Advanced Search (OLGA)

Gene: Bub1 (BUB1 mitotic checkpoint serine/threonine kinase) Rattus norvegicus

Analyze

Symbol:

Bub1

Name:

BUB1 mitotic checkpoint serine/threonine kinase

RGD ID:

1311707

Description:

Predicted to enable histone H2A kinase activity and protein serine/threonine kinase activity. Predicted to be involved in meiotic sister chromatid cohesion, centromeric; mitotic spindle assembly checkpoint signaling; and positive regulation of maintenance of mitotic sister chromatid cohesion, centromeric. Predicted to act upstream of or within chromosome segregation and positive regulation of intrinsic apoptotic signaling pathway. Predicted to be located in condensed chromosome, centromeric region; cytosol; and nucleoplasm. Predicted to be part of outer kinetochore. Predicted to be active in kinetochore and nucleus. Human ortholog(s) of this gene implicated in colorectal cancer and primary autosomal recessive microcephaly 30. Orthologous to human BUB1 (BUB1 mitotic checkpoint serine/threonine kinase); PARTICIPATES IN cell cycle pathway, mitotic; INTERACTS WITH 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

budding uninhibited by benzimidazoles 1; budding uninhibited by benzimidazoles 1 homolog; budding uninhibited by benzimidazoles 1 homolog (S. cerevisiae); budding uninhibited by benzimidazoles 1 homolog (yeast); LOC296137; mitotic checkpoint serine/threonine-protein kinase BUB1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BUB1 (BUB1 mitotic checkpoint serine/threonine kinase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Bub1 (BUB1, mitotic checkpoint serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bub1 (BUB1 mitotic checkpoint serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BUB1 (BUB1 mitotic checkpoint serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BUB1 (BUB1 mitotic checkpoint serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BUB1 (BUB1 mitotic checkpoint serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BUB1 (BUB1 mitotic checkpoint serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bub1 (BUB1 mitotic checkpoint serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRMT112 (tRNA methyltransferase activator subunit 11-2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	BUB1 (BUB1 mitotic checkpoint serine/threonine kinase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Bub1 (BUB1, mitotic checkpoint serine/threonine kinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bub1 (BUB1 mitotic checkpoint serine/threonine kinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BUB1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Bub1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	BubR1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	bub-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MAD3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	bub1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	135,473,525 - 135,504,921 (-)	NCBI		GRCr8
mRatBN7.2	3	115,020,254 - 115,051,650 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	115,020,254 - 115,051,650 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	118,910,094 - 118,941,495 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	127,505,638 - 127,537,039 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	125,165,975 - 125,197,376 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	120,373,604 - 120,404,910 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	120,373,604 - 120,404,910 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	126,929,123 - 126,960,429 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	115,323,510 - 115,354,906 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	115,230,064 - 115,260,294 (-)	NCBI
Celera	3	113,854,710 - 113,886,108 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bub1	Rat	colorectal cancer	susceptibility	ISO	RGD:1323304	1600539	DNA:splice-site mutation, missense mutation	RGD
Bub1	Rat	COVID-19		ISO	RGD:1323304	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226\|REF_RGD_ID:28912744

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bub1	Rat	colon carcinoma		ISO	RGD:1323304	8554872	ClinVar Annotator: match by term: Carcinoma of colon	ClinVar	PMID:9521327
Bub1	Rat	colorectal cancer		ISO	RGD:1323304	8554872	ClinVar Annotator: match by term: BUB1-related condition \| ClinVar Annotator: match by term: Colorectal cancer more ...	ClinVar	PMID:17576681\|PMID:25741868\|PMID:28492532\|PMID:9521327\|PMID:9536098
Bub1	Rat	genetic disease		ISO	RGD:1323304	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar
Bub1	Rat	primary autosomal recessive microcephaly 30		ISO	RGD:1323304	8554872	ClinVar Annotator: match by term: Microcephaly 30, primary, autosomal recessive	ClinVar	PMID:25741868\|PMID:28492532\|PMID:35044816

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bub1	Rat	Colorectal Neoplasms		ISO	RGD:1323304	11554173	CTD Direct Evidence: marker/mechanism	CTD
Bub1	Rat	hepatocellular carcinoma		ISO	RGD:1323304	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:28284560

