Tnfaip8l2 (TNF alpha induced protein 8 like 2) - Rat Genome Database

Tnfaip8l2 (TNF alpha induced protein 8 like 2) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Tnfaip8l2 (TNF alpha induced protein 8 like 2) Rattus norvegicus

Subscribe to Updates

Symbol:

Tnfaip8l2

Name:

TNF alpha induced protein 8 like 2

RGD ID:

1310519

Description:

Predicted to be involved in negative regulation of T cell activation and negative regulation of inflammatory response. Predicted to be located in lysosome and nucleus. Predicted to be active in cytoplasm. Orthologous to human TNFAIP8L2 (TNF alpha induced protein 8 like 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane; acetamide.

Type:

protein-coding

RefSeq Status:

Previously known as:

LOC310663; RGD1310519; similar to RIKEN cDNA 1810019A08; TIPE2; TNF alpha-induced protein 8-like protein 2; TNFAIP8-like protein 2; tumor necrosis factor alpha-induced protein 8-like protein 2; tumor necrosis factor, alpha-induced protein 8-like 2; tumor necrosis factor, alpha-induced protein 8-like protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	185,399,442 - 185,415,798 (-)	NCBI		GRCr8
mRatBN7.2	2	182,710,433 - 182,726,724 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	182,709,378 - 182,726,760 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	190,375,134 - 190,392,053 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	188,171,377 - 188,186,872 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	183,007,618 - 183,024,547 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	196,309,789 - 196,329,495 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	196,309,790 - 196,323,881 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	215,804,335 - 215,820,349 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	190,044,647 - 190,058,739 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	190,005,724 - 190,021,493 (-)	NCBI
Celera	2	175,247,228 - 175,260,482 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tnfaip8l2	Rat	COVID-19		ISO	TNFAIP8L2 (Homo sapiens)	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226 and REF_RGD_ID:28912744

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tnfaip8l2	Rat	Dravet syndrome		ISO	TNFAIP8L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Severe myoclonic epilepsy in infancy	ClinVar	PMID:28492532
Tnfaip8l2	Rat	gastrointestinal stromal tumor		ISO	TNFAIP8L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Tnfaip8l2	Rat	immunodeficiency 42		ISO	TNFAIP8L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive mendelian susceptibility to mycobacterial diseases due to complete RORgamma receptor deficiency	ClinVar	PMID:28492532
Tnfaip8l2	Rat	MHC class II deficiency		ISO	TNFAIP8L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: MHC class II deficiency	ClinVar	PMID:28492532
Tnfaip8l2	Rat	parathyroid carcinoma		ISO	TNFAIP8L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532
Tnfaip8l2	Rat	severe congenital neutropenia 3		ISO	TNFAIP8L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Kostmann syndrome	ClinVar	PMID:28492532
Tnfaip8l2	Rat	severe congenital neutropenia 5		ISO	TNFAIP8L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital neutropenia-myelofibrosis-nephromegaly syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tnfaip8l2	Rat	1,2-dimethylhydrazine	increases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:22206623
Tnfaip8l2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of TNFAIP8L2 mRNA	CTD	PMID:34747641
Tnfaip8l2	Rat	4,4'-diaminodiphenylmethane	increases expression	EXP		6480464	4 and 4'-diaminodiphenylmethane results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:30723492
Tnfaip8l2	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Tnfaip8l2 (Mus musculus)	6480464	bisphenol S affects the methylation of TNFAIP8L2 exon	CTD	PMID:33297965
Tnfaip8l2	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	Fenretinide results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:28973697
Tnfaip8l2	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:31881176
Tnfaip8l2	Rat	aflatoxin B1	decreases expression	EXP		6480464	Aflatoxin B1 results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:33354967
Tnfaip8l2	Rat	antirheumatic drug	decreases expression	ISO	TNFAIP8L2 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:24449571
Tnfaip8l2	Rat	benzo[a]pyrene	increases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:22228805
Tnfaip8l2	Rat	benzo[a]pyrene	decreases methylation	ISO	TNFAIP8L2 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of TNFAIP8L2 promoter	CTD	PMID:27901495
Tnfaip8l2	Rat	benzo[a]pyrene	multiple interactions	ISO	Tnfaip8l2 (Mus musculus)	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of TNFAIP8L2 mRNA]	CTD	PMID:22228805
Tnfaip8l2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:25181051 more ...
Tnfaip8l2	Rat	bisphenol A	increases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	bisphenol A results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:32156529
Tnfaip8l2	Rat	carbon nanotube	increases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:25554681
Tnfaip8l2	Rat	chloroprene	decreases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	Chloroprene results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:23125180
Tnfaip8l2	Rat	choline	multiple interactions	ISO	Tnfaip8l2 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:20938992
Tnfaip8l2	Rat	copper atom	decreases expression	EXP		6480464	Copper results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:30556269
Tnfaip8l2	Rat	copper(0)	decreases expression	EXP		6480464	Copper results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:30556269
Tnfaip8l2	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:27523638
Tnfaip8l2	Rat	Dibutyl phosphate	affects expression	ISO	TNFAIP8L2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of TNFAIP8L2 mRNA	CTD	PMID:37042841
Tnfaip8l2	Rat	diclofenac	increases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	Diclofenac results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:26934552
Tnfaip8l2	Rat	diuron	decreases expression	ISO	TNFAIP8L2 (Homo sapiens)	6480464	Diuron results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:35967413
Tnfaip8l2	Rat	ethanol	multiple interactions	ISO	Tnfaip8l2 (Mus musculus)	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:30517762
Tnfaip8l2	Rat	folic acid	multiple interactions	ISO	Tnfaip8l2 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:20938992
Tnfaip8l2	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:22061828
Tnfaip8l2	Rat	L-methionine	multiple interactions	ISO	Tnfaip8l2 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:20938992
Tnfaip8l2	Rat	lidocaine	increases expression	EXP		6480464	Lidocaine results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:35283115
Tnfaip8l2	Rat	lipopolysaccharide	multiple interactions	ISO	TNFAIP8L2 (Homo sapiens)	6480464	[Acetaminophen co-treated with Lipopolysaccharides] affects the expression of TNFAIP8L2 mRNA	CTD	PMID:31059760
Tnfaip8l2	Rat	N,N-diethyl-m-toluamide	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in increased methylation of TNFAIP8L2 gene	CTD	PMID:33148267
Tnfaip8l2	Rat	N-methyl-4-phenylpyridinium	decreases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:28801915
Tnfaip8l2	Rat	nickel atom	decreases expression	ISO	TNFAIP8L2 (Homo sapiens)	6480464	Nickel results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:23195993
Tnfaip8l2	Rat	nickel atom	increases expression	ISO	TNFAIP8L2 (Homo sapiens)	6480464	Nickel results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:24768652 and PMID:25583101
Tnfaip8l2	Rat	nitrates	multiple interactions	ISO	Tnfaip8l2 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:35964746
Tnfaip8l2	Rat	ozone	multiple interactions	ISO	Tnfaip8l2 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of TNFAIP8L2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:34911549
Tnfaip8l2	Rat	paracetamol	increases expression	ISO	TNFAIP8L2 (Homo sapiens)	6480464	Acetaminophen results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:26690555
Tnfaip8l2	Rat	paracetamol	multiple interactions	ISO	TNFAIP8L2 (Homo sapiens)	6480464	[Acetaminophen co-treated with Lipopolysaccharides] affects the expression of TNFAIP8L2 mRNA	CTD	PMID:31059760
Tnfaip8l2	Rat	permethrin	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in increased methylation of TNFAIP8L2 gene	CTD	PMID:33148267
Tnfaip8l2	Rat	resveratrol	increases expression	EXP		6480464	resveratrol results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:25905778
Tnfaip8l2	Rat	serpentine asbestos	increases methylation	ISO	TNFAIP8L2 (Homo sapiens)	6480464	Asbestos and Serpentine results in increased methylation of TNFAIP8L2 5' UTR	CTD	PMID:29523930
Tnfaip8l2	Rat	tacrolimus hydrate	increases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	Tacrolimus results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:29362864
Tnfaip8l2	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:31150632
Tnfaip8l2	Rat	tetrachloromethane	multiple interactions	ISO	Tnfaip8l2 (Mus musculus)	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:30517762
Tnfaip8l2	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:34492290
Tnfaip8l2	Rat	titanium dioxide	decreases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	titanium dioxide results in decreased expression of TNFAIP8L2 mRNA	CTD	PMID:29264374
Tnfaip8l2	Rat	titanium dioxide	decreases methylation	ISO	Tnfaip8l2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of TNFAIP8L2 gene	CTD	PMID:35295148
Tnfaip8l2	Rat	triptonide	increases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	triptonide results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:33045310
Tnfaip8l2	Rat	troglitazone	increases expression	ISO	Tnfaip8l2 (Mus musculus)	6480464	troglitazone results in increased expression of TNFAIP8L2 mRNA	CTD	PMID:28973697

