Acc Id:

NM_001401394 ⟹ NP_001388323

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	218,882,391 - 218,917,466 (-)	NCBI
mRatBN7.2	1	209,457,719 - 209,492,797 (-)	NCBI

RefSeq Acc Id:

XM_039108699 ⟹ XP_038964627

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	218,882,391 - 218,916,444 (-)	NCBI
mRatBN7.2	1	209,457,719 - 209,491,764 (-)	NCBI

RefSeq Acc Id:

XM_039108700 ⟹ XP_038964628

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	218,882,391 - 218,916,432 (-)	NCBI
mRatBN7.2	1	209,457,719 - 209,491,722 (-)	NCBI

RefSeq Acc Id:

XM_039108701 ⟹ XP_038964629

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	218,882,391 - 218,969,837 (-)	NCBI
mRatBN7.2	1	209,457,719 - 209,545,163 (-)	NCBI

RefSeq Acc Id:

XM_039108702 ⟹ XP_038964630

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	218,882,391 - 218,969,779 (-)	NCBI
mRatBN7.2	1	209,457,719 - 209,545,111 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001041320	(Get FASTA)	NCBI Sequence Viewer
	NP_001388322	(Get FASTA)	NCBI Sequence Viewer
	NP_001388323	(Get FASTA)	NCBI Sequence Viewer
	XP_038964627	(Get FASTA)	NCBI Sequence Viewer
	XP_038964628	(Get FASTA)	NCBI Sequence Viewer
	XP_038964629	(Get FASTA)	NCBI Sequence Viewer
	XP_038964630	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ96250	(Get FASTA)	NCBI Sequence Viewer
	EDM12918	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028626.5
	ENSRNOP00000071301.2
	ENSRNOP00000087356.1
	ENSRNOP00000097092.1

RefSeq Acc Id:	NP_001041320 ⟸ NM_001047855
- Peptide Label:	isoform 3 precursor
- UniProtKB:	Q6TXG2 (UniProtKB/TrEMBL), A0A8I6AQV0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMMMVMMMMVVVVWVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVS KSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGYKGPQ PTVKPDLVGKLSKCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPH SLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRR LIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTSQEK D hide sequence

Ensembl Acc Id:

ENSRNOP00000028626 ⟸ ENSRNOT00000028626

Ensembl Acc Id:

ENSRNOP00000071301 ⟸ ENSRNOT00000083283

RefSeq Acc Id:	XP_038964629 ⟸ XM_039108701
- Peptide Label:	isoform X2
- UniProtKB:	A6I0D7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038964630 ⟸ XM_039108702
- Peptide Label:	isoform X2
- UniProtKB:	A6I0D7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038964627 ⟸ XM_039108699
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038964628 ⟸ XM_039108700
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000087356 ⟸ ENSRNOT00000103725

Ensembl Acc Id:

ENSRNOP00000097092 ⟸ ENSRNOT00000101313

RefSeq Acc Id:	NP_001388323 ⟸ NM_001401394
- Peptide Label:	isoform 2
- UniProtKB:	A6I0D7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001388322 ⟸ NM_001401393
- Peptide Label:	isoform 1
- UniProtKB:	A0A0G2K048 (UniProtKB/TrEMBL)

Protein Domains

RING-type WWE

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K048-F1-model_v2	AlphaFold	A0A0G2K048	1-513	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311767	AgrOrtholog
BioCyc Gene	G2FUF-56303	BioCyc
Ensembl Genes	ENSRNOG00000021086	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028626.7	UniProtKB/TrEMBL
	ENSRNOT00000083283.2	UniProtKB/TrEMBL
	ENSRNOT00000101313.1	UniProtKB/TrEMBL
	ENSRNOT00000103725.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.390.130	UniProtKB/TrEMBL
	3.30.40.10	UniProtKB/TrEMBL
	3.30.720.50	UniProtKB/TrEMBL
InterPro	Deltex_C	UniProtKB/TrEMBL
	Deltex_C_sf	UniProtKB/TrEMBL
	Deltex_fam	UniProtKB/TrEMBL
	WWE-dom	UniProtKB/TrEMBL
	WWE-dom_subgr	UniProtKB/TrEMBL
	WWE_dom_sf	UniProtKB/TrEMBL
	Znf_C3HC4_RING-type	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
NCBI Gene	293774	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE DTX4	UniProtKB/TrEMBL
	PTHR12622	UniProtKB/TrEMBL
Pfam	DTC	UniProtKB/TrEMBL
	WWE	UniProtKB/TrEMBL
	zf-C3HC4	UniProtKB/TrEMBL
PhenoGen	Dtx4	PhenoGen
PROSITE	WWE	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000021086	RatGTEx
SMART	RING	UniProtKB/TrEMBL
	WWE	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
	SSF117839	UniProtKB/TrEMBL
UniProt	A0A0G2K048	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A316_RAT	UniProtKB/TrEMBL
	A0A8I6AQV0	ENTREZGENE, UniProtKB/TrEMBL
	A6I0D7	ENTREZGENE, UniProtKB/TrEMBL
	Q6TXG2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-22	Dtx4	deltex E3 ubiquitin ligase 4	Dtx4	deltex 4, E3 ubiquitin ligase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-02-06	Dtx4	deltex 4, E3 ubiquitin ligase	Dtx4	deltex homolog 4 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-03-24	Dtx4	deltex homolog 4 (Drosophila)	Dtx4	deltex 4 homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Dtx4	deltex 4 homolog (Drosophila)	Dtx4_predicted	deltex 4 homolog (Drosophila) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Dtx4_predicted	deltex 4 homolog (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)