Advanced Search (OLGA)

Gene: C1h11orf58 (similar to human chromosome 11 open reading frame 58) Rattus norvegicus

Analyze

Symbol:

C1h11orf58

Name:

similar to human chromosome 11 open reading frame 58

RGD ID:

1311703

Description:

Orthologous to human C11orf58 (chromosome 11 open reading frame 58); INTERACTS WITH 4,4'-sulfonyldiphenol; aconitine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC293160; MGC109208; RGD1311703; similar to sid2057p; small acidic protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	179,769,283 - 179,780,437 (+)	NCBI		GRCr8
mRatBN7.2	1	170,334,950 - 170,346,864 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	170,334,964 - 170,346,102 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	178,655,061 - 178,666,168 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	185,841,564 - 185,852,671 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	178,554,546 - 178,565,626 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	185,557,633 - 185,569,190 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	185,558,036 - 185,569,190 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	192,524,453 - 192,536,714 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	174,173,969 - 174,185,067 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	174,313,214 - 174,324,312 (+)	NCBI
Celera	1	168,159,824 - 168,170,975 (+)	NCBI		Celera
Cytogenetic Map	1	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

4,4'-sulfonyldiphenol (EXP)

aconitine (EXP)

acrolein (ISO)

arsane (ISO)

arsenic atom (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

carbamazepine (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

enzyme inhibitor (ISO)

flutamide (EXP)

ivermectin (ISO)

lead(0) (ISO)

ozone (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
2.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

C1h11orf58
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	179,769,283 - 179,780,437 (+)	NCBI		GRCr8
mRatBN7.2	1	170,334,950 - 170,346,864 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	170,334,964 - 170,346,102 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	178,655,061 - 178,666,168 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	185,841,564 - 185,852,671 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	178,554,546 - 178,565,626 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	185,557,633 - 185,569,190 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	185,558,036 - 185,569,190 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	192,524,453 - 192,536,714 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	174,173,969 - 174,185,067 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	174,313,214 - 174,324,312 (+)	NCBI
Celera	1	168,159,824 - 168,170,975 (+)	NCBI		Celera
Cytogenetic Map	1	q35	NCBI

C11orf58
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	16,738,647 - 16,758,340 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	16,613,132 - 16,758,340 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	16,760,194 - 16,779,887 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	16,716,770 - 16,734,149 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	11	16,887,272 - 16,907,025 (+)	NCBI		Celera
Cytogenetic Map	11	p15.2	NCBI
HuRef	11	16,444,810 - 16,464,556 (+)	NCBI		HuRef
CHM1_1	11	16,759,347 - 16,779,060 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	16,836,026 - 16,855,719 (+)	NCBI		T2T-CHM13v2.0

1110004F10Rik
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	115,680,596 - 115,704,445 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	115,638,632 - 115,704,445 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	116,081,363 - 116,105,210 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	116,039,397 - 116,105,210 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	123,236,894 - 123,248,724 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	115,884,529 - 115,896,359 (+)	NCBI		MGSCv36	mm8
Celera	7	116,040,094 - 116,051,919 (+)	NCBI		Celera
Cytogenetic Map	7	F1	NCBI
cM Map	7	61.42	NCBI

LOC102005702
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	31,621,023 - 31,642,993 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955414	31,621,806 - 31,642,993 (+)	NCBI	ChiLan1.0	ChiLan1.0

C9H11orf58
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	19,100,962 - 19,118,790 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	19,061,865 - 19,079,699 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	16,822,905 - 16,842,316 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	16,511,509 - 16,530,915 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	16,511,509 - 16,530,915 (+)	Ensembl	panpan1.1		panPan2

C21H11orf58
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	39,397,196 - 39,410,143 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	38,897,633 - 38,910,591 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	40,501,417 - 40,514,335 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	40,501,418 - 40,516,722 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	39,515,032 - 39,527,951 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	39,721,867 - 39,734,797 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	40,060,720 - 40,073,650 (+)	NCBI		UU_Cfam_GSD_1.0