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tnfaip8l2	Rat	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tnfaip8l2	Rat	innate immune response	involved_in	IEA	UniProtKB-KW:KW-0399	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tnfaip8l2	Rat	negative regulation of inflammatory response	involved_in	IBA	MGI:1917019 and PANTHER:PTN000298385	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tnfaip8l2	Rat	negative regulation of inflammatory response	acts_upstream_of_or_within	ISO	Tnfaip8l2 (Mus musculus)	1624291	MGI:3810526 PMID:21466895	RGD	PMID:21466895
Tnfaip8l2	Rat	negative regulation of T cell activation	acts_upstream_of_or_within	ISO	Tnfaip8l2 (Mus musculus)	1624291	PMID:21963221	RGD	PMID:21963221
Tnfaip8l2	Rat	negative regulation of T cell activation	involved_in	IBA	MGI:1917019 and PANTHER:PTN000298385	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tnfaip8l2	Rat	regulation of apoptotic process	involved_in	IEA	InterPro:IPR008477	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tnfaip8l2	Rat	T cell activation	acts_upstream_of	ISO	Tnfaip8l2 (Mus musculus)	1624291	PMID:21963221	RGD	PMID:21963221

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tnfaip8l2	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tnfaip8l2	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tnfaip8l2	Rat	cytoplasm	located_in	ISO	Tnfaip8l2 (Mus musculus)	1624291	PMID:20663561 and PMID:21963221	RGD	PMID:20663561 and PMID:21963221
Tnfaip8l2	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0034894 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tnfaip8l2	Rat	lysosome	located_in	IEA	UniProtKB-SubCell:SL-0158	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tnfaip8l2	Rat	lysosome	located_in	IEA	UniProtKB-KW:KW-0458	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tnfaip8l2	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tnfaip8l2	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tnfaip8l2	Rat	protein binding	enables	ISO	Tnfaip8l2 (Mus musculus)	1624291	UniProtKB:O89110 and PMID:18455983	RGD	PMID:18455983
Tnfaip8l2	Rat	protein binding	enables	ISO	TNFAIP8L2 (Homo sapiens)	1624291	UniProtKB:P15153 more ...	RGD	PMID:22949657 and PMID:24274578

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:20663561	PMID:21466895	PMID:21963221	PMID:27666960	PMID:28849230	PMID:32333940	PMID:35842555	PMID:37493703

Tnfaip8l2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	185,399,442 - 185,415,798 (-)	NCBI		GRCr8
mRatBN7.2	2	182,710,433 - 182,726,724 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	182,709,378 - 182,726,760 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	190,375,134 - 190,392,053 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	188,171,377 - 188,186,872 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	183,007,618 - 183,024,547 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	196,309,789 - 196,329,495 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	196,309,790 - 196,323,881 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	215,804,335 - 215,820,349 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	190,044,647 - 190,058,739 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	190,005,724 - 190,021,493 (-)	NCBI
Celera	2	175,247,228 - 175,260,482 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