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bub1	Rat	colorectal cancer		ISO	RGD:1323304	7240710		OMIM
Bub1	Rat	primary autosomal recessive microcephaly 30		ISO	RGD:1323304	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bub1	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	RGD:1323304	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BUB1 mRNA	CTD	PMID:22079256
Bub1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1323305	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BUB1 mRNA	CTD	PMID:36331819
Bub1	Rat	(S)-amphetamine	increases expression	ISO	RGD:1323305	6480464	Dextroamphetamine results in increased expression of BUB1 mRNA	CTD	PMID:12205029
Bub1	Rat	(S)-amphetamine	multiple interactions	ISO	RGD:1323305	6480464	SOD1 inhibits the reaction [Dextroamphetamine results in increased expression of BUB1 mRNA]	CTD	PMID:12205029
Bub1	Rat	1,1-dichloroethene	increases expression	ISO	RGD:1323305	6480464	vinylidene chloride results in increased expression of BUB1 mRNA	CTD	PMID:26682919
Bub1	Rat	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	RGD:1323305	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Bub1	Rat	1,2-dimethylhydrazine	decreases expression	EXP		6480464	1,2-Dimethylhydrazine results in decreased expression of BUB1 mRNA	CTD	PMID:27840820
Bub1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1323305	6480464	1,2-Dimethylhydrazine results in decreased expression of BUB1 mRNA	CTD	PMID:22206623
Bub1	Rat	1-chloro-2,4-dinitrobenzene	decreases expression	ISO	RGD:1323304	6480464	Dinitrochlorobenzene results in decreased expression of BUB1 mRNA	CTD	PMID:17374397
Bub1	Rat	1-chloro-2,4-dinitrobenzene	increases expression	ISO	RGD:1323305	6480464	Dinitrochlorobenzene results in increased expression of BUB1 mRNA	CTD	PMID:21404309
Bub1	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of BUB1 mRNA	CTD	PMID:30723492
Bub1	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1323305	6480464	Ethinyl Estradiol results in increased expression of BUB1 mRNA	CTD	PMID:17942748
Bub1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1323305	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BUB1 mRNA	CTD	PMID:17942748
Bub1	Rat	17beta-estradiol	increases expression	ISO	RGD:1323305	6480464	Estradiol results in increased expression of BUB1 mRNA	CTD	PMID:19484750\|PMID:25210133
Bub1	Rat	17beta-estradiol	affects expression	EXP		6480464	Estradiol affects the expression of BUB1 mRNA	CTD	PMID:32145629
Bub1	Rat	17beta-estradiol	increases expression	ISO	RGD:1323304	6480464	Estradiol results in increased expression of BUB1 mRNA	CTD	PMID:19167446
Bub1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1323305	6480464	ESR1 protein promotes the reaction [Estradiol results in increased expression of BUB1 mRNA]	CTD	PMID:25210133
Bub1	Rat	17beta-hydroxy-17-methylestra-4,9,11-trien-3-one	increases expression	ISO	RGD:1323304	6480464	Metribolone results in increased expression of BUB1 mRNA	CTD	PMID:19318562
Bub1	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	RGD:1323305	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Bub1	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:1323305	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Bub1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1323305	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BUB1 mRNA	CTD	PMID:17942748
Bub1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of BUB1 mRNA	CTD	PMID:34747641
Bub1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of BUB1 mRNA	CTD	PMID:32109520\|PMID:33387578
Bub1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1323304	6480464	Tetrachlorodibenzodioxin affects the expression of BUB1 mRNA	CTD	PMID:22298810
Bub1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1323305	6480464	Tetrachlorodibenzodioxin results in increased expression of BUB1 mRNA	CTD	PMID:19465110
Bub1	Rat	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	RGD:1323305	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Bub1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:1323305	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of BUB1 mRNA	CTD	PMID:38648751
Bub1	Rat	2-methylcholine	affects expression	ISO	RGD:1323304	6480464	beta-methylcholine affects the expression of BUB1 mRNA	CTD	PMID:21179406
Bub1	Rat	2-palmitoylglycerol	increases expression	ISO	RGD:1323304	6480464	2-palmitoylglycerol results in increased expression of BUB1 mRNA	CTD	PMID:37199045
Bub1	Rat	3-methylcholanthrene	increases expression	ISO	RGD:1323305	6480464	Methylcholanthrene results in increased expression of BUB1 mRNA	CTD	PMID:20713471
Bub1	Rat	4-(ethoxymethylene)-2-phenyloxazol-5-one	decreases expression	ISO	RGD:1323304	6480464	Oxazolone results in decreased expression of BUB1 mRNA	CTD	PMID:17374397
Bub1	Rat	4-(ethoxymethylene)-2-phenyloxazol-5-one	increases expression	ISO	RGD:1323305	6480464	Oxazolone results in increased expression of BUB1 mRNA	CTD	PMID:21404309
Bub1	Rat	4-hydroxynon-2-enal	decreases expression	ISO	RGD:1323305	6480464	4-hydroxy-2-nonenal results in decreased expression of BUB1 mRNA	CTD	PMID:19191707
Bub1	Rat	4-nitroquinoline N-oxide	increases expression	ISO	RGD:1323305	6480464	4-Nitroquinoline-1-oxide results in increased expression of BUB1 mRNA	CTD	PMID:22561872
Bub1	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	RGD:1323304	6480464	Decitabine affects the expression of BUB1 mRNA	CTD	PMID:23300844
Bub1	Rat	5-fluorouracil	decreases expression	ISO	RGD:1323304	6480464	Fluorouracil results in decreased expression of BUB1 mRNA	CTD	PMID:16709241
Bub1	Rat	5-fluorouracil	decreases expression	ISO	RGD:1323305	6480464	Fluorouracil results in decreased expression of BUB1 mRNA	CTD	PMID:19272435
Bub1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of BUB1 mRNA	CTD	PMID:24780913
Bub1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of BUB1 mRNA	CTD	PMID:31881176
Bub1	Rat	acrolein	multiple interactions	ISO	RGD:1323304	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ...	CTD	PMID:32699268
Bub1	Rat	acrylamide	decreases expression	ISO	RGD:1323304	6480464	Acrylamide results in decreased expression of BUB1 mRNA	CTD	PMID:32763439
Bub1	Rat	aflatoxin B1	affects expression	ISO	RGD:1323304	6480464	Aflatoxin B1 affects the expression of BUB1 protein	CTD	PMID:20106945
Bub1	Rat	aflatoxin B1	increases methylation	ISO	RGD:1323304	6480464	Aflatoxin B1 results in increased methylation of BUB1 gene	CTD	PMID:27153756
Bub1	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of BUB1 mRNA	CTD	PMID:23630614\|PMID:25378103
Bub1	Rat	aflatoxin M1	decreases expression	ISO	RGD:1323304	6480464	Aflatoxin M1 results in decreased expression of BUB1 mRNA	CTD	PMID:30928695
Bub1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1323304	6480464	Tretinoin results in decreased expression of BUB1 mRNA	CTD	PMID:23724009\|PMID:33167477
Bub1	Rat	alpha-pinene	multiple interactions	ISO	RGD:1323304	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ...	CTD	PMID:32699268
Bub1	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of BUB1 mRNA	CTD	PMID:35163327
Bub1	Rat	amosite asbestos	increases expression	ISO	RGD:1323305	6480464	Asbestos, Amosite results in increased expression of BUB1 mRNA	CTD	PMID:23917077
Bub1	Rat	antimycin A	increases expression	ISO	RGD:1323304	6480464	Antimycin A results in increased expression of BUB1 mRNA	CTD	PMID:33512557
Bub1	Rat	antirheumatic drug	decreases expression	ISO	RGD:1323304	6480464	Antirheumatic Agents results in decreased expression of BUB1 mRNA	CTD	PMID:24449571
Bub1	Rat	aristolochic acid A	decreases expression	ISO	RGD:1323304	6480464	aristolochic acid I results in decreased expression of BUB1 mRNA	CTD	PMID:33212167
Bub1	Rat	arsenite(3-)	affects expression	ISO	RGD:1323304	6480464	arsenite affects the expression of BUB1 mRNA	CTD	PMID:22959463
Bub1	Rat	azathioprine	decreases expression	ISO	RGD:1323304	6480464	Azathioprine results in decreased expression of BUB1 mRNA	CTD	PMID:22623647
Bub1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1323305	6480464	Benzo(a)pyrene results in decreased expression of BUB1 mRNA	CTD	PMID:17942131\|PMID:19770486
Bub1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1323304	6480464	Benzo(a)pyrene results in decreased expression of BUB1 mRNA	CTD	PMID:16120219\|PMID:20064835\|PMID:20106945\|PMID:21632981
Bub1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1323304	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of BUB1 mRNA	CTD	PMID:19150397\|PMID:20018196\|PMID:20382639
Bub1	Rat	beta-lapachone	decreases expression	ISO	RGD:1323304	6480464	beta-lapachone results in decreased expression of BUB1 mRNA	CTD	PMID:38218311
Bub1	Rat	bis(2-chloroethyl) sulfide	decreases expression	ISO	RGD:1323304	6480464	Mustard Gas results in decreased expression of BUB1 mRNA	CTD	PMID:25102026
Bub1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of BUB1 mRNA	CTD	PMID:25181051\|PMID:26982218\|PMID:30816183\|PMID:32528016\|PMID:34947998
Bub1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of BUB1 mRNA	CTD	PMID:32145629
Bub1	Rat	bisphenol A	affects expression	ISO	RGD:1323304	6480464	bisphenol A affects the expression of BUB1 mRNA	CTD	PMID:30903817\|PMID:35628146
Bub1	Rat	bisphenol A	decreases expression	ISO	RGD:1323304	6480464	bisphenol A results in decreased expression of BUB1 mRNA	CTD	PMID:29275510
Bub1	Rat	Bisphenol A diglycidyl ether	affects splicing	ISO	RGD:1323305	6480464	bisphenol A diglycidyl ether affects the splicing of BUB1 mRNA	CTD	PMID:36464114
Bub1	Rat	bisphenol AF	affects splicing	ISO	RGD:1323305	6480464	bisphenol AF affects the splicing of BUB1 mRNA	CTD	PMID:36464114
Bub1	Rat	butan-1-ol	multiple interactions	ISO	RGD:1323304	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
Bub1	Rat	cadmium atom	decreases expression	ISO	RGD:1323304	6480464	Cadmium results in decreased expression of BUB1 mRNA	CTD	PMID:21120746\|PMID:24376830
Bub1	Rat	cadmium dichloride	increases expression	ISO	RGD:1323305	6480464	Cadmium Chloride results in increased expression of BUB1 mRNA	CTD	PMID:18974090
Bub1	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of BUB1 mRNA	CTD	PMID:25993096
Bub1	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of BUB1 mRNA	CTD	PMID:33453195
Bub1	Rat	caffeine	multiple interactions	ISO	RGD:1323304	6480464	[Nocodazole co-treated with Caffeine] results in increased expression of BUB1 protein modified form	CTD	PMID:21670593
Bub1	Rat	caffeine	increases phosphorylation	ISO	RGD:1323304	6480464	Caffeine results in increased phosphorylation of BUB1 protein	CTD	PMID:35688186
Bub1	Rat	calcitriol	multiple interactions	ISO	RGD:1323304	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of BUB1 mRNA	CTD	PMID:21592394
Bub1	Rat	calcitriol	decreases expression	ISO	RGD:1323304	6480464	Calcitriol results in decreased expression of BUB1 mRNA	CTD	PMID:21592394