CUNH11orf58
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	46,202,786 - 46,216,251 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936528	2,233,605 - 2,250,269 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936528	2,237,242 - 2,250,227 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C2H11orf58
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	42,322,007 - 42,364,521 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	42,325,578 - 42,364,522 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	45,426,741 - 45,465,694 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CUNH11orf58
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	48,184,630 - 48,203,707 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	48,182,303 - 48,203,686 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	145,622,575 - 145,642,429 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH11orf58
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624766	8,386,111 - 8,403,721 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624766	8,386,114 - 8,407,967 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	392
Count of miRNA genes:	214
Interacting mature miRNAs:	240
Transcripts:	ENSRNOT00000027702
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	137611478	182611478	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	153679879	198679879	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	177339686	222339686	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	153679879	205813246	Rat
8694166	Bw147	Body weight QTL 147	6.83	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	1	153788989	198788989	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	142582336	182383862	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	160573753	210707719	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	160573753	210707719	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	165278545	210278545	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	161077990	206077990	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	168063662	213063662	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	159894717	207261263	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	163992710	208992710	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	155359438	194575574	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	140833106	185833106	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	162753891	207753891	Rat
634315	Niddm45	Non-insulin dependent diabetes mellitus QTL 45	7.16		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	153680016	182383862	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	153680016	183564652	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	172718770	228180370	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	175967553	200707874	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	178547286	206690557	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
1582204	Livw1	Liver weight QTL 1	3.6	0.0003	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	1	170078537	182384005	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	210707719	Rat
1576310	Schws2	Schwannoma susceptibility QTL 2		0.029	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	1	153788989	198788989	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	165707719	210707719	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	173363824	227535316	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	180021436	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	140915717	185915717	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
7411599	Foco11	Food consumption QTL 11	18.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	1	153788989	198788989	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	210707719	Rat

Markers in Region

RH131502

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	170,345,705 - 170,345,895 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	185,558,246 - 185,558,435	NCBI	Rnor6.0
Rnor_5.0	1	192,525,211 - 192,525,400	UniSTS	Rnor5.0
RGSC_v3.4	1	174,184,668 - 174,184,857	UniSTS	RGSC3.4
Celera	1	168,170,576 - 168,170,765	UniSTS
Cytogenetic Map	1	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039106275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089924	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM053223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227559	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000090773 ⟹ ENSRNOP00000074599

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	170,334,964 - 170,346,102 (+)	Ensembl
Rnor_6.0 Ensembl	1	185,558,036 - 185,569,190 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099493 ⟹ ENSRNOP00000092347

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	170,334,991 - 170,345,946 (+)	Ensembl

RefSeq Acc Id:

NM_001013898 ⟹ NP_001013920

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	179,769,283 - 179,780,437 (+)	NCBI
mRatBN7.2	1	170,334,950 - 170,346,105 (+)	NCBI
Rnor_6.0	1	185,558,036 - 185,569,190 (-)	NCBI
Rnor_5.0	1	192,524,453 - 192,536,714 (-)	NCBI
RGSC_v3.4	1	174,173,969 - 174,185,067 (+)	RGD
Celera	1	168,159,824 - 168,170,975 (+)	NCBI

Sequence:

show sequence

CAGCAGTGACGACTGTGGCGGAGAAGGCCCGGAGGGGCTCTGCGTTCTGGAGTGGCGCTGCTTG
GTCCGGCGGCTGGGTGAGGGCTGCTGGTGTCGCGTTTGAGGAGAACTGCGAGTCTGTTTGGCCT
ATACCCATCGGTATCCCAGCTACGATGAGTGCTGCCCGGGAGTCTCACCCGCACGGGGTGAAAC
GTTCAGCCTCTCCCGACGACGATCTTGGATCTAGCAATTGGGAGGCAGCAGACTTGGGCAATGA
AGAAAGAAAACAGAAGTTCTTGAGACTTATGGGTGCAGGAAAGAAAGAACACACTGGTCGTCTT
GTTATAGGAGATCACAAATCAACATCTCACTTCAGAACAGGGGAAGAAGACAAGAAAATTAATG
AAGAGCTGGAGTCTCAGTACCAGCAGAGCATGGACAGCAAACTGTCAGGACGGTACCGGCGGCA
CTGCGGGCTCGGCTTCAGTGAGGTAGAAGATCATGATGGAGAAGGTGATGTGGCTGGGGATGAC
GATGAGGACGACTCTCCTGATGCTGAGAGTCCAGATGACTCGGACAGCGATTCTGAGTCTGAGA
AGGAGGAGTCTGCAGAAGAGCTCCACGCTGCTGCGCATCCTGACGACACAGAAGACCCGAAGAG
CAAAAAAGATGCGAAGAGCAGTTATAAGATGATGTTCGTCAAGTCCAGTGGCTCATAACCACCA
AACACTTAGTCTTTGTATTAAAAGTAAGCCTTATTGTTATAATGCACAGTGGAGGACTGCTTAT
AGAGCACAGACCTTTGTATTATAATTTTTAAAAAGGCCCTTTTAAATAACTACAAAGAGTGTTT
GCTTTCAAATGCCGTGGGTCACATTTCTCCCGGCATGACTATAACCATTTTTGTAAAGAGTCAG
AGTTGTATAAAATGAGAAATAAATACTGCACTCAGCTTCCTTTCATATTAGCATCCTCAGCCCT
CTCTCCACTGTCTGCCCCTGTAGGTGCATCATGGGGGACACTGGCTTTGTCTGTGGTAGCCCTT
TCATCTTCATCTTTTGGTTTGTTCCTATTTTTCTCTTAGATATTCATTTGATACTGTGACATGT
TCCCTTGATTATACTTTGTTAAAGCAGACCTGTCCATCATGGATCTGGCTGCCAGCAGCCATGC
TGCAGACCATTGATGACAGTCCCTGCTTGTTGAGTCTCTGCTCTCAGACTAGAGCAAGCACAGG
ACACTGGTGTGTGGAAGTGCCCTGTCACATCATTTCAAGGTTGCAATCCCAAAATGTCTTTATA
TAATTTGATTTCACTGTATGGTAAAGTTTTGATAAAATTTGGCCAGTTTTTACAGAAGAAATTA
TTTCTCTGCTCATTTAGTCCTGTATATTTAGAAATATGTAAAACTGGATTTTTTTTTTTAAGGT
ACTATGTGACCAAAGTTCATTTTTTCCTCCTAAGGTCTAAATAAAGAGAAAGCAGTTTCCCATA

