Symbol:
Tmem218
Name:
transmembrane protein 218
RGD ID:
1311364
Description:
Predicted to be located in cilium and membrane. Human ortholog(s) of this gene implicated in Joubert syndrome. Orthologous to human TMEM218 (transmembrane protein 218); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC300516; MGC105984; RGD1311364; similar to RIKEN cDNA 1810021J13
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 45,113,368 - 45,128,739 (+) NCBI GRCr8 mRatBN7.2 8 36,924,553 - 36,940,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 36,924,585 - 36,939,927 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 40,934,537 - 40,949,885 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 39,217,611 - 39,232,959 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 37,080,514 - 37,095,863 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 39,687,280 - 39,702,722 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 39,687,269 - 39,702,902 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 39,687,841 - 39,704,008 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 38,459,286 - 38,474,642 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 38,468,051 - 38,483,407 (+) NCBI Celera 8 37,505,411 - 37,520,737 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tmem218 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TMEM218 mRNA] CTD PMID:31150632 Tmem218 Rat (1->4)-beta-D-glucan multiple interactions ISO Tmem218 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMEM218 mRNA CTD PMID:36331819 Tmem218 Rat 1,2-dimethylhydrazine decreases expression ISO Tmem218 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TMEM218 mRNA CTD PMID:22206623 Tmem218 Rat 1,2-dimethylhydrazine multiple interactions ISO Tmem218 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TMEM218 mRNA CTD PMID:22206623 Tmem218 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of TMEM218 mRNA CTD PMID:26496021 Tmem218 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TMEM218 mRNA CTD PMID:21215274 Tmem218 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tmem218 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TMEM218 mRNA CTD PMID:21570461 and PMID:24680724 Tmem218 Rat 2-hydroxypropanoic acid decreases expression ISO TMEM218 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TMEM218 mRNA CTD PMID:30851411 Tmem218 Rat 4,4'-diaminodiphenylmethane affects expression ISO Tmem218 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of TMEM218 mRNA CTD PMID:18648102 Tmem218 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of TMEM218 mRNA CTD PMID:36041667 Tmem218 Rat 4-hydroxyphenyl retinamide increases expression ISO Tmem218 (Mus musculus) 6480464 Fenretinide results in increased expression of TMEM218 mRNA CTD PMID:28973697 Tmem218 Rat arsane affects methylation ISO TMEM218 (Homo sapiens) 6480464 Arsenic affects the methylation of TMEM218 gene CTD PMID:25304211 Tmem218 Rat arsenic atom affects methylation ISO TMEM218 (Homo sapiens) 6480464 Arsenic affects the methylation of TMEM218 gene CTD PMID:25304211 Tmem218 Rat arsenite(3-) multiple interactions ISO TMEM218 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to TMEM218 mRNA] CTD PMID:32406909 Tmem218 Rat benzo[a]pyrene increases expression ISO Tmem218 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TMEM218 mRNA CTD PMID:22228805 Tmem218 Rat benzo[a]pyrene decreases expression ISO Tmem218 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TMEM218 mRNA CTD PMID:22228805 Tmem218 Rat beta-lapachone decreases expression ISO TMEM218 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of TMEM218 mRNA CTD PMID:38218311 Tmem218 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of TMEM218 mRNA and [bisphenol A co-treated with Estradiol] results in decreased expression of TMEM218 mRNA CTD PMID:26496021 and PMID:36041667 Tmem218 Rat bisphenol A increases expression ISO Tmem218 (Mus musculus) 6480464 bisphenol A results in increased expression of TMEM218 mRNA CTD PMID:32156529 Tmem218 Rat bisphenol A increases methylation ISO TMEM218 (Homo sapiens) 6480464 bisphenol A results in increased methylation of TMEM218 gene CTD PMID:31601247 Tmem218 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TMEM218 mRNA CTD PMID:30816183 more ... Tmem218 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of TMEM218 mRNA CTD PMID:36041667 Tmem218 Rat carbon nanotube decreases expression ISO Tmem218 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Tmem218 Rat chromium(6+) decreases expression ISO TMEM218 (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of TMEM218 mRNA CTD PMID:30690063 Tmem218 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of TMEM218 mRNA CTD PMID:24386269 Tmem218 Rat copper(II) sulfate decreases expression ISO TMEM218 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TMEM218 mRNA CTD PMID:19549813 Tmem218 Rat cyclosporin A increases expression ISO TMEM218 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TMEM218 mRNA CTD PMID:27989131 Tmem218 Rat DDE increases expression ISO TMEM218 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of TMEM218 mRNA CTD PMID:38568856 Tmem218 Rat Dibutyl phosphate affects expression ISO TMEM218 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TMEM218 mRNA CTD PMID:37042841 Tmem218 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of TMEM218 mRNA CTD PMID:21266533 Tmem218 Rat entinostat decreases expression ISO TMEM218 (Homo sapiens) 6480464 entinostat results in decreased expression of TMEM218 mRNA CTD PMID:26272509 Tmem218 Rat folic acid multiple interactions ISO Tmem218 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TMEM218 mRNA CTD PMID:22206623 Tmem218 Rat formaldehyde decreases expression ISO TMEM218 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of TMEM218 mRNA CTD PMID:27664576 Tmem218 Rat gallic acid decreases expression ISO TMEM218 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of TMEM218 mRNA CTD PMID:34408198 Tmem218 Rat genistein decreases expression ISO Tmem218 (Mus musculus) 6480464 Genistein results in decreased expression of TMEM218 mRNA CTD PMID:32186404 Tmem218 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TMEM218 mRNA CTD PMID:33387578 Tmem218 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of TMEM218 mRNA CTD PMID:24136188 Tmem218 Rat inulin multiple interactions ISO Tmem218 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TMEM218 mRNA CTD PMID:36331819 Tmem218 Rat mercury dibromide decreases expression ISO TMEM218 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of TMEM218 mRNA CTD PMID:26272509 Tmem218 Rat methylmercury chloride decreases expression ISO TMEM218 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of TMEM218 mRNA CTD PMID:28001369 Tmem218 Rat p-chloromercuribenzoic acid decreases expression ISO TMEM218 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of TMEM218 mRNA CTD PMID:26272509 Tmem218 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of TMEM218 mRNA CTD PMID:27638505 Tmem218 Rat panobinostat decreases expression ISO TMEM218 (Homo sapiens) 6480464 panobinostat results in decreased expression of TMEM218 mRNA CTD PMID:26272509 Tmem218 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tmem218 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMEM218 mRNA more ... CTD PMID:36331819 Tmem218 Rat phenylmercury acetate decreases expression ISO TMEM218 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of TMEM218 mRNA CTD PMID:26272509 Tmem218 Rat potassium chromate decreases expression ISO TMEM218 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of TMEM218 mRNA CTD PMID:22714537 Tmem218 Rat rac-lactic acid decreases expression ISO TMEM218 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TMEM218 mRNA CTD PMID:30851411 Tmem218 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of TMEM218 mRNA CTD PMID:28374803 Tmem218 Rat silicon dioxide decreases expression ISO Tmem218 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of TMEM218 mRNA CTD PMID:19073995 and PMID:33720480 Tmem218 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TMEM218 mRNA CTD PMID:31150632 Tmem218 Rat tetrachloromethane affects expression ISO Tmem218 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of TMEM218 mRNA CTD PMID:31919559 Tmem218 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TMEM218 mRNA] CTD PMID:31150632 Tmem218 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TMEM218 mRNA CTD PMID:34492290 Tmem218 Rat thiram decreases expression ISO TMEM218 (Homo sapiens) 6480464 Thiram results in decreased expression of TMEM218 mRNA CTD PMID:38568856 Tmem218 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of TMEM218 mRNA CTD PMID:30589522 Tmem218 Rat tris(2-butoxyethyl) phosphate affects expression ISO TMEM218 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of TMEM218 mRNA CTD PMID:29024780 Tmem218 Rat urethane decreases expression ISO TMEM218 (Homo sapiens) 6480464 Urethane results in decreased expression of TMEM218 mRNA CTD PMID:28818685 Tmem218 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of TMEM218 mRNA CTD PMID:24136188 Tmem218 Rat valproic acid affects expression ISO Tmem218 (Mus musculus) 6480464 Valproic Acid affects the expression of TMEM218 mRNA CTD PMID:17292431 Tmem218 Rat valproic acid increases methylation ISO TMEM218 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of TMEM218 gene CTD PMID:29154799 Tmem218 Rat valproic acid decreases expression ISO TMEM218 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TMEM218 mRNA CTD PMID:24383497 and PMID:26272509
Tmem218 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 45,113,368 - 45,128,739 (+) NCBI GRCr8 mRatBN7.2 8 36,924,553 - 36,940,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 36,924,585 - 36,939,927 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 40,934,537 - 40,949,885 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 39,217,611 - 39,232,959 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 37,080,514 - 37,095,863 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 39,687,280 - 39,702,722 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 39,687,269 - 39,702,902 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 39,687,841 - 39,704,008 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 38,459,286 - 38,474,642 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 38,468,051 - 38,483,407 (+) NCBI Celera 8 37,505,411 - 37,520,737 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
TMEM218 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 125,094,389 - 125,111,626 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 125,094,389 - 125,111,763 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 124,964,285 - 124,981,522 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 124,471,608 - 124,478,415 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 122,126,435 - 122,133,242 (-) NCBI Celera Cytogenetic Map 11 q24.2 NCBI HuRef 11 120,906,345 - 120,923,734 (-) NCBI HuRef CHM1_1 11 124,850,310 - 124,867,709 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 125,123,053 - 125,140,287 (-) NCBI T2T-CHM13v2.0
Tmem218 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 37,119,519 - 37,134,524 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 37,119,519 - 37,135,996 (+) Ensembl GRCm39 Ensembl GRCm38 9 37,208,223 - 37,223,228 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 37,208,223 - 37,224,700 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 37,015,918 - 37,030,796 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 36,958,004 - 36,972,882 (+) NCBI MGSCv36 mm8 Celera 9 34,421,339 - 34,437,444 (+) NCBI Celera Cytogenetic Map 9 A4 NCBI cM Map 9 20.74 NCBI
Tmem218 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 26,151,452 - 26,166,470 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 26,149,816 - 26,166,470 (-) NCBI ChiLan1.0 ChiLan1.0
TMEM218 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 125,791,275 - 125,807,480 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 126,897,561 - 126,912,333 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 119,924,220 - 119,938,931 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 123,838,459 - 123,853,190 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 123,839,054 - 123,843,682 (-) Ensembl panpan1.1 panPan2
TMEM218 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 9,363,910 - 9,377,471 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 9,371,556 - 9,377,112 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 9,408,241 - 9,422,323 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 9,302,550 - 9,316,639 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 9,310,764 - 9,318,422 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 9,375,367 - 9,389,428 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 9,345,896 - 9,359,966 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 9,382,459 - 9,396,547 (+) NCBI UU_Cfam_GSD_1.0
Tmem218 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 107,270,364 - 107,287,819 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936743 1,517,113 - 1,535,329 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936743 1,519,531 - 1,535,302 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TMEM218 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 52,260,508 - 52,302,638 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 52,270,691 - 52,302,766 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 57,773,829 - 57,818,268 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TMEM218 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 116,257,539 - 116,272,815 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 116,257,158 - 116,272,859 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 9,849,776 - 9,864,598 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tmem218
.
Predicted Target Of
Count of predictions: 65 Count of miRNA genes: 57 Interacting mature miRNAs: 62 Transcripts: ENSRNOT00000012060 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 61337 Bp22 Blood pressure QTL 22 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 42692818 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 70206 Alc20 Alcohol consumption QTL 20 2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 8 30848154 40713225 Rat 1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
RH133660
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 36,939,644 - 36,939,864 (+) MAPPER mRatBN7.2 Rnor_6.0 8 39,702,437 - 39,702,656 NCBI Rnor6.0 Rnor_5.0 8 39,702,990 - 39,703,209 UniSTS Rnor5.0 RGSC_v3.4 8 38,474,357 - 38,474,576 UniSTS RGSC3.4 Celera 8 37,505,477 - 37,505,696 UniSTS RH 3.4 Map 8 320.0 UniSTS Cytogenetic Map 8 q21 UniSTS
G44836
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 36,927,470 - 36,927,716 (+) MAPPER mRatBN7.2 Rnor_6.0 8 39,690,263 - 39,690,508 NCBI Rnor6.0 Rnor_5.0 8 39,690,816 - 39,691,061 UniSTS Rnor5.0 RGSC_v3.4 8 38,462,152 - 38,462,397 UniSTS RGSC3.4 Celera 8 37,517,626 - 37,517,871 UniSTS Cytogenetic Map 8 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012060 ⟹ ENSRNOP00000012060
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 36,924,585 - 36,939,927 (+) Ensembl Rnor_6.0 Ensembl 8 39,687,269 - 39,702,902 (+) Ensembl
RefSeq Acc Id:
NM_001008325 ⟹ NP_001008326
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 45,113,414 - 45,128,739 (+) NCBI mRatBN7.2 8 36,924,605 - 36,939,930 (+) NCBI Rnor_6.0 8 39,687,397 - 39,702,722 (+) NCBI Rnor_5.0 8 39,687,841 - 39,704,008 (+) NCBI RGSC_v3.4 8 38,459,286 - 38,474,642 (+) RGD Celera 8 37,505,411 - 37,520,737 (-) RGD
Sequence:
GGGACGGAGAGCGAGGGGTGAGCCCTGGTGAGGAACCTGAAAGCCAGGATGGCTGGCATGGTGCTGGGAGTGGGTGCTGGCGTGTTCCTCCTCGCTCTGCTCTGGGTGTTGGTGCTGCTGCTGTGTGT
hide sequence
RefSeq Acc Id:
XM_008766050 ⟹ XP_008764272
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 45,113,368 - 45,128,739 (+) NCBI mRatBN7.2 8 36,924,553 - 36,940,564 (+) NCBI Rnor_6.0 8 39,687,280 - 39,702,722 (+) NCBI
Sequence:
TCAGCTAGTAAGAAAGACGCTAGGTGCTGAAAGAGCGTCTTTGATTGGTCCACCATAAATTTTTTAAATGAATTCCGACTTGTGATTCGTCCAAAGTACACCAAAGCCTAGGTGAAGGGGACGGAGAG
hide sequence
RefSeq Acc Id:
NP_001008326 ⟸ NM_001008325
- UniProtKB:
Q5U3Y9 (UniProtKB/Swiss-Prot), A6KRM2 (UniProtKB/TrEMBL)
- Sequence:
MAGMVLGVGAGVFLLALLWVLVLLLCVLLCRASGIARFSIIFVFLGALIITTVLLLFPRASEFPAPQGEMKIVDAFFIGRYVLLAFLSAVFLGGLFLLLTHHVLEPIYAKPLRSC
hide sequence
RefSeq Acc Id:
XP_008764272 ⟸ XM_008766050
- Peptide Label:
isoform X1
- UniProtKB:
Q5U3Y9 (UniProtKB/Swiss-Prot), A6KRM2 (UniProtKB/TrEMBL)
- Sequence:
MAGMVLGVGAGVFLLALLWVLVLLLCVLLCRASGIARFSIIFVFLGALIITTVLLLFPRASEFPAPQGEMKIVDAFFIGRYVLLAFLSAVFLGGLFLLLTHHVLEPIYAKPLRSC
hide sequence
Ensembl Acc Id:
ENSRNOP00000012060 ⟸ ENSRNOT00000012060
RGD ID: 13695857 Promoter ID: EPDNEW_R6381 Type: initiation region Name: Tmem218_1 Description: transmembrane protein 218 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 39,687,409 - 39,687,469 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-09
Tmem218
transmembrane protein 218
RGD1311364
similar to RIKEN cDNA 1810021J13
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1311364
similar to RIKEN cDNA 1810021J13
RGD1311364_predicted
similar to RIKEN cDNA 1810021J13 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1311364_predicted
similar to RIKEN cDNA 1810021J13 (predicted)
LOC300516_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC300516_predicted
similar to RIKEN cDNA 1810021J13 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