Bub1	Rat	cannabidiol	decreases expression	ISO	RGD:1323304	6480464	Cannabidiol results in decreased expression of BUB1 mRNA	CTD	PMID:36519830
Bub1	Rat	carbon nanotube	increases expression	ISO	RGD:1323305	6480464	Nanotubes, Carbon analog results in increased expression of BUB1 mRNA	CTD	PMID:25554681
Bub1	Rat	carbon nanotube	affects expression	ISO	RGD:1323305	6480464	Nanotubes, Carbon affects the expression of BUB1 mRNA	CTD	PMID:25554681
Bub1	Rat	choline	multiple interactions	ISO	RGD:1323305	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Bub1	Rat	chromium(6+)	multiple interactions	ISO	RGD:1323304	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ...	CTD	PMID:21670593\|PMID:38479592
Bub1	Rat	chromium(6+)	affects expression	ISO	RGD:1323305	6480464	chromium hexavalent ion affects the expression of BUB1 mRNA	CTD	PMID:28472532
Bub1	Rat	cisplatin	multiple interactions	ISO	RGD:1323304	6480464	[Piroxicam co-treated with Cisplatin] results in decreased expression of BUB1 mRNA	CTD	PMID:21858171
Bub1	Rat	cisplatin	decreases expression	ISO	RGD:1323304	6480464	Cisplatin results in decreased expression of BUB1 mRNA	CTD	PMID:27594783
Bub1	Rat	cisplatin	affects expression	ISO	RGD:1323304	6480464	Cisplatin affects the expression of BUB1 mRNA	CTD	PMID:23300844
Bub1	Rat	cisplatin	increases expression	ISO	RGD:1323305	6480464	Cisplatin results in increased expression of BUB1 mRNA	CTD	PMID:21151649
Bub1	Rat	cobalt dichloride	decreases expression	ISO	RGD:1323304	6480464	cobaltous chloride results in decreased expression of BUB1 mRNA	CTD	PMID:19320972\|PMID:19376846
Bub1	Rat	copper atom	multiple interactions	ISO	RGD:1323304	6480464	[Chelating Agents binds to Copper] which results in decreased expression of BUB1 mRNA	CTD	PMID:30911355
Bub1	Rat	copper(0)	multiple interactions	ISO	RGD:1323304	6480464	[Chelating Agents binds to Copper] which results in decreased expression of BUB1 mRNA	CTD	PMID:30911355
Bub1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1323304	6480464	Copper Sulfate results in decreased expression of BUB1 mRNA	CTD	PMID:19549813
Bub1	Rat	cordycepin	increases expression	ISO	RGD:1323305	6480464	cordycepin results in increased expression of BUB1 mRNA	CTD	PMID:32042022
Bub1	Rat	coumestrol	increases expression	ISO	RGD:1323304	6480464	Coumestrol results in increased expression of BUB1 mRNA	CTD	PMID:19167446
Bub1	Rat	coumestrol	multiple interactions	ISO	RGD:1323304	6480464	[Coumestrol co-treated with resveratrol] results in increased expression of BUB1 mRNA	CTD	PMID:19167446
Bub1	Rat	cryptolepine	decreases expression	ISO	RGD:1323304	6480464	cryptolepine results in decreased expression of BUB1 mRNA	CTD	PMID:16120219
Bub1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of BUB1 mRNA	CTD	PMID:26577399
Bub1	Rat	cyclosporin A	decreases expression	ISO	RGD:1323305	6480464	Cyclosporine results in decreased expression of BUB1 mRNA	CTD	PMID:17942131
Bub1	Rat	cyclosporin A	decreases expression	ISO	RGD:1323304	6480464	Cyclosporine results in decreased expression of BUB1 mRNA	CTD	PMID:20106945\|PMID:21632981\|PMID:25562108
Bub1	Rat	DDE	increases expression	ISO	RGD:1323304	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of BUB1 mRNA	CTD	PMID:38568856
Bub1	Rat	diallyl trisulfide	decreases expression	ISO	RGD:1323304	6480464	diallyl trisulfide results in decreased expression of BUB1 mRNA	CTD	PMID:34995734
Bub1	Rat	dichloroacetic acid	increases expression	ISO	RGD:1323305	6480464	Dichloroacetic Acid results in increased expression of BUB1 mRNA	CTD	PMID:28962523
Bub1	Rat	dicrotophos	decreases expression	ISO	RGD:1323304	6480464	dicrotophos results in decreased expression of BUB1 mRNA	CTD	PMID:28302478
Bub1	Rat	dioxygen	multiple interactions	EXP		6480464	[dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with more ...	CTD	PMID:33729688
Bub1	Rat	doxorubicin	decreases expression	ISO	RGD:1323304	6480464	Doxorubicin results in decreased expression of BUB1 mRNA	CTD	PMID:29803840\|PMID:30031762
Bub1	Rat	ethyl methanesulfonate	decreases expression	ISO	RGD:1323304	6480464	Ethyl Methanesulfonate results in decreased expression of BUB1 mRNA	CTD	PMID:23649840
Bub1	Rat	etoposide	decreases expression	ISO	RGD:1323304	6480464	Etoposide results in decreased expression of BUB1 mRNA	CTD	PMID:16120219
Bub1	Rat	eugenol	decreases expression	ISO	RGD:1323304	6480464	Eugenol results in decreased expression of BUB1 mRNA	CTD	PMID:17374397
Bub1	Rat	fluvastatin	multiple interactions	ISO	RGD:1323304	6480464	[zoledronic acid co-treated with fluvastatin] results in increased expression of BUB1 mRNA	CTD	PMID:16996129
Bub1	Rat	folic acid	multiple interactions	ISO	RGD:1323305	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Bub1	Rat	folic acid	multiple interactions	ISO	RGD:1323304	6480464	[Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of BUB1 mRNA	CTD	PMID:24657277
Bub1	Rat	formaldehyde	decreases expression	ISO	RGD:1323304	6480464	Formaldehyde results in decreased expression of BUB1 mRNA	CTD	PMID:23649840
Bub1	Rat	FR900359	decreases phosphorylation	ISO	RGD:1323304	6480464	FR900359 results in decreased phosphorylation of BUB1 protein	CTD	PMID:37730182
Bub1	Rat	fulvestrant	multiple interactions	ISO	RGD:1323304	6480464	[fulvestrant co-treated with Sirolimus] results in decreased expression of BUB1 mRNA	CTD	PMID:19016759
Bub1	Rat	fulvestrant	decreases expression	ISO	RGD:1323304	6480464	fulvestrant results in decreased expression of BUB1 mRNA	CTD	PMID:19016759
Bub1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of BUB1 mRNA	CTD	PMID:25539665
Bub1	Rat	genistein	affects expression	ISO	RGD:1323304	6480464	Genistein affects the expression of BUB1 mRNA	CTD	PMID:18847459
Bub1	Rat	geraniol	decreases expression	ISO	RGD:1323304	6480464	geraniol results in decreased expression of BUB1 mRNA	CTD	PMID:27683099
Bub1	Rat	GW 4064	increases expression	ISO	RGD:1323304	6480464	GW 4064 results in increased expression of BUB1 mRNA	CTD	PMID:31437187
Bub1	Rat	hydrogen peroxide	affects expression	ISO	RGD:1323304	6480464	Hydrogen Peroxide affects the expression of BUB1 mRNA	CTD	PMID:23410634
Bub1	Rat	irinotecan	decreases expression	ISO	RGD:1323304	6480464	Irinotecan metabolite results in decreased expression of BUB1 mRNA; Irinotecan results in decreased expression of more ...	CTD	PMID:15956246
Bub1	Rat	irinotecan	affects expression	EXP		6480464	Irinotecan affects the expression of BUB1 mRNA	CTD	PMID:20097248
Bub1	Rat	L-ascorbic acid	multiple interactions	ISO	RGD:1323304	6480464	[Quercetin co-treated with Ascorbic Acid] results in increased expression of BUB1 mRNA	CTD	PMID:17639512
Bub1	Rat	L-methionine	multiple interactions	ISO	RGD:1323305	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Bub1	Rat	lead diacetate	decreases expression	ISO	RGD:1323305	6480464	lead acetate results in decreased expression of BUB1 mRNA	CTD	PMID:22613225
Bub1	Rat	leflunomide	decreases expression	ISO	RGD:1323304	6480464	leflunomide results in decreased expression of BUB1 mRNA	CTD	PMID:28988120
Bub1	Rat	lidocaine	increases expression	EXP		6480464	Lidocaine results in increased expression of BUB1 mRNA	CTD	PMID:35283115
Bub1	Rat	lucanthone	decreases expression	ISO	RGD:1323304	6480464	Lucanthone results in decreased expression of BUB1 mRNA	CTD	PMID:21148553
Bub1	Rat	malathion	decreases expression	ISO	RGD:1323304	6480464	Malathion results in decreased expression of BUB1 mRNA	CTD	PMID:16079077
Bub1	Rat	manganese atom	decreases expression	ISO	RGD:1323304	6480464	Manganese results in decreased expression of BUB1 mRNA	CTD	PMID:17175027
Bub1	Rat	manganese(0)	decreases expression	ISO	RGD:1323304	6480464	Manganese results in decreased expression of BUB1 mRNA	CTD	PMID:17175027
Bub1	Rat	manganese(II) chloride	decreases expression	ISO	RGD:1323304	6480464	manganese chloride results in decreased expression of BUB1 mRNA	CTD	PMID:17175027
Bub1	Rat	menadione	affects expression	ISO	RGD:1323304	6480464	Vitamin K 3 affects the expression of BUB1 mRNA	CTD	PMID:20044591\|PMID:23410634
Bub1	Rat	mercury atom	increases expression	ISO	RGD:1323304	6480464	Mercury results in increased expression of BUB1 mRNA	CTD	PMID:16823088
Bub1	Rat	mercury(0)	increases expression	ISO	RGD:1323304	6480464	Mercury results in increased expression of BUB1 mRNA	CTD	PMID:16823088
Bub1	Rat	methotrexate	multiple interactions	ISO	RGD:1323304	6480464	[Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of BUB1 mRNA	CTD	PMID:24657277
Bub1	Rat	methotrexate	decreases expression	ISO	RGD:1323304	6480464	Methotrexate results in decreased expression of BUB1 mRNA	CTD	PMID:24657277
Bub1	Rat	methyl methanesulfonate	decreases expression	ISO	RGD:1323304	6480464	Methyl Methanesulfonate results in decreased expression of BUB1 mRNA	CTD	PMID:23649840
Bub1	Rat	methylmercury chloride	increases expression	ISO	RGD:1323304	6480464	methylmercuric chloride results in increased expression of BUB1 mRNA	CTD	PMID:26272509
Bub1	Rat	methylmercury chloride	decreases expression	ISO	RGD:1323304	6480464	methylmercuric chloride results in decreased expression of BUB1 mRNA	CTD	PMID:34089799
Bub1	Rat	N-methyl-4-phenylpyridinium	decreases expression	ISO	RGD:1323304	6480464	1-Methyl-4-phenylpyridinium results in decreased expression of BUB1 mRNA	CTD	PMID:24810058
Bub1	Rat	N-methyl-N-nitrosourea	increases expression	ISO	RGD:1323305	6480464	Methylnitrosourea results in increased expression of BUB1 mRNA	CTD	PMID:25270620
Bub1	Rat	N-nitrosodiethylamine	multiple interactions	ISO	RGD:1323305	6480464	[Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of BUB1 mRNA; RB1 protein inhibits the more ...	CTD	PMID:17854601\|PMID:24535843
Bub1	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:1323305	6480464	Diethylnitrosamine results in increased expression of BUB1 mRNA	CTD	PMID:17854601\|PMID:24535843
Bub1	Rat	N-Nitrosopyrrolidine	decreases expression	ISO	RGD:1323304	6480464	N-Nitrosopyrrolidine results in decreased expression of BUB1 mRNA	CTD	PMID:32234424
Bub1	Rat	nickel atom	increases expression	ISO	RGD:1323304	6480464	Nickel results in increased expression of BUB1 mRNA	CTD	PMID:25583101
Bub1	Rat	nickel sulfate	decreases expression	ISO	RGD:1323304	6480464	nickel sulfate results in decreased expression of BUB1 mRNA	CTD	PMID:17374397
Bub1	Rat	nocodazole	multiple interactions	ISO	RGD:1323304	6480464	[Nocodazole co-treated with Caffeine] results in increased expression of BUB1 protein modified form; chromium hexavalent more ...	CTD	PMID:21670593
Bub1	Rat	nocodazole	increases phosphorylation	ISO	RGD:1323304	6480464	Nocodazole results in increased phosphorylation of BUB1 protein	CTD	PMID:21670593
Bub1	Rat	O-methyleugenol	increases expression	EXP		6480464	methyleugenol results in increased expression of BUB1 mRNA	CTD	PMID:26011634