hide sequence

RefSeq Acc Id:

XM_039106275 ⟹ XP_038962203

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	179,774,954 - 179,780,437 (+)	NCBI
mRatBN7.2	1	170,334,965 - 170,346,105 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013920	(Get FASTA)	NCBI Sequence Viewer
	XP_038962203	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89924	(Get FASTA)	NCBI Sequence Viewer
	EDM17746	(Get FASTA)	NCBI Sequence Viewer
	EDM17747	(Get FASTA)	NCBI Sequence Viewer
	EDM17748	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074599.2
	ENSRNOP00000092347.1

RefSeq Acc Id:	NP_001013920 ⟸ NM_001013898
- UniProtKB:	G3V8R0 (UniProtKB/TrEMBL), A0A8I6AVK1 (UniProtKB/TrEMBL), A6I8D2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSAARESHPHGVKRSASPDDDLGSSNWEAADLGNEERKQKFLRLMGAGKKEHTGRLVIGDHKST SHFRTGEEDKKINEELESQYQQSMDSKLSGRYRRHCGLGFSEVEDHDGEGDVAGDDDEDDSPDA ESPDDSDSDSESEKEESAEELHAAAHPDDTEDPKSKKDAKSSYKMMFVKSSGS hide sequence

Ensembl Acc Id:

ENSRNOP00000074599 ⟸ ENSRNOT00000090773

RefSeq Acc Id:	XP_038962203 ⟸ XM_039106275
- Peptide Label:	isoform X1
- UniProtKB:	Q5FVK5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000092347 ⟸ ENSRNOT00000099493

Protein Domains

Small acidic protein-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8R0-F1-model_v2	AlphaFold	G3V8R0	1-181	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690336

Promoter ID:

EPDNEW_R861

Type:

initiation region

Name:

RGD1311703_1

Description:

similar to sid2057p

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	185,569,149 - 185,569,209	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311703	AgrOrtholog
BioCyc Gene	G2FUF-57722	BioCyc
Ensembl Genes	ENSRNOG00000053659	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000090773.2	UniProtKB/TrEMBL
	ENSRNOT00000099493.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7307309	IMAGE-MGC_LOAD
InterPro	SMAP	UniProtKB/TrEMBL
	SMAP_dom	UniProtKB/TrEMBL
KEGG Report	rno:293160	UniProtKB/TrEMBL
MGC_CLONE	MGC:109208	IMAGE-MGC_LOAD
NCBI Gene	293160	ENTREZGENE
PANTHER	PTHR22175	UniProtKB/TrEMBL
	SMALL ACIDIC PROTEIN	UniProtKB/TrEMBL
Pfam	SMAP	UniProtKB/TrEMBL
PhenoGen	C1h11orf58	PhenoGen
RatGTEx	ENSRNOG00000053659	RatGTEx
UniProt	A0A8I6AVK1	ENTREZGENE, UniProtKB/TrEMBL
	A6I8D2	ENTREZGENE, UniProtKB/TrEMBL
	G3V8R0	ENTREZGENE, UniProtKB/TrEMBL
	Q5FVK5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-06-28	C1h11orf58	similar to human chromosome 11 open reading frame 58	RGD1311703	similar to sid2057p	Name and Symbol changed	629549	APPROVED
2005-12-06	RGD1311703	similar to sid2057p	RGD1311703_predicted	similar to sid2057p (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1311703_predicted	similar to sid2057p (predicted)	LOC293160_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC293160_predicted	similar to sid2057p (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar