Symbol:
Irgq
Name:
immunity-related GTPase Q
RGD ID:
1309409
Description:
Predicted to enable protein-macromolecule adaptor activity. Predicted to be involved in positive regulation of autophagy; protein quality control for misfolded or incompletely synthesized proteins; and substrate localization to autophagosome. Predicted to be active in autophagosome and lysosome. Orthologous to human IRGQ (immunity related GTPase Q); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
immunity-related GTPase family, Q; LOC292708; RGD1309409; similar to FKSG27
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 89,251,846 - 89,259,799 (+) NCBI GRCr8 mRatBN7.2 1 80,123,925 - 80,131,881 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,123,925 - 80,131,881 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 85,517,541 - 85,525,491 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,067,378 - 94,075,331 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 87,273,366 - 87,281,317 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 81,395,922 - 81,403,872 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 81,395,841 - 81,399,672 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 82,656,242 - 82,664,190 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 79,816,826 - 79,824,777 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 79,893,608 - 79,902,886 (+) NCBI Celera 1 74,576,973 - 74,584,923 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Irgq Rat 1,2-dimethylhydrazine increases expression ISO Irgq (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of IRGQ mRNA CTD PMID:22206623 Irgq Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of IRGQ mRNA CTD PMID:29097150 Irgq Rat 17beta-estradiol increases expression ISO Irgq (Mus musculus) 6480464 Estradiol results in increased expression of IRGQ mRNA CTD PMID:39298647 Irgq Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Irgq (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of IRGQ mRNA CTD PMID:21570461 Irgq Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IRGQ mRNA CTD PMID:33387578 Irgq Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of IRGQ protein CTD PMID:34915118 Irgq Rat 4,4'-sulfonyldiphenol increases expression ISO Irgq (Mus musculus) 6480464 bisphenol S results in increased expression of IRGQ mRNA CTD PMID:39298647 Irgq Rat 4,4'-sulfonyldiphenol affects methylation ISO Irgq (Mus musculus) 6480464 bisphenol S affects the methylation of IRGQ gene CTD PMID:31683443 Irgq Rat 4,4'-sulfonyldiphenol increases methylation ISO Irgq (Mus musculus) 6480464 bisphenol S results in increased methylation of IRGQ exon CTD PMID:33297965 Irgq Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of IRGQ mRNA CTD PMID:24780913 Irgq Rat acrolein multiple interactions ISO IRGQ (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of IRGQ mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of IRGQ mRNA CTD PMID:32699268 Irgq Rat acrylamide decreases expression ISO Irgq (Mus musculus) 6480464 Acrylamide results in decreased expression of IRGQ mRNA CTD PMID:30807115 Irgq Rat actinomycin D multiple interactions ISO IRGQ (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of IRGQ protein CTD PMID:38460933 Irgq Rat aflatoxin B1 increases expression ISO Irgq (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of IRGQ mRNA CTD PMID:19770486 Irgq Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of IRGQ mRNA CTD PMID:33354967 Irgq Rat alpha-pinene multiple interactions ISO IRGQ (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of IRGQ mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of IRGQ mRNA CTD PMID:32699268 Irgq Rat aristolochic acid A increases expression ISO IRGQ (Homo sapiens) 6480464 aristolochic acid I results in increased expression of IRGQ mRNA CTD PMID:33212167 Irgq Rat arsenite(3-) decreases expression ISO Irgq (Mus musculus) 6480464 arsenite results in decreased expression of IRGQ protein CTD PMID:37955338 Irgq Rat benzo[a]pyrene increases expression ISO Irgq (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of IRGQ mRNA CTD PMID:22228805 Irgq Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Irgq (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of IRGQ mRNA CTD PMID:39150890 Irgq Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of IRGQ mRNA CTD PMID:25181051 Irgq Rat bisphenol A increases expression ISO IRGQ (Homo sapiens) 6480464 bisphenol A results in increased expression of IRGQ protein CTD PMID:37567409 Irgq Rat Butylbenzyl phthalate multiple interactions ISO Irgq (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of IRGQ mRNA CTD PMID:39150890 Irgq Rat cadmium dichloride decreases expression ISO IRGQ (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of IRGQ mRNA CTD PMID:38568856 Irgq Rat carbon nanotube increases expression ISO Irgq (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of IRGQ mRNA CTD PMID:25620056 Irgq Rat CGP 52608 multiple interactions ISO IRGQ (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to IRGQ gene] CTD PMID:28238834 Irgq Rat chlorpyrifos increases expression ISO Irgq (Mus musculus) 6480464 Chlorpyrifos results in increased expression of IRGQ mRNA CTD PMID:37019170 Irgq Rat cisplatin multiple interactions ISO IRGQ (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of IRGQ mRNA CTD PMID:27392435 Irgq Rat cisplatin increases expression ISO IRGQ (Homo sapiens) 6480464 Cisplatin results in increased expression of IRGQ mRNA CTD PMID:27392435 Irgq Rat Dibutyl phosphate affects expression ISO IRGQ (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of IRGQ mRNA CTD PMID:37042841 Irgq Rat dibutyl phthalate multiple interactions ISO Irgq (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of IRGQ mRNA CTD PMID:39150890 Irgq Rat dicrotophos increases expression ISO IRGQ (Homo sapiens) 6480464 dicrotophos results in increased expression of IRGQ mRNA CTD PMID:28302478 Irgq Rat diethyl phthalate multiple interactions ISO Irgq (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of IRGQ mRNA CTD PMID:39150890 Irgq Rat diisobutyl phthalate multiple interactions ISO Irgq (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of IRGQ mRNA CTD PMID:39150890 Irgq Rat diisononyl phthalate multiple interactions ISO Irgq (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of IRGQ mRNA CTD PMID:39150890 Irgq Rat dimethylselenide multiple interactions ISO IRGQ (Homo sapiens) 6480464 [[Reactive Oxygen Species results in increased oxidation of dimethylselenide] which results in increased expression of DLGAP1-AS2 mRNA] which results in increased expression of IRGQ mRNA CTD PMID:33656867 Irgq Rat doxorubicin decreases expression ISO IRGQ (Homo sapiens) 6480464 Doxorubicin results in decreased expression of IRGQ mRNA CTD PMID:29803840 Irgq Rat enzyme inhibitor multiple interactions ISO IRGQ (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of IRGQ protein CTD PMID:23301498 Irgq Rat epoxiconazole increases expression ISO Irgq (Mus musculus) 6480464 epoxiconazole results in increased expression of IRGQ mRNA CTD PMID:35436446 Irgq Rat ethanol affects splicing ISO Irgq (Mus musculus) 6480464 Ethanol affects the splicing of IRGQ mRNA CTD PMID:30319688 Irgq Rat folic acid decreases expression ISO Irgq (Mus musculus) 6480464 Folic Acid results in decreased expression of IRGQ mRNA CTD PMID:25629700 Irgq Rat ivermectin decreases expression ISO IRGQ (Homo sapiens) 6480464 Ivermectin results in decreased expression of IRGQ protein CTD PMID:32959892 Irgq Rat lead(0) affects expression ISO IRGQ (Homo sapiens) 6480464 Lead affects the expression of IRGQ mRNA CTD PMID:28903495 Irgq Rat leflunomide decreases expression ISO Irgq (Mus musculus) 6480464 leflunomide results in decreased expression of IRGQ mRNA CTD PMID:19751817 Irgq Rat Nutlin-3 multiple interactions ISO IRGQ (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of IRGQ protein CTD PMID:38460933 Irgq Rat ozone multiple interactions ISO IRGQ (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of IRGQ mRNA more ... CTD PMID:32699268 and PMID:35430440 Irgq Rat ozone multiple interactions ISO Irgq (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of IRGQ mRNA CTD PMID:27106289 Irgq Rat paracetamol affects expression ISO Irgq (Mus musculus) 6480464 Acetaminophen affects the expression of IRGQ mRNA CTD PMID:17562736 Irgq Rat reactive oxygen species multiple interactions ISO IRGQ (Homo sapiens) 6480464 [[Reactive Oxygen Species results in increased oxidation of dimethylselenide] which results in increased expression of DLGAP1-AS2 mRNA] which results in increased expression of IRGQ mRNA CTD PMID:33656867 Irgq Rat SB 431542 multiple interactions ISO IRGQ (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of IRGQ protein CTD PMID:37664457 Irgq Rat sodium arsenite increases expression ISO IRGQ (Homo sapiens) 6480464 sodium arsenite results in increased expression of IRGQ mRNA CTD PMID:38568856 Irgq Rat sunitinib decreases expression ISO IRGQ (Homo sapiens) 6480464 Sunitinib results in decreased expression of IRGQ mRNA CTD PMID:31533062 Irgq Rat titanium dioxide increases methylation ISO Irgq (Mus musculus) 6480464 titanium dioxide results in increased methylation of IRGQ gene CTD PMID:35295148 Irgq Rat titanium dioxide decreases methylation ISO Irgq (Mus musculus) 6480464 titanium dioxide results in decreased methylation of IRGQ gene CTD PMID:35295148 Irgq Rat torcetrapib increases expression ISO IRGQ (Homo sapiens) 6480464 torcetrapib results in increased expression of IRGQ mRNA CTD PMID:23228038 Irgq Rat triphenyl phosphate affects expression ISO IRGQ (Homo sapiens) 6480464 triphenyl phosphate affects the expression of IRGQ mRNA CTD PMID:37042841 Irgq Rat urethane increases expression ISO IRGQ (Homo sapiens) 6480464 Urethane results in increased expression of IRGQ mRNA CTD PMID:28818685 Irgq Rat valproic acid increases expression ISO IRGQ (Homo sapiens) 6480464 Valproic Acid results in increased expression of IRGQ mRNA CTD PMID:23179753 Irgq Rat valproic acid affects expression ISO IRGQ (Homo sapiens) 6480464 Valproic Acid affects the expression of IRGQ mRNA CTD PMID:25979313 Irgq Rat valproic acid increases methylation ISO IRGQ (Homo sapiens) 6480464 Valproic Acid results in increased methylation of IRGQ gene CTD PMID:29154799
Irgq Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 89,251,846 - 89,259,799 (+) NCBI GRCr8 mRatBN7.2 1 80,123,925 - 80,131,881 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,123,925 - 80,131,881 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 85,517,541 - 85,525,491 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,067,378 - 94,075,331 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 87,273,366 - 87,281,317 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 81,395,922 - 81,403,872 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 81,395,841 - 81,399,672 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 82,656,242 - 82,664,190 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 79,816,826 - 79,824,777 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 79,893,608 - 79,902,886 (+) NCBI Celera 1 74,576,973 - 74,584,923 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
IRGQ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 43,584,367 - 43,596,134 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 43,584,367 - 43,596,134 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 44,088,519 - 44,100,286 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 48,787,866 - 48,791,516 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 19 40,890,998 - 40,902,768 (-) NCBI Celera Cytogenetic Map 19 q13.31 NCBI HuRef 19 40,519,278 - 40,531,046 (-) NCBI HuRef CHM1_1 19 44,090,267 - 44,102,035 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 46,406,008 - 46,417,777 (-) NCBI T2T-CHM13v2.0
Irgq Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 24,230,073 - 24,238,025 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 24,230,114 - 24,238,025 (+) Ensembl GRCm39 Ensembl GRCm38 7 24,530,648 - 24,538,600 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 24,530,689 - 24,538,600 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 25,315,667 - 25,323,619 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 24,239,449 - 24,247,360 (+) NCBI MGSCv36 mm8 Celera 7 19,144,746 - 19,152,698 (+) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 11.32 NCBI
Irgq Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955555 1,329,812 - 1,334,317 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955555 1,328,187 - 1,335,018 (-) NCBI ChiLan1.0 ChiLan1.0
IRGQ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 49,744,895 - 49,755,300 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 51,613,857 - 51,624,292 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 40,533,711 - 40,538,157 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 49,141,775 - 49,146,061 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 49,141,775 - 49,146,061 (-) Ensembl panpan1.1 panPan2
IRGQ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 111,532,975 - 111,540,585 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 111,532,317 - 111,537,042 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 111,012,412 - 111,020,311 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 112,142,811 - 112,150,712 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 112,143,862 - 112,149,648 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 111,730,931 - 111,738,826 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 111,364,761 - 111,372,662 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 112,249,011 - 112,256,913 (+) NCBI UU_Cfam_GSD_1.0
Irgq
IRGQ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 50,433,862 - 50,445,575 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 50,433,858 - 50,442,106 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 46,188,729 - 46,206,689 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IRGQ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 37,111,782 - 37,116,258 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 37,112,015 - 37,115,322 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 16,654,203 - 16,658,672 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Irgq
.
Predicted Target Of
Count of predictions: 861 Count of miRNA genes: 320 Interacting mature miRNAs: 440 Transcripts: ENSRNOT00000072750 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
RH138812
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 80,128,968 - 80,129,100 (+) MAPPER mRatBN7.2 Rnor_6.0 1 81,400,960 - 81,401,091 NCBI Rnor6.0 Rnor_5.0 1 82,661,278 - 82,661,409 UniSTS Rnor5.0 RGSC_v3.4 1 79,821,865 - 79,821,996 UniSTS RGSC3.4 Celera 1 74,582,014 - 74,582,145 UniSTS RH 3.4 Map 1 822.1 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000072750 ⟹ ENSRNOP00000064929
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 81,395,841 - 81,399,386 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081829 ⟹ ENSRNOP00000071992
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 81,396,558 - 81,399,672 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119508 ⟹ ENSRNOP00000082584
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 80,123,925 - 80,131,881 (+) Ensembl
RefSeq Acc Id:
NM_001135742 ⟹ NP_001129214
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 89,251,846 - 89,259,799 (+) NCBI mRatBN7.2 1 80,123,925 - 80,131,881 (+) NCBI Rnor_6.0 1 81,395,922 - 81,403,872 (+) NCBI Rnor_5.0 1 82,656,242 - 82,664,190 (+) NCBI RGSC_v3.4 1 79,816,826 - 79,824,777 (+) RGD Celera 1 74,576,973 - 74,584,923 (+) NCBI
Sequence:
CTCCAAGACACACCCGGTCGTGGAAGGAATGACGTCAGGATAGAGCCACCTGAAGGAGTCCGGATGTCTCTAAATCCGGACACCCCTTCCCCTTCAGCCGCTGTCATTTCGTCTTAAGGGGCCGGGCC
hide sequence
RefSeq Acc Id:
XM_006228410 ⟹ XP_006228472
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 89,252,018 - 89,259,799 (+) NCBI mRatBN7.2 1 80,124,093 - 80,131,881 (+) NCBI Rnor_6.0 1 81,396,090 - 81,403,872 (+) NCBI Rnor_5.0 1 82,656,242 - 82,664,190 (+) NCBI
Sequence:
GATTTGGAACGGGGAGGGGAAAGACCATCCTCGAGTTCCCGAGTGATTGGCAGTCAGGTTTCTGAGGGTTTTTGGGTTTTGTTTTGTTTTCTTTTTTTTTAAATAGAGAAATGCATTCGTGTGGAGAA
hide sequence
RefSeq Acc Id:
NP_001129214 ⟸ NM_001135742
- UniProtKB:
A0A8I5ZUT2 (UniProtKB/TrEMBL)
- Sequence:
MPLPQGDVTALFLGPPGSGKSALIAALCGKNVDAVEIPDGRPDSGVPSLRAAAPGLFLGELSCPPAAPGPWAAEANLLVLVLPGSEGSEEPLTPALGEAARAALARGTPLLAVRNLRPGDSQNAAQAR
hide sequence
RefSeq Acc Id:
XP_006228472 ⟸ XM_006228410
- Peptide Label:
isoform X1
- Sequence:
MSFPASCFPAMPLPQGDVTALFLGPPGSGKSALIAALCGKNVDAVEIPDGRPDSGVPSLRAAAPGLFLGELSCPPAAPGPWAAEANLLVLVLPGSEGSEEPLTPALGEAARAALARGTPLLAVRNLRP
hide sequence
Ensembl Acc Id:
ENSRNOP00000064929 ⟸ ENSRNOT00000072750
Ensembl Acc Id:
ENSRNOP00000071992 ⟸ ENSRNOT00000081829
Ensembl Acc Id:
ENSRNOP00000082584 ⟸ ENSRNOT00000119508
RGD ID: 13689806 Promoter ID: EPDNEW_R322 Type: initiation region Name: Irgq_1 Description: immunity-related GTPase Q SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 81,395,858 - 81,395,918 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-04
Irgq
immunity-related GTPase Q
Irgq
immunity-related GTPase family, Q
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Irgq
immunity-related GTPase family, Q
Irgq_predicted
immunity-related GTPase family, Q (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Irgq_predicted
immunity-related GTPase family, Q (predicted)
RGD1309409_predicted
similar to FKSG27 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1309409_predicted
similar to FKSG27 (predicted)
LOC292708_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC292708_predicted
similar to FKSG27 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