Bub1	Rat	okadaic acid	increases expression	ISO	RGD:1323304	6480464	Okadaic Acid results in increased expression of BUB1 mRNA	CTD	PMID:38832940
Bub1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of BUB1 mRNA	CTD	PMID:25729387
Bub1	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of BUB1 mRNA	CTD	PMID:25729387
Bub1	Rat	ozone	multiple interactions	ISO	RGD:1323305	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:19555225\|PMID:27106289\|PMID:34911549
Bub1	Rat	ozone	multiple interactions	ISO	RGD:1323304	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ...	CTD	PMID:32699268
Bub1	Rat	palbociclib	decreases expression	ISO	RGD:1323304	6480464	palbociclib results in decreased expression of BUB1 mRNA	CTD	PMID:22869556
Bub1	Rat	paracetamol	decreases expression	ISO	RGD:1323305	6480464	Acetaminophen results in decreased expression of BUB1 mRNA	CTD	PMID:17942131
Bub1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of BUB1 mRNA	CTD	PMID:33387578
Bub1	Rat	paracetamol	decreases expression	ISO	RGD:1323304	6480464	Acetaminophen results in decreased expression of BUB1 mRNA	CTD	PMID:27761495\|PMID:29067470
Bub1	Rat	paracetamol	increases expression	ISO	RGD:1323304	6480464	Acetaminophen results in increased expression of BUB1 mRNA	CTD	PMID:22230336\|PMID:27761495
Bub1	Rat	paraquat	multiple interactions	ISO	RGD:1323305	6480464	[ATG7 protein affects the susceptibility to Paraquat] which affects the expression of BUB1 mRNA	CTD	PMID:28012437
Bub1	Rat	PCB138	multiple interactions	ISO	RGD:1323305	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Bub1	Rat	perfluorohexanesulfonic acid	increases expression	ISO	RGD:1323305	6480464	perfluorohexanesulfonic acid results in increased expression of BUB1 mRNA	CTD	PMID:37995155
Bub1	Rat	perfluorononanoic acid	decreases expression	ISO	RGD:1323304	6480464	perfluoro-n-nonanoic acid results in decreased expression of BUB1 mRNA	CTD	PMID:32588087
Bub1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1323305	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BUB1 mRNA	CTD	PMID:36331819
Bub1	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of BUB1 mRNA	CTD	PMID:35163327
Bub1	Rat	phenformin	decreases expression	EXP		6480464	Phenformin results in decreased expression of BUB1 mRNA	CTD	PMID:31324951
Bub1	Rat	phenobarbital	multiple interactions	ISO	RGD:1323305	6480464	[Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of BUB1 mRNA; NR1I3 protein affects the more ...	CTD	PMID:19482888\|PMID:24535843
Bub1	Rat	phenobarbital	increases expression	ISO	RGD:1323305	6480464	Phenobarbital results in increased expression of BUB1 mRNA	CTD	PMID:19482888\|PMID:23091169
Bub1	Rat	PhIP	increases expression	ISO	RGD:1323304	6480464	2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of BUB1 mRNA	CTD	PMID:16120219
Bub1	Rat	picoxystrobin	increases expression	ISO	RGD:1323304	6480464	picoxystrobin results in increased expression of BUB1 mRNA	CTD	PMID:33512557
Bub1	Rat	piperonyl butoxide	increases expression	ISO	RGD:1323305	6480464	Piperonyl Butoxide results in increased expression of BUB1 mRNA	CTD	PMID:30572783
Bub1	Rat	pirinixic acid	multiple interactions	ISO	RGD:1323305	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Bub1	Rat	piroxicam	multiple interactions	ISO	RGD:1323304	6480464	[Piroxicam co-treated with Cisplatin] results in decreased expression of BUB1 mRNA	CTD	PMID:21858171
Bub1	Rat	potassium chromate	decreases expression	ISO	RGD:1323304	6480464	potassium chromate(VI) results in decreased expression of BUB1 mRNA	CTD	PMID:22079256
Bub1	Rat	potassium chromate	multiple interactions	ISO	RGD:1323304	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BUB1 mRNA	CTD	PMID:22079256
Bub1	Rat	promethazine	decreases expression	EXP		6480464	Promethazine results in decreased expression of BUB1 mRNA	CTD	PMID:26011634
Bub1	Rat	propanal	decreases expression	ISO	RGD:1323304	6480464	propionaldehyde results in decreased expression of BUB1 mRNA	CTD	PMID:26079696
Bub1	Rat	quercetin	multiple interactions	ISO	RGD:1323304	6480464	[Quercetin co-treated with Ascorbic Acid] results in increased expression of BUB1 mRNA	CTD	PMID:17639512
Bub1	Rat	quercetin	decreases phosphorylation	ISO	RGD:1323304	6480464	Quercetin results in decreased phosphorylation of BUB1 protein	CTD	PMID:35688186
Bub1	Rat	quercetin	decreases expression	ISO	RGD:1323304	6480464	Quercetin results in decreased expression of BUB1 mRNA	CTD	PMID:21632981\|PMID:23727915
Bub1	Rat	resveratrol	decreases expression	ISO	RGD:1323304	6480464	resveratrol results in decreased expression of BUB1 mRNA	CTD	PMID:15767336
Bub1	Rat	resveratrol	multiple interactions	ISO	RGD:1323304	6480464	[Coumestrol co-treated with resveratrol] results in increased expression of BUB1 mRNA	CTD	PMID:19167446
Bub1	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of BUB1 mRNA	CTD	PMID:28374803
Bub1	Rat	rotenone	increases expression	ISO	RGD:1323304	6480464	Rotenone results in increased expression of BUB1 mRNA	CTD	PMID:33512557
Bub1	Rat	silicon dioxide	increases expression	ISO	RGD:1323305	6480464	Silicon Dioxide results in increased expression of BUB1 mRNA	CTD	PMID:29341224
Bub1	Rat	silver(1+) nitrate	increases expression	ISO	RGD:1323304	6480464	Silver Nitrate analog results in increased expression of BUB1 mRNA; Silver Nitrate results in increased more ...	CTD	PMID:22831968
Bub1	Rat	sirolimus	multiple interactions	ISO	RGD:1323304	6480464	[fulvestrant co-treated with Sirolimus] results in decreased expression of BUB1 mRNA	CTD	PMID:19016759
Bub1	Rat	sodium arsenite	increases expression	ISO	RGD:1323304	6480464	sodium arsenite results in increased expression of BUB1 mRNA	CTD	PMID:29301061
Bub1	Rat	sodium arsenite	decreases expression	ISO	RGD:1323304	6480464	sodium arsenite results in decreased expression of BUB1 mRNA	CTD	PMID:38568856
Bub1	Rat	sulforaphane	increases expression	ISO	RGD:1323304	6480464	sulforaphane results in increased expression of BUB1 mRNA	CTD	PMID:31838189
Bub1	Rat	sunitinib	decreases expression	ISO	RGD:1323304	6480464	Sunitinib results in decreased expression of BUB1 mRNA	CTD	PMID:31533062
Bub1	Rat	tamoxifen	increases expression	ISO	RGD:1323305	6480464	Tamoxifen results in increased expression of BUB1 mRNA	CTD	PMID:17555576
Bub1	Rat	tert-butyl hydroperoxide	affects expression	ISO	RGD:1323304	6480464	tert-Butylhydroperoxide affects the expression of BUB1 mRNA	CTD	PMID:23410634
Bub1	Rat	testosterone	multiple interactions	ISO	RGD:1323304	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of BUB1 mRNA	CTD	PMID:21592394
Bub1	Rat	testosterone	decreases expression	ISO	RGD:1323304	6480464	Testosterone results in decreased expression of BUB1 mRNA	CTD	PMID:21592394
Bub1	Rat	tetrachloromethane	increases expression	ISO	RGD:1323305	6480464	Carbon Tetrachloride results in increased expression of BUB1 mRNA	CTD	PMID:17484886\|PMID:27339419\|PMID:31919559
Bub1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of BUB1 mRNA	CTD	PMID:26011634
Bub1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of BUB1 mRNA	CTD	PMID:34492290
Bub1	Rat	thiram	decreases expression	ISO	RGD:1323304	6480464	Thiram results in decreased expression of BUB1 mRNA	CTD	PMID:38568856
Bub1	Rat	titanium dioxide	increases expression	ISO	RGD:1323305	6480464	titanium dioxide results in increased expression of BUB1 mRNA	CTD	PMID:23557971
Bub1	Rat	titanium dioxide	decreases methylation	ISO	RGD:1323305	6480464	titanium dioxide results in decreased methylation of BUB1 gene	CTD	PMID:35295148
Bub1	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of BUB1 mRNA	CTD	PMID:30012374
Bub1	Rat	toluene 2,4-diisocyanate	increases expression	ISO	RGD:1323305	6480464	Toluene 2,4-Diisocyanate results in increased expression of BUB1 mRNA	CTD	PMID:21404309
Bub1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of BUB1 mRNA	CTD	PMID:25729387
Bub1	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of BUB1 mRNA	CTD	PMID:25729387
Bub1	Rat	Tributyltin oxide	decreases expression	ISO	RGD:1323305	6480464	bis(tri-n-butyltin)oxide results in decreased expression of BUB1 mRNA	CTD	PMID:17942131\|PMID:18958704
Bub1	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of BUB1 mRNA	CTD	PMID:33387578
Bub1	Rat	trichostatin A	decreases expression	ISO	RGD:1323304	6480464	trichostatin A results in decreased expression of BUB1 mRNA	CTD	PMID:24935251
Bub1	Rat	triclosan	decreases expression	ISO	RGD:1323304	6480464	Triclosan results in decreased expression of BUB1 mRNA	CTD	PMID:30510588
Bub1	Rat	trimellitic anhydride	increases expression	ISO	RGD:1323305	6480464	trimellitic anhydride results in increased expression of BUB1 mRNA	CTD	PMID:19042947
Bub1	Rat	triphenyl phosphate	increases expression	EXP		6480464	triphenyl phosphate results in increased expression of BUB1 mRNA	CTD	PMID:30589522
Bub1	Rat	triphenyl phosphate	affects expression	ISO	RGD:1323304	6480464	triphenyl phosphate affects the expression of BUB1 mRNA	CTD	PMID:37042841
Bub1	Rat	Triptolide	decreases expression	EXP		6480464	triptolide results in decreased expression of BUB1 mRNA	CTD	PMID:23639586
Bub1	Rat	Triptolide	increases expression	EXP		6480464	triptolide results in increased expression of BUB1 mRNA	CTD	PMID:23639586
Bub1	Rat	troglitazone	decreases expression	ISO	RGD:1323304	6480464	troglitazone results in decreased expression of BUB1 mRNA	CTD	PMID:19140230
Bub1	Rat	trovafloxacin	decreases expression	ISO	RGD:1323305	6480464	trovafloxacin results in decreased expression of BUB1 mRNA	CTD	PMID:35537566
Bub1	Rat	tunicamycin	decreases expression	ISO	RGD:1323304	6480464	Tunicamycin results in decreased expression of BUB1 mRNA	CTD	PMID:22378314\|PMID:29453283
Bub1	Rat	valproic acid	increases expression	ISO	RGD:1323304	6480464	Valproic Acid results in increased expression of BUB1 mRNA	CTD	PMID:19101580
Bub1	Rat	valproic acid	decreases expression	ISO	RGD:1323304	6480464	Valproic Acid results in decreased expression of BUB1 mRNA	CTD	PMID:23179753\|PMID:24935251\|PMID:27188386
Bub1	Rat	vincaleukoblastine	affects response to substance	ISO	RGD:1323304	6480464	BUB1 protein affects the susceptibility to Vinblastine	CTD	PMID:16217747
Bub1	Rat	vorinostat	increases expression	ISO	RGD:1323304	6480464	vorinostat results in increased expression of BUB1 mRNA	CTD	PMID:27188386
Bub1	Rat	zinc atom	increases expression	ISO	RGD:1323304	6480464	Zinc deficiency results in increased expression of BUB1 mRNA; Zinc results in increased expression of more ...	CTD	PMID:18316168\|PMID:22171008
Bub1	Rat	zinc(0)	increases expression	ISO	RGD:1323304	6480464	Zinc deficiency results in increased expression of BUB1 mRNA; Zinc results in increased expression of more ...	CTD	PMID:18316168\|PMID:22171008
Bub1	Rat	zoledronic acid	multiple interactions	ISO	RGD:1323304	6480464	[zoledronic acid co-treated with fluvastatin] results in increased expression of BUB1 mRNA	CTD	PMID:16996129

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bub1	Rat	chromatin remodeling	involved_in	IEA	GO:0140995	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Bub1	Rat	chromosome segregation	acts_upstream_of_or_within	ISO	RGD:1323305	1624291	MGI:3793294 PMID:17938250	RGD	PMID:17938250
Bub1	Rat	intrinsic apoptotic signaling pathway	acts_upstream_of	ISO	RGD:1323305	1624291	MGI:3793294 PMID:17938250	RGD	PMID:17938250
Bub1	Rat	meiotic sister chromatid cohesion, centromeric	involved_in	IBA	FB:FBgn0263855\|PANTHER:PTN000361607\|PomBase:SPCC1322.12c	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bub1	Rat	mitotic spindle assembly checkpoint signaling	involved_in	ISO	RGD:1323304	1624291	PMID:18995837	RGD	PMID:18995837
Bub1	Rat	mitotic spindle assembly checkpoint signaling	involved_in	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bub1	Rat	mitotic spindle assembly checkpoint signaling	involved_in	IBA	FB:FBgn0031696\|FB:FBgn0263855\|PANTHER:PTN000361607\|PomBase:SPCC1322.12c\|PomBase:SPCC1795.01c\|SGD:S000003420\|SGD:S000003550\|TAIR:locus:2050977\|UniProtKB:O43683\|UniProtKB:O60566\|WB:WBGene00004721	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bub1	Rat	mitotic spindle assembly checkpoint signaling	involved_in	IEA	InterPro:IPR015661	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Bub1	Rat	positive regulation of intrinsic apoptotic signaling pathway	acts_upstream_of_or_within	ISO	RGD:1323305	1624291	MGI:3793294 PMID:17938250	RGD	PMID:17938250
Bub1	Rat	positive regulation of maintenance of mitotic sister chromatid cohesion, centromeric	involved_in	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bub1	Rat	positive regulation of maintenance of mitotic sister chromatid cohesion, centromeric	involved_in	ISO	RGD:1323304	1624291	PMID:25308863	RGD	PMID:25308863
Bub1	Rat	regulation of chromosome segregation	involved_in	ISO	RGD:1323304	1624291	PMID:19487456	RGD	PMID:19487456
Bub1	Rat	regulation of chromosome segregation	involved_in	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bub1	Rat	regulation of sister chromatid cohesion	involved_in	ISO	RGD:1323304	1624291	PMID:15723797	RGD	PMID:15723797
Bub1	Rat	regulation of sister chromatid cohesion	involved_in	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bub1	Rat	chromosome	located_in	IEA	UniProtKB-KW:KW-0158	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bub1	Rat	chromosome, centromeric region	located_in	ISO	RGD:1323305	1624291	PMID:12355205	RGD	PMID:12355205
Bub1	Rat	chromosome, centromeric region	located_in	IEA	UniProtKB-KW:KW-0137	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bub1	Rat	condensed chromosome, centromeric region	located_in	ISO	RGD:1323305	1624291	PMID:18084284, PMID:19965387	RGD	PMID:18084284\|PMID:19965387
Bub1	Rat	cytosol	located_in	ISO	RGD:1323304\|UniProtKB:O43683-1\|UniProtKB:O43683-2\|UniProtKB:O43683-3	1624291		RGD	GO_REF:0000052
Bub1	Rat	cytosol	located_in	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bub1	Rat	kinetochore	located_in	ISO	RGD:1323304	1624291	PMID:15020684, PMID:16760428, PMID:17227893, PMID:19465021, PMID:22331848	RGD	PMID:15020684\|PMID:16760428\|PMID:17227893\|PMID:19465021\|PMID:22331848
Bub1	Rat	kinetochore	located_in	IEA	ARBA:ARBA00027576	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Bub1	Rat	kinetochore	located_in	ISO	RGD:1323305	1624291	PMID:15226446, PMID:17227893, PMID:17938250	RGD	PMID:15226446\|PMID:17227893\|PMID:17938250
Bub1	Rat	kinetochore	located_in	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bub1	Rat	kinetochore	is_active_in	IBA	FB:FBgn0263855\|MGI:1100510\|MGI:1333889\|PANTHER:PTN000361607\|PomBase:SPCC1322.12c\|SGD:S000003420\|TAIR:locus:2050977\|UniProtKB:O43683\|UniProtKB:O60566\|WB:WBGene00000275\|WB:WBGene00004721	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bub1	Rat	kinetochore	located_in	IEA	UniProtKB-KW:KW-0995	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bub1	Rat	nucleoplasm	located_in	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bub1	Rat	nucleoplasm	located_in	ISO	RGD:1323304\|UniProtKB:O43683-1\|UniProtKB:O43683-2\|UniProtKB:O43683-3	1624291		RGD	GO_REF:0000052
Bub1	Rat	nucleus	is_active_in	IBA	PANTHER:PTN000361608\|PomBase:SPCC1322.12c\|PomBase:SPCC1795.01c\|SGD:S000003420\|SGD:S000003550\|UniProtKB:O43683\|UniProtKB:O60566\|WB:WBGene00004721	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bub1	Rat	outer kinetochore	part_of	ISO	RGD:1323304	1624291	PMID:22331848	RGD	PMID:22331848
Bub1	Rat	outer kinetochore	part_of	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bub1	Rat	ATP binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Bub1	Rat	ATP binding	enables	IEA	InterPro:IPR000719\|InterPro:IPR017441	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Bub1	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bub1	Rat	histone H2A kinase activity	enables	ISO	RGD:1323304	1624291	PMID:26658523	RGD	PMID:26658523
Bub1	Rat	histone H2A kinase activity	enables	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bub1	Rat	nucleotide binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Bub1	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bub1	Rat	protein binding	enables	ISO	RGD:1323304	1624291	UniProtKB:O43684\|UniProtKB:O60566\|UniProtKB:O95376\|UniProtKB:P03070\|UniProtKB:P46108\|UniProtKB:P53350\|UniProtKB:Q8NG31\|UniProtKB:Q8NG31-2\|UniProtKB:Q9GZQ8\|UniProtKB:Q9Y6D9 PMID:10198256, PMID:14732683, PMID:15525512, PMID:16189514, PMID:16760428, PMID:17981135, PMID:19141287, PMID:20360068, PMID:21988832, PMID:22331848, PMID:22660415, PMID:25416956, PMID:25852190, more ...	RGD	PMID:10198256\|PMID:14732683\|PMID:15525512\|PMID:16189514\|PMID:16760428\|PMID:17981135\|PMID:19141287\|PMID:20360068\|PMID:21988832\|PMID:22331848\|PMID:22660415\|PMID:25416956\|PMID:25852190\|PMID:26496610\|PMID:28514442\|PMID:31515488\|PMID:32296183\|PMID:33961781\|PMID:34013668\|PMID:35044719\|PMID:39009827
Bub1	Rat	protein kinase activity	enables	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bub1	Rat	protein kinase activity	enables	IEA	InterPro:IPR000719\|InterPro:IPR008271	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Bub1	Rat	protein kinase activity	enables	IBA	PANTHER:PTN000361607\|PomBase:SPCC1322.12c\|SGD:S000003420\|UniProtKB:O43683	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bub1	Rat	protein kinase activity	enables	ISO	RGD:1323304	1624291	PMID:18995837, PMID:22331848	RGD	PMID:18995837\|PMID:22331848
Bub1	Rat	protein serine/threonine kinase activity	enables	ISO	RGD:1323304	1624291	PMID:25308863, PMID:26658523, PMID:30429199	RGD	PMID:25308863\|PMID:26658523\|PMID:30429199
Bub1	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB:O43683\|ensembl:ENSP00000302530	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bub1	Rat	cell cycle pathway, mitotic		IEA		6907045		KEGG	rno:04110

Disease Annotations Click to see Annotation Detail View

colon carcinoma (ISO)

colorectal cancer (ISO)

Colorectal Neoplasms (ISO)

COVID-19 (ISO)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

primary autosomal recessive microcephaly 30 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

(S)-amphetamine (ISO)

1,1-dichloroethene (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (EXP,ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-methylcholine (ISO)

2-palmitoylglycerol (ISO)

3-methylcholanthrene (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxynon-2-enal (ISO)

4-nitroquinoline N-oxide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

acrylamide (ISO)

aflatoxin B1 (EXP,ISO)

aflatoxin M1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

alpha-Zearalanol (EXP)

amosite asbestos (ISO)

antimycin A (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

bisphenol AF (ISO)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cordycepin (ISO)

coumestrol (ISO)

cryptolepine (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

DDE (ISO)

diallyl trisulfide (ISO)

dichloroacetic acid (ISO)

dicrotophos (ISO)

dioxygen (EXP)

doxorubicin (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

eugenol (ISO)

fluvastatin (ISO)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (ISO)

geraniol (ISO)

GW 4064 (ISO)

hydrogen peroxide (ISO)

irinotecan (EXP,ISO)

L-ascorbic acid (ISO)

L-methionine (ISO)

lead diacetate (ISO)

leflunomide (ISO)

lidocaine (EXP)

lucanthone (ISO)

malathion (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

menadione (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N-nitrosourea (ISO)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nocodazole (ISO)

O-methyleugenol (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

palbociclib (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenformin (EXP)

phenobarbital (ISO)

PhIP (ISO)

picoxystrobin (ISO)

piperonyl butoxide (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

potassium chromate (ISO)

promethazine (EXP)

propanal (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

silicon dioxide (ISO)

silver(1+) nitrate (ISO)

sirolimus (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (EXP,ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP)

Tributyltin oxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (EXP,ISO)

Triptolide (EXP)

troglitazone (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vincaleukoblastine (ISO)

vorinostat (ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin remodeling (IEA)

chromosome segregation (ISO)

intrinsic apoptotic signaling pathway (ISO)

meiotic sister chromatid cohesion, centromeric (IBA)

mitotic spindle assembly checkpoint signaling (IBA,IEA,ISO)

positive regulation of intrinsic apoptotic signaling pathway (ISO)

positive regulation of maintenance of mitotic sister chromatid cohesion, centromeric (IEA,ISO)

regulation of chromosome segregation (IEA,ISO)

regulation of sister chromatid cohesion (IEA,ISO)

Cellular Component

chromosome (IEA)

chromosome, centromeric region (IEA,ISO)

condensed chromosome, centromeric region (ISO)

cytosol (IEA,ISO)

kinetochore (IBA,IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA)

outer kinetochore (IEA,ISO)

Molecular Function

ATP binding (IEA)

histone H2A kinase activity (IEA,ISO)

nucleotide binding (IEA)

protein binding (ISO)

protein kinase activity (IBA,IEA,ISO)

protein serine/threonine kinase activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Mutations of mitotic checkpoint genes in human cancers.	Cahill DP, etal., Nature. 1998 Mar 19;392(6673):300-3.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Mammalian BUB1 protein kinases: map positions and in vivo expression.	Pangilinan F, etal., Genomics. 1997 Dec 15;46(3):379-88.
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12355205	PMID:15020684	PMID:15226446	PMID:15723797	PMID:16760428	PMID:17227893	PMID:17938250	PMID:18084284	PMID:19465021	PMID:19487456	PMID:19946888	PMID:19965387
PMID:22331848	PMID:24055156

Genomics

Comparative Map Data

Bub1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	135,473,525 - 135,504,921 (-)	NCBI		GRCr8
mRatBN7.2	3	115,020,254 - 115,051,650 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	115,020,254 - 115,051,650 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	118,910,094 - 118,941,495 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	127,505,638 - 127,537,039 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	125,165,975 - 125,197,376 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	120,373,604 - 120,404,910 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	120,373,604 - 120,404,910 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	126,929,123 - 126,960,429 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	115,323,510 - 115,354,906 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	115,230,064 - 115,260,294 (-)	NCBI
Celera	3	113,854,710 - 113,886,108 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

BUB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	110,637,528 - 110,678,063 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	110,637,528 - 110,678,063 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	111,395,105 - 111,435,640 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	111,111,881 - 111,152,135 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	111,111,642 - 111,151,895	NCBI
Celera	2	105,046,046 - 105,086,323 (-)	NCBI		Celera
Cytogenetic Map	2	q13	NCBI
HuRef	2	104,274,404 - 104,314,815 (-)	NCBI		HuRef
CHM1_1	2	111,399,569 - 111,439,978 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	111,060,427 - 111,100,976 (-)	NCBI		T2T-CHM13v2.0

Bub1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	127,642,117 - 127,673,790 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	127,643,036 - 127,673,785 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	127,800,197 - 127,831,859 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	127,801,122 - 127,831,865 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	127,625,936 - 127,657,595 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	127,492,562 - 127,523,236 (-)	NCBI		MGSCv36	mm8
Celera	2	129,026,419 - 129,058,592 (-)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	62.1	NCBI

Bub1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955470	3,152,758 - 3,191,888 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955470	3,152,798 - 3,190,185 (+)	NCBI	ChiLan1.0	ChiLan1.0

BUB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	17,445,607 - 17,533,774 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	17,448,057 - 17,488,719 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	91,393,317 - 91,433,579 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	111,815,335 - 111,855,573 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	111,793,236 - 111,858,392 (+)	Ensembl	panpan1.1		panPan2

BUB1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	35,208,989 - 35,252,296 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	35,208,991 - 35,252,975 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	34,978,541 - 35,021,465 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	35,980,361 - 36,023,634 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	35,980,365 - 36,023,641 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	35,107,041 - 35,149,998 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	35,176,457 - 35,219,422 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	35,386,576 - 35,429,599 (-)	NCBI		UU_Cfam_GSD_1.0

BUB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	45,585,226 - 45,624,543 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	45,585,188 - 45,623,240 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	47,568,892 - 47,584,217 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BUB1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	13,647,342 - 13,698,061 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	13,647,462 - 13,697,932 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666080	5,994,677 - 6,036,649 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bub1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	1,584,186 - 1,639,770 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	1,584,289 - 1,639,334 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bub1
93 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	135
Count of miRNA genes:	99
Interacting mature miRNAs:	115
Transcripts:	ENSRNOT00000051783
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000051783 ⟹ ENSRNOP00000042114

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	115,020,254 - 115,051,650 (-)	Ensembl
Rnor_6.0 Ensembl	3	120,373,604 - 120,404,910 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111791 ⟹ ENSRNOP00000090348

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	115,020,254 - 115,051,456 (-)	Ensembl

RefSeq Acc Id:

NM_001106507 ⟹ NP_001099977

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	135,473,525 - 135,504,921 (-)	NCBI
mRatBN7.2	3	115,020,254 - 115,051,650 (-)	NCBI
Rnor_6.0	3	120,373,604 - 120,404,910 (-)	NCBI
Rnor_5.0	3	126,929,123 - 126,960,429 (+)	NCBI
RGSC_v3.4	3	115,323,510 - 115,354,906 (-)	RGD
Celera	3	113,854,710 - 113,886,108 (-)	RGD

Sequence:

show sequence

CTGACCTCAGCCAGCACCTAGCCTAGGATTCACTAAAGGCCTAAGGGCAAGTGAAAGAACGGCT
GAGGAGGGCGAGGGGGTGGGGGCGGGACTTTGTCTCCCAGCAACGGGCGCAGCGATTGGCCAAC
TTTCCCGCAGCGGAAACCAATAGTCAGGCGCGCTGCCAACGCTCGACATTACAAGTGCGGCTGC
GCGGGGAATTCGAATCGCTGGCCGCCTTCGAGGCTCGGGGTGGGGGCTGATGGGGTGTTTAGTC
GGCGGCTGATGGGGTATTTCACCGCTGCGCGCTTTTTCTCGTCATGGACAACCTCGGAAATGTC
TTTCGTATGTTTGAAGCCCATATGCAAAGCTACAAGGGTAATGACCCACTTGGAGAATGGGAAA
GCTTTATGAAGTGGGTAGAAGAAAATTTTCCTGACAATAAAGAACACTTGGTGACAATATTAGA
ACATTTAATGAAGGAATTCTTAGATAAGAAGAACTACCACAATGATTCAAGATTCATCAGTTAT
TGCTTAAAATTTGCTGAGTACAACAGTGACCGTCATCAGTTTTTTGAGTTTCTGTACAGCCAGG
GAGTTGGAACCAAGTCATCATATCTATACCTGTCCTGGGCAGGGCATCTGGAAGCCCAGGGAGA
GCAGCAGCATGCCAGTGCTATTTTTCAAACAGGAATTCACAATCAGGCTGAACCTATGGAACTA
CTACAACAACAATACAGGCTATTCCAGGCACGCCTTACTGGAACACATTTGCCAGATCAAGCTA
CAACCTCAGAACCTTTGCATAGTGCACAGATTTTAAACCAAGTTATGTTAACAAAGTCAAGTCC
AGAAACAGAAAACTCAGCTTGCGTTCCTAGGAGTCAGGGTTCAGAATGTTCTGGTGTGGCACCT
TCTACTTGTGACGAAAAGTCTAATATTAGGGAACAAAGAGTGATCATGATTTCCAAGTCAGAAT
GCTCTGTCAGCTCATCTATGGCACCCAAGCCTGAAGCTCAGCAAGTTATGTACTGCAAAGAAAA
GCTTATCCGTGGAGATTCGGAATTTTCATTTGAAGAGCTGAGAGCCCAGAAATACAATCAACGA
AAGAAGCATGAACAGTGGGTTAGTGAAGACAGAAATTATATGAAAAGGAAAGAAGCAAATGCTT
TTGAAGAGCAATTATTAAAACAGAAAATGGATGAACTTCACAAGAAATTGCATCAAGTGGTGGA
ATTGTCTCACAAGGACCTGCCTGCTTCTGAGAACAGGCCTGACGCTAATCTAGTATGTGTGGGA
CAAAATACATGCTCCCACCAAGAACTGAGGGGTCTAAGTCTTTCATCCATCAATCAGCAGACCT
CAGAGAACTCAGGAGAGAAACCACTGGAAGAACCTTCTGTTCCTCTTATGGTAAATGCTGTTAA
CAGCACTTTGCTGTTCCCAGCCATCAGCCTGCCATCTCTTCCTATTCCTGTAAGTGGCCAGTCA
GAGACAGATTCCAGAGGTGTGAATCAAAGTATTCGTGAATTCATGACACAGAGTGGACCAGACA
AAAAAGAAGTATGTGAAACAAATAAAGTTGCCAACATTAATGACTTTCATACAACTCCAAACAC
ATCATTGGGAATGGTTCAAGGAACACCATGCAAAGTGCAGCCATCACCAACTGTCCACACCAAG
GAAGCATTAGGTTTCATCATGGATATGTTTCAGGCTCCAACACTTCCTGACATTTCTGATGATA
AAGATGAATGGCCATCTCTAGACCAAAATGAAGATGCATTTGAAGCCCAGTTTCAAAAAAATGC
AGTATTTTCAGAGGACTGGGGAGTTAAAAAGATTATGACTTTATCATCTGCTTTTCCTATTTTT
GAAGACGGAAACAAAGAAAATTATGGCTTACCACAGCCTAAAAATAAGCCTTTAGGAGCTAGGA
CCTTTGGAGAACGATCTCTCAGCAAATGTTCATCAAGATCAAATGAAATGCCTCACACTGATGA
GTTTATGGATGACTCAACAGTATGTGGTATTCGCTACAACAAAACCCTAGCTCCCAGTCCTAAA
AGTATAGGAGACTTTACATCTGCTGCCCAGCTTTCATCTACACCATTCCACAAATTTCCAGCAG
ATCCATTGCAGATTCCAGAAGATAAAGAAAATGTGGTAGCCACACAATATACACATATGGCTTT
GGATTCTTGTAAAGAAAACATGGTGGACCCCTCAAAAGACAGAAAGCTTGGTCTAATTCAAGAG
AAAATTTCAGCATCTTTATCCTGTCCTAGTCAGCCTGCCACAGGTGGTTTGCTCACCCAGGAAG
CAGTGTTCAGCCTTGAGACTTATAAATGCACAGGCACTGACCGTGCGATCATGGAAGACCTATC
AGATGCCAGCGCTGGGCTCCAAGTTGAATGGGTGCAGACTAGTTCATTTGGAAATGTTAATGCT
CCAAACTTTACTATTGAGAACCCATGGGATGATGAATTGATTCTTAAACTTCTATCTGGGCTTT
CTAAGCCAGTTACTTCCTATTCAAATACTTTTGAGTGGCAGAGTAAACTTCCAGCCATCAAGAC
CAAGACAGAATTCCAGTTGGGTTCTTTGCTGGTCTATGTGAATCACCTTCTTGGAGAAGGAGCC
TTTGCTCAAGTCTTTGAAGCTATTCATGGAGATACCAAAAGTAAACAGAAATGTATTTTGAAGG
TGCAGAAACCTGCCAACTCCTGGGAATTCTACATTGGGATGCAGCTGATGGAAAGACTAAAGCC
AGAAGTACATCACATGTTCATCAAGTTTTATTCTGCTCACTTATTCCAGAATGGCAGCATATTA
GTAGGGGAGCTCTATAGCTATGGGACATTACTAAATGTCATTAACCTCTATAAAAATACCTCTG
AGAAAGTGATGCCCCAAGCTCTCGTCATTACTTTCGCTATCAGAATGCTTTACATGGTTGAACA
AGTCCACAGCTGCGAAATCATTCATGGAGACATTAAGCCAGATAACTTCATACTAGGACACAGA
TTTTTGGAACAGGATGATGAAGACTTAGCTACCGGCTTGACATTGATTGACCTGGGTCAGAGTA
TAGATATGAAACTTTTCCCTAAAGGAACTGTATTTACAGGAAAGTGTGAAACATCTGGTTTTCA
GTGCCCTGAGATGCTCAGTAACAAGCCATGGAACTACCAGGTTGATTACTATGGAGTTGCTGCA
TCAATATATTGTATGCTCTTTGGCACTTACATGAAAGTAAAAAATGAAGGAGGAGTCTGGAAAC
CTGAAGGTCTTTTTAGAAGGCTTCCTCATTTGGATATGTGGGAGGAATTCTTTCACATCATGTT
GAATATACCGGATTGTCATAATCTTCCATCTTTGGACTTTCTGAGACAAAAGATGAACAAGTTA
CTTGAACAACAATATTCCAACAAAATTAAGACCTTGCGCAATAGGCTAATTGTGCTTCTTTCAG
AATATAAGCGTTCAAGAAAATAAAATATGAATATGGACCTTCTCCAAAACATACTTTGTAAATT
TAAACTCTCACTTTGGATCCTATTTTTTCATACTTATTATTTATGTATGTTAAAAAAATAAAGC
TACATATGATACACCCATGTGACCTAGTTGTTATAAATATTCTAACAAAGAAAGGAGACCCATG
TAAGCTAGCTGATCTGTTGGCTTGCTTTTGGTGTACAAGTCTTCATGAGAATGATTCAAATTTA
AATGCTTTCTAGAAGTCATTCCCCTGCCCCCAACCCTAAGACAGGGTTTCTCAGTGTAGCCAGA
GCTCTGGCTATTCTGGATGTGATTTGTAAACCATCCTGGCCTCAAGCTCATAGAAAACTGCCTG
CCTTTGCCTCCCAAGTGCTGGGATTACAGGGGTGCACCAACATTCCCTGCTTTAAAAACCTACC
TTTTTAAACACTGACCTATTTAAGTCAAAAGTAAACCAAAAAGAATTAAAAAATGTTTAATTAG
CATATGTAGGATTAAGTTTCCTTTTGGCATTTTAAGAAAAAAAATTGTGTTTGTTGATTTTTCT
TCCCCGTCCTTCTGGCCCCTTTGTTCTCTTTCACACCCCATAGCTTTCATGTCTCATCTGTCCC
TTCCTCCTTTCTCAACATCTTTTTCCCTTAAGGTCTTTTTAATTCATAACCCACACTTATTTTC
CATCCCATTTATATGATATAAACATTATTTTAGGGTCTGCATATGAGAGAAACTTTTTGTCTTT
CTGACTGAGTTCCTTATACTTTCTAACTCCATCTATTTTCATACAAATTTCATGGTGTACATCT
GAGCAGAATTGTGTTATAAATGATACATACACATTACACATCCATCAGTTGGTTGATAAACATC
TGAGCTGATTCTGTTTCCTTGCTGTTGTGAATAGAGGAACAGTTGACATGGATGTGCATGTTGC
TCTTGTAGAAGATTGAATCCTTTGTGTGCTCAGGAGTGGGGAGCTAGGTCATAAACAGTTCTGG
TTTTCTTTCTGTTTGTTTTTTAAGAGACCACCATACTGATTCCACAATGGCCATACTAGGTTGC
ATTTCAACCAATAATGAATACAAATTTCCTCTTTACTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099977	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL80129	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000042114
	ENSRNOP00000042114.3
	ENSRNOP00000090348.1

RefSeq Acc Id:

NP_001099977 ⟸ NM_001106507

- UniProtKB:

D4A5D3 (UniProtKB/TrEMBL), A6HQ28 (UniProtKB/TrEMBL), A0A8I6GIT9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDNLGNVFRMFEAHMQSYKGNDPLGEWESFMKWVEENFPDNKEHLVTILEHLMKEFLDKKNYHN
DSRFISYCLKFAEYNSDRHQFFEFLYSQGVGTKSSYLYLSWAGHLEAQGEQQHASAIFQTGIHN
QAEPMELLQQQYRLFQARLTGTHLPDQATTSEPLHSAQILNQVMLTKSSPETENSACVPRSQGS
ECSGVAPSTCDEKSNIREQRVIMISKSECSVSSSMAPKPEAQQVMYCKEKLIRGDSEFSFEELR
AQKYNQRKKHEQWVSEDRNYMKRKEANAFEEQLLKQKMDELHKKLHQVVELSHKDLPASENRPD
ANLVCVGQNTCSHQELRGLSLSSINQQTSENSGEKPLEEPSVPLMVNAVNSTLLFPAISLPSLP
IPVSGQSETDSRGVNQSIREFMTQSGPDKKEVCETNKVANINDFHTTPNTSLGMVQGTPCKVQP
SPTVHTKEALGFIMDMFQAPTLPDISDDKDEWPSLDQNEDAFEAQFQKNAVFSEDWGVKKIMTL
SSAFPIFEDGNKENYGLPQPKNKPLGARTFGERSLSKCSSRSNEMPHTDEFMDDSTVCGIRYNK
TLAPSPKSIGDFTSAAQLSSTPFHKFPADPLQIPEDKENVVATQYTHMALDSCKENMVDPSKDR
KLGLIQEKISASLSCPSQPATGGLLTQEAVFSLETYKCTGTDRAIMEDLSDASAGLQVEWVQTS
SFGNVNAPNFTIENPWDDELILKLLSGLSKPVTSYSNTFEWQSKLPAIKTKTEFQLGSLLVYVN
HLLGEGAFAQVFEAIHGDTKSKQKCILKVQKPANSWEFYIGMQLMERLKPEVHHMFIKFYSAHL
FQNGSILVGELYSYGTLLNVINLYKNTSEKVMPQALVITFAIRMLYMVEQVHSCEIIHGDIKPD
NFILGHRFLEQDDEDLATGLTLIDLGQSIDMKLFPKGTVFTGKCETSGFQCPEMLSNKPWNYQV
DYYGVAASIYCMLFGTYMKVKNEGGVWKPEGLFRRLPHLDMWEEFFHIMLNIPDCHNLPSLDFL
RQKMNKLLEQQYSNKIKTLRNRLIVLLSEYKRSRK

hide sequence

Ensembl Acc Id:

ENSRNOP00000042114 ⟸ ENSRNOT00000051783

Ensembl Acc Id:

ENSRNOP00000090348 ⟸ ENSRNOT00000111791

Protein Domains

BUB1 N-terminal Protein kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A5D3-F1-model_v2	AlphaFold	D4A5D3	1-1059	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692411

Promoter ID:

EPDNEW_R2936

Type:

initiation region

Name:

Bub1_1

Description:

BUB1 mitotic checkpoint serine/threonine kinase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	120,404,702 - 120,404,762	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311707	AgrOrtholog
BioCyc Gene	G2FUF-47957	BioCyc
Ensembl Genes	ENSRNOG00000032778	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000051783	ENTREZGENE
	ENSRNOT00000051783.5	UniProtKB/TrEMBL
	ENSRNOT00000111791.1	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.430	UniProtKB/TrEMBL
	6.10.130.20	UniProtKB/TrEMBL
	Transferase(Phosphotransferase) domain 1	UniProtKB/TrEMBL
InterPro	Bub1	UniProtKB/TrEMBL
	Kinase-like_dom	UniProtKB/TrEMBL
	Mad3_BUB1_I	UniProtKB/TrEMBL
	Prot_kinase_cat_dom	UniProtKB/TrEMBL
	Protein_kinase_ATP_BS	UniProtKB/TrEMBL
	Ser/Thr_prot_kinase_AS	UniProtKB/TrEMBL
KEGG Report	rno:296137	UniProtKB/TrEMBL
NCBI Gene	296137	ENTREZGENE
PANTHER	Bub1	UniProtKB/TrEMBL
	MITOTIC CHECKPOINT SERINE/THREONINE-PROTEIN KINASE BUB1	UniProtKB/TrEMBL
Pfam	Mad3_BUB1_I	UniProtKB/TrEMBL
	Pkinase	UniProtKB/TrEMBL
PhenoGen	Bub1	PhenoGen
PROSITE	BUB1_N	UniProtKB/TrEMBL
	PROTEIN_KINASE_ATP	UniProtKB/TrEMBL
	PROTEIN_KINASE_DOM	UniProtKB/TrEMBL
	PROTEIN_KINASE_ST	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000032778	RatGTEx
SMART	Mad3_BUB1_I	UniProtKB/TrEMBL
	S_TKc	UniProtKB/TrEMBL
Superfamily-SCOP	Kinase_like	UniProtKB/TrEMBL
UniProt	A0A8I6GIT9	ENTREZGENE, UniProtKB/TrEMBL
	A6HQ28	ENTREZGENE, UniProtKB/TrEMBL
	D4A5D3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-01-23	Bub1	BUB1 mitotic checkpoint serine/threonine kinase	Bub1	budding uninhibited by benzimidazoles 1 homolog (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-01-14	Bub1	budding uninhibited by benzimidazoles 1 homolog (yeast)	Bub1	budding uninhibited by benzimidazoles 1 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Bub1	budding uninhibited by benzimidazoles 1 homolog (S. cerevisiae)	Bub1_predicted	budding uninhibited by benzimidazoles 1 homolog (S. cerevisiae) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Bub1_predicted	budding uninhibited by benzimidazoles 1 homolog (S. cerevisiae) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)