TNFAIP8L2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	151,156,649 - 151,159,749 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	151,156,649 - 151,159,749 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	151,129,125 - 151,132,225 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	149,395,729 - 149,398,849 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	124,244,396 - 124,247,516 (+)	NCBI		Celera
Cytogenetic Map	1	q21.3	NCBI
HuRef	1	122,507,131 - 122,510,251 (+)	NCBI		HuRef
CHM1_1	1	152,524,432 - 152,527,552 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	150,280,351 - 150,283,451 (+)	NCBI		T2T-CHM13v2.0

Tnfaip8l2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	95,046,832 - 95,051,581 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	95,046,832 - 95,049,671 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	95,139,521 - 95,142,416 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	95,139,521 - 95,142,360 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	94,943,443 - 94,946,282 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	95,224,925 - 95,227,764 (-)	NCBI		MGSCv36	mm8
Celera	3	96,570,653 - 96,573,492 (-)	NCBI		Celera
Cytogenetic Map	3	F2.1	NCBI
cM Map	3	40.74	NCBI

Tnfaip8l2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955588	514,567 - 517,314 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955588	514,567 - 517,314 (+)	NCBI	ChiLan1.0	ChiLan1.0

TNFAIP8L2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	98,674,162 - 98,680,598 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	98,425,363 - 98,429,300 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	126,504,849 - 126,508,578 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	130,154,121 - 130,157,238 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	130,156,187 - 130,156,741 (+)	Ensembl	panpan1.1		panPan2

TNFAIP8L2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	60,219,239 - 60,222,818 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	60,221,592 - 60,222,146 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	59,663,376 - 59,666,183 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	61,235,930 - 61,238,737 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	61,237,700 - 61,238,254 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	60,064,635 - 60,067,442 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	60,149,971 - 60,152,778 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	60,877,934 - 60,880,741 (+)	NCBI		UU_Cfam_GSD_1.0

Tnfaip8l2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	22,327,252 - 22,330,318 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936580	1,357,673 - 1,360,199 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936580	1,357,076 - 1,360,233 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TNFAIP8L2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	98,093,426 - 98,096,531 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	98,093,426 - 98,096,819 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	107,346,209 - 107,349,558 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TNFAIP8L2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	12,530,625 - 12,534,278 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	12,531,052 - 12,533,694 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	12,108,506 - 12,112,033 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tnfaip8l2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	18,695,083 - 18,697,688 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	18,695,670 - 18,698,304 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Tnfaip8l2
84 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	44
Interacting mature miRNAs:	45
Transcripts:	ENSRNOT00000028642
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

BF399368

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	182,727,070 - 182,727,226 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	196,324,228 - 196,324,383	NCBI	Rnor6.0
Rnor_5.0	2	215,820,696 - 215,820,851	UniSTS	Rnor5.0
RGSC_v3.4	2	190,059,086 - 190,059,241	UniSTS	RGSC3.4
Celera	2	175,260,829 - 175,260,984	UniSTS
RH 3.4 Map	2	1194.01	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH132449

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	182,710,532 - 182,710,737 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	196,309,889 - 196,310,093	NCBI	Rnor6.0
Rnor_5.0	2	215,804,435 - 215,804,639	UniSTS	Rnor5.0
RGSC_v3.4	2	190,044,747 - 190,044,951	UniSTS	RGSC3.4
Celera	2	175,247,328 - 175,247,532	UniSTS
RH 3.4 Map	2	1212.9	UniSTS
Cytogenetic Map	2	q34	UniSTS

AI454737

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	182,710,191 - 182,710,410 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	196,309,548 - 196,309,766	NCBI	Rnor6.0
Rnor_5.0	2	215,804,094 - 215,804,312	UniSTS	Rnor5.0
RGSC_v3.4	2	190,044,406 - 190,044,624	UniSTS	RGSC3.4
Celera	2	175,246,987 - 175,247,205	UniSTS
RH 3.4 Map	2	1195.21	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH134839

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	182,709,967 - 182,710,155 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	196,309,324 - 196,309,511	NCBI	Rnor6.0
Rnor_5.0	2	215,803,870 - 215,804,057	UniSTS	Rnor5.0
RGSC_v3.4	2	190,044,182 - 190,044,369	UniSTS	RGSC3.4
Celera	2	175,246,763 - 175,246,950	UniSTS
RH 3.4 Map	2	1213.8	UniSTS
Cytogenetic Map	2	q34	UniSTS

UniSTS:234754

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	182,710,444 - 182,710,713 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	196,309,801 - 196,310,069	NCBI	Rnor6.0
Rnor_5.0	2	215,804,347 - 215,804,615	UniSTS	Rnor5.0
RGSC_v3.4	2	190,044,659 - 190,044,927	UniSTS	RGSC3.4
Celera	2	175,247,240 - 175,247,508	UniSTS
Cytogenetic Map	2	q34	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	47	113	91	90	59	25	59	6	216	95	93	45	60	31


RefSeq Transcripts	NM_001014039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117098	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028642 ⟹ ENSRNOP00000028642

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	182,709,378 - 182,726,760 (-)	Ensembl
Rnor_6.0 Ensembl	2	196,309,790 - 196,323,881 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116833 ⟹ ENSRNOP00000094344

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	182,709,404 - 182,714,466 (-)	Ensembl

RefSeq Acc Id:

NM_001014039 ⟹ NP_001014061

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	185,399,442 - 185,415,736 (-)	NCBI
mRatBN7.2	2	182,710,433 - 182,726,724 (-)	NCBI
Rnor_6.0	2	196,309,789 - 196,323,881 (-)	NCBI
Rnor_5.0	2	215,804,335 - 215,820,349 (-)	NCBI
RGSC_v3.4	2	190,044,647 - 190,058,739 (-)	RGD
Celera	2	175,247,228 - 175,260,482 (-)	RGD

Sequence:

show sequence

GTCACATCTTCAGGCACCCTCTTTTGCTGTGCATTCTCTCCAACAGAGATAATCCTCACCCCCAGTGACAATGACTGTGTGTGGCACTCAACCAGAATCCAAGTGTCCAACTGAGGTCTTTCTGCTGA
ACTTGGGCCCCACCTAGATCATGATTTGTTGGGCTGCTCTTGGGACACTGGACTTCTTGGTGACAGTGGTGATGAACCGGAGGTGGAGAGTAGGTAGGCGGGGCTTGGGGTGGGGCTAGACCAAAGGG
CCTCTAAGGAGCTTCTCCTTTCTGCTAGCTCTCAGACACATCCAAAGCAAGACCGGCACCCAGCGCACAGCAGTCACAGACCACATAGGGTCACCTAGCACCATGGAGTCCTTCAGCTCAAAGAGTCT
GGCACTACAAGCGGAGAAGAAGCTGCTGAGTAAAATGGCTGGTCGGTCCGTGGCGCATCTCTTTATCGATGAGACTAGCAGCGAGGTGCTAGACGAGCTTTACCGCGTCTCCAAAGAATACACGCACA
GCCGGTCCAAGGCACAACGGGTGATCAAAGACCTCATCAAGGTGGCCGTCAAGGTGGCGGTGCTGCACCGCAGTGGCTGCTTTAGCCCTGGGGAGCTGGCTCTGGCTACACGATTTCGCCAGAAGCTG
CGGCAGGGTGCGATGACTGCACTTAGCTTTGGTGAGGTGGACTTCACCTTTGAGGCTGCTGTGCTAGCAGGTCTGCTCATCGAGTGCCGGGAGATTCTGCTGGAGCTGGTGGAGCACCACCTCACACC
CAAGTCACATGACCGCATCAGACACGTGTTTGATCACTACTCTGACCCTGACCTGCTGACTGCCCTCTACGGGCCCGACTTCACTCAGCACCTTGACAAGATCTGTGATGGGCTCCGGAAGCTTCTAG
ACGAGGGGAAGCTCTGAGGCTCCTGAGCTCAGCACACTGGACTTTGGCAAAATGACTGACCGGGAAACGACACTTCGGGCTTTCTAACCCGCACAAATGCTTTTCAATCCCCTGGCTTCATTCTCTCC
CAAGAGTGCTATTGACACCGAGGCCACCCCCACCCCCAAACTGCTGGTGGAATAAAGTAAGACTGAGCTGAGTGAGGCGGCTCTCCCATCCAGTTCCAGTAAAGGAAACAGCTGACTGAAGAAGAAGT
GAAACTCCGATCCGCCTCTCCCAGGATGGCTGCACAGAACAGGGGATCCTCCTTCTCCACAAACCCAAGGAAGGGGACACTAAAGGCCAGACCAGGAAGGTGGCCATCGGAGACCTCCTGGATCTCCT
CCAGTTGGAGGCAGCACTTGGACACACACAGATGCTGTGTTTCAGAGCTTCTAGAAGGAGCTGAGGGAAGGGAGGCACAGGGGAAATAAAACCACTGAAACATGCAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_017590897 ⟹ XP_017446386

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	185,399,444 - 185,415,798 (-)	NCBI
mRatBN7.2	2	182,710,435 - 182,726,713 (-)	NCBI
Rnor_6.0	2	196,309,791 - 196,323,905 (-)	NCBI

Sequence:

show sequence

CTCTATTAAGTGTGTGTCCCTGAGGTCACATCTTCAGGCACCCTCTTTTGCTGTGCATTCTCTC
CAACAGAGATAATCCTCACCCCCAGTGACAATGACTGTGTGTGGCACTCAACCAGAATCCAAGTGTCCAACTGAGGTCTTTCTGCTGAACTTGGGCCCCACCTAGATCATGATTTGTTGGGCTGCTCT
TGGGACACTGGACTTCTTGGTGACAGTGGTGATGAACCGGAGGTGGAGAGTAGTCACAGACCACATAGGGTCACCTAGCACCATGGAGTCCTTCAGCTCAAAGAGTCTGGCACTACAAGCGGAGAAGA
AGCTGCTGAGTAAAATGGCTGGTCGGTCCGTGGCGCATCTCTTTATCGATGAGACTAGCAGCGAGGTGCTAGACGAGCTTTACCGCGTCTCCAAAGAATACACGCACAGCCGGTCCAAGGCACAACGG
GTGATCAAAGACCTCATCAAGGTGGCCGTCAAGGTGGCGGTGCTGCACCGCAGTGGCTGCTTTAGCCCTGGGGAGCTGGCTCTGGCTACACGATTTCGCCAGAAGCTGCGGCAGGGTGCGATGACTGC
ACTTAGCTTTGGTGAGGTGGACTTCACCTTTGAGGCTGCTGTGCTAGCAGGTCTGCTCATCGAGTGCCGGGAGATTCTGCTGGAGCTGGTGGAGCACCACCTCACACCCAAGTCACATGACCGCATCA
GACACGTGTTTGATCACTACTCTGACCCTGACCTGCTGACTGCCCTCTACGGGCCCGACTTCACTCAGCACCTTGACAAGATCTGTGATGGGCTCCGGAAGCTTCTAGACGAGGGGAAGCTCTGAGGC
TCCTGAGCTCAGCACACTGGACTTTGGCAAAATGACTGACCGGGAAACGACACTTCGGGCTTTCTAACCCGCACAAATGCTTTTCAATCCCCTGGCTTCATTCTCTCCCAAGAGTGCTATTGACACCG
AGGCCACCCCCACCCCCAAACTGCTGGTGGAATAAAGTAAGACTGAGCTGAGTGAGGCGGCTCTCCCATCCAGTTCCAGTAAAGGAAACAGCTGACTGAAGAAGAAGTGAAACTCCGATCCGCCTCTC
CCAGGATGGCTGCACAGAACAGGGGATCCTCCTTCTCCACAAACCCAAGGAAGGGGACACTAAAGGCCAGACCAGGAAGGTGGCCATCGGAGACCTCCTGGATCTCCTCCAGTTGGAGGCAGCACTTG
GACACACACAGATGCTGTGTTTCAGAGCTTCTAGAAGGAGCTGAGGGAAGGGAGGCACAGGGGAAATAAAACCACTGAAACATG

hide sequence


Protein RefSeqs	NP_001014061	(Get FASTA)	NCBI Sequence Viewer
	XP_017446386	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79019	(Get FASTA)	NCBI Sequence Viewer
	EDL85748	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028642
	ENSRNOP00000028642.3
	ENSRNOP00000094344.1
	ENSRNOP00000110113
GenBank Protein	Q6AYJ8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001014061 ⟸ NM_001014039
- UniProtKB:	Q6AYJ8 (UniProtKB/Swiss-Prot), A6K2V2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRSKAQRVIKDLIKVAVKVAVLHRSGCFSPGELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLIECREILL ELVEHHLTPKSHDRIRHVFDHYSDPDLLTALYGPDFTQHLDKICDGLRKLLDEGKL hide sequence

RefSeq Acc Id:

XP_017446386 ⟸ XM_017590897

- Peptide Label:

isoform X1

- Sequence:

show sequence

MICWAALGTLDFLVTVVMNRRWRVVTDHIGSPSTMESFSSKSLALQAEKKLLSKMAGRSVAHLF
IDETSSEVLDELYRVSKEYTHSRSKAQRVIKDLIKVAVKVAVLHRSGCFSPGELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLIECREILLELVEHHLTPKSHDRIRHVFDHYSDPDLLTA
LYGPDFTQHLDKICDGLRKLLDEGKL

hide sequence

Ensembl Acc Id:

ENSRNOP00000028642 ⟸ ENSRNOT00000028642

Ensembl Acc Id:

ENSRNOP00000094344 ⟸ ENSRNOT00000116833

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYJ8-F1-model_v2	AlphaFold	Q6AYJ8	1-184	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

Promoter ID:

Type:

multiple initiation site

Name:

Tnfaip8l2_1

Description:

TNF alpha induced protein 8 like 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	196,312,566 - 196,312,626	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-52111	BioCyc
Ensembl Genes	ENSRNOG00000021100	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000028642	ENTREZGENE
	ENSRNOT00000028642.5	UniProtKB/Swiss-Prot
	ENSRNOT00000116833.1	UniProtKB/Swiss-Prot
	ENSRNOT00000125109	ENTREZGENE
Gene3D-CATH	1.20.1440.160	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7113794	IMAGE-MGC_LOAD
InterPro	TNFAIP8-like	UniProtKB/Swiss-Prot
	TNFAIP8_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:310663	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93944	IMAGE-MGC_LOAD
NCBI Gene	310663	ENTREZGENE
PANTHER	PTHR12757	UniProtKB/Swiss-Prot
	TUMOR NECROSIS FACTOR ALPHA-INDUCED PROTEIN 8-LIKE PROTEIN 2	UniProtKB/Swiss-Prot
Pfam	DUF758	UniProtKB/Swiss-Prot
PhenoGen	Tnfaip8l2	PhenoGen
RatGTEx	ENSRNOG00000021100	RatGTEx
UniProt	A6K2V2	ENTREZGENE, UniProtKB/TrEMBL
	Q6AYJ8	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-02	Tnfaip8l2	TNF alpha induced protein 8 like 2	Tnfaip8l2	tumor necrosis factor, alpha-induced protein 8-like 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Tnfaip8l2	tumor necrosis factor, alpha-induced protein 8-like 2	RGD1310519	similar to RIKEN cDNA 1810019A08	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1310519	similar to RIKEN cDNA 1810019A08	RGD1310519_predicted	similar to RIKEN cDNA 1810019A08 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310519_predicted	similar to RIKEN cDNA 1810019A08 (predicted)	LOC310663_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC310663_predicted	similar to RIKEN cDNA 1810019A08 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL