Symbol:
Nudt8
Name:
nudix hydrolase 8
RGD ID:
1309040
Description:
Predicted to enable coenzyme A diphosphatase activity; magnesium ion binding activity; and manganese ion binding activity. Predicted to be involved in nucleoside phosphate catabolic process. Predicted to be located in mitochondrion. Orthologous to human NUDT8 (nudix hydrolase 8); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; aconitine; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC361692; mitochondrial coenzyme A diphosphatase NUDT8; nucleoside diphosphate-linked moiety X motif 8; nucleoside diphosphate-linked moiety X motif 8, mitochondrial; nudix (nucleoside diphosphate linked moiety X)-type motif 8
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NUDT8 (nudix hydrolase 8) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nudt8 (nudix hydrolase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nudt8 (nudix hydrolase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NUDT8 (nudix hydrolase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NUDT8 (nudix hydrolase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nudt8 (nudix hydrolase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NUDT8 (nudix hydrolase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nudt8 (nudix hydrolase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NUDT8 (nudix hydrolase 8)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nudt8 (nudix hydrolase 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nudt8 (nudix (nucleoside diphosphate linked moiety X)-type motif 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG11095
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ndx-3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 210,723,209 - 210,724,717 (+) NCBI GRCr8 mRatBN7.2 1 201,293,660 - 201,295,233 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 201,292,619 - 201,295,224 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 209,646,028 - 209,647,536 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 216,739,198 - 216,740,706 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 209,430,223 - 209,431,731 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 219,247,428 - 219,249,155 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 219,247,672 - 219,249,207 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 226,118,079 - 226,119,806 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 206,583,181 - 206,584,885 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 206,732,510 - 206,738,336 (+) NCBI Celera 1 198,838,563 - 198,840,290 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nudt8 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1319159 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NUDT8 mRNA CTD PMID:17942748 Nudt8 Rat 17beta-estradiol increases expression ISO RGD:1319159 6480464 Estradiol results in increased expression of NUDT8 mRNA CTD PMID:39298647 Nudt8 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1319159 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NUDT8 mRNA CTD PMID:17942748 Nudt8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NUDT8 mRNA CTD PMID:33387578 Nudt8 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NUDT8 mRNA CTD PMID:32109520 Nudt8 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1319159 6480464 4,4'-diaminodiphenylmethane results in decreased expression of NUDT8 mRNA CTD PMID:18648102 Nudt8 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1319158 6480464 bisphenol S results in increased expression of NUDT8 mRNA CTD PMID:27685785 Nudt8 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1319159 6480464 bisphenol S results in increased expression of NUDT8 mRNA CTD PMID:39298647 Nudt8 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of NUDT8 protein CTD PMID:33236894 Nudt8 Rat aldehydo-D-glucose multiple interactions ISO RGD:1319159 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 Nudt8 Rat all-trans-retinoic acid decreases expression ISO RGD:1319158 6480464 Tretinoin results in decreased expression of NUDT8 mRNA CTD PMID:33167477 Nudt8 Rat Aroclor 1254 increases expression ISO RGD:1319159 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of NUDT8 mRNA CTD PMID:23650126 Nudt8 Rat atrazine increases expression ISO RGD:1319158 6480464 Atrazine results in increased expression of NUDT8 mRNA CTD PMID:22378314 Nudt8 Rat benzo[a]pyrene decreases expression ISO RGD:1319159 6480464 Benzo(a)pyrene results in decreased expression of NUDT8 mRNA CTD PMID:22228805 Nudt8 Rat benzo[a]pyrene increases methylation ISO RGD:1319158 6480464 Benzo(a)pyrene results in increased methylation of NUDT8 promoter CTD PMID:27901495 Nudt8 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NUDT8 mRNA CTD PMID:30816183 Nudt8 Rat bisphenol A increases expression ISO RGD:1319159 6480464 bisphenol A results in increased expression of NUDT8 mRNA CTD PMID:38074096 Nudt8 Rat carbon nanotube increases expression ISO RGD:1319159 6480464 Nanotubes, Carbon results in increased expression of NUDT8 mRNA CTD PMID:25554681 Nudt8 Rat chromium(6+) multiple interactions ISO RGD:1319158 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 Nudt8 Rat cisplatin multiple interactions ISO RGD:1319158 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of NUDT8 mRNA CTD PMID:27392435 Nudt8 Rat cisplatin increases expression ISO RGD:1319158 6480464 Cisplatin results in increased expression of NUDT8 mRNA CTD PMID:27392435|PMID:27594783 Nudt8 Rat copper(II) sulfate decreases expression ISO RGD:1319158 6480464 Copper Sulfate results in decreased expression of NUDT8 mRNA CTD PMID:19549813 Nudt8 Rat D-glucose multiple interactions ISO RGD:1319159 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 Nudt8 Rat DDE increases expression ISO RGD:1319158 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of NUDT8 mRNA CTD PMID:38568856 Nudt8 Rat Dibutyl phosphate affects expression ISO RGD:1319158 6480464 di-n-butylphosphoric acid affects the expression of NUDT8 mRNA CTD PMID:37042841 Nudt8 Rat fenthion increases expression ISO RGD:1319159 6480464 Fenthion results in increased expression of NUDT8 mRNA CTD PMID:34813904 Nudt8 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of NUDT8 mRNA CTD PMID:23962444 Nudt8 Rat folic acid decreases expression ISO RGD:1319159 6480464 Folic Acid results in decreased expression of NUDT8 mRNA CTD PMID:25629700 Nudt8 Rat fructose multiple interactions ISO RGD:1319159 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 Nudt8 Rat glucose multiple interactions ISO RGD:1319159 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 Nudt8 Rat GSK-J4 decreases expression ISO RGD:1319158 6480464 GSK-J4 results in decreased expression of NUDT8 mRNA CTD PMID:29301935 Nudt8 Rat Monobutylphthalate increases expression ISO RGD:1319159 6480464 monobutyl phthalate results in increased expression of NUDT8 mRNA CTD PMID:35278568 Nudt8 Rat ozone multiple interactions ISO RGD:1319159 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Nudt8 Rat paracetamol affects expression ISO RGD:1319159 6480464 Acetaminophen affects the expression of NUDT8 mRNA CTD PMID:17562736 Nudt8 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NUDT8 mRNA CTD PMID:33387578 Nudt8 Rat paracetamol decreases expression ISO RGD:1319158 6480464 Acetaminophen results in decreased expression of NUDT8 mRNA CTD PMID:22230336 Nudt8 Rat sodium arsenite multiple interactions ISO RGD:1319158 6480464 sodium arsenite results in decreased expression of and affects the splicing of NUDT8 mRNA CTD PMID:25879800 Nudt8 Rat sodium arsenite increases expression ISO RGD:1319158 6480464 sodium arsenite results in increased expression of NUDT8 mRNA CTD PMID:34032870 Nudt8 Rat sodium arsenite decreases expression ISO RGD:1319158 6480464 sodium arsenite results in decreased expression of NUDT8 mRNA CTD PMID:38568856 Nudt8 Rat sulforaphane increases expression ISO RGD:1319159 6480464 sulforaphane results in increased expression of NUDT8 mRNA CTD PMID:30529165 Nudt8 Rat sunitinib decreases expression ISO RGD:1319158 6480464 Sunitinib results in decreased expression of NUDT8 mRNA CTD PMID:31533062 Nudt8 Rat testosterone decreases expression ISO RGD:1319159 6480464 Testosterone deficiency results in decreased expression of NUDT8 mRNA CTD PMID:33848595 Nudt8 Rat tetrachloroethene decreases expression ISO RGD:1319159 6480464 Tetrachloroethylene results in decreased expression of NUDT8 mRNA CTD PMID:28973375 Nudt8 Rat thapsigargin decreases expression ISO RGD:1319158 6480464 Thapsigargin results in decreased expression of NUDT8 mRNA CTD PMID:22378314 Nudt8 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NUDT8 mRNA CTD PMID:34492290 Nudt8 Rat thiram decreases expression ISO RGD:1319158 6480464 Thiram results in decreased expression of NUDT8 mRNA CTD PMID:38568856 Nudt8 Rat titanium dioxide increases expression ISO RGD:1319159 6480464 titanium dioxide results in increased expression of NUDT8 mRNA CTD PMID:27760801 Nudt8 Rat titanium dioxide decreases methylation ISO RGD:1319159 6480464 titanium dioxide results in decreased methylation of NUDT8 promoter CTD PMID:35295148 Nudt8 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of NUDT8 mRNA CTD PMID:33387578 Nudt8 Rat tris(2-butoxyethyl) phosphate affects expression ISO RGD:1319158 6480464 tris(2-butoxyethyl) phosphate affects the expression of NUDT8 mRNA CTD PMID:29024780 Nudt8 Rat tunicamycin decreases expression ISO RGD:1319158 6480464 Tunicamycin results in decreased expression of NUDT8 mRNA CTD PMID:22378314 Nudt8 Rat urethane decreases expression ISO RGD:1319158 6480464 Urethane results in decreased expression of NUDT8 mRNA CTD PMID:28818685
Nudt8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 210,723,209 - 210,724,717 (+) NCBI GRCr8 mRatBN7.2 1 201,293,660 - 201,295,233 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 201,292,619 - 201,295,224 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 209,646,028 - 209,647,536 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 216,739,198 - 216,740,706 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 209,430,223 - 209,431,731 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 219,247,428 - 219,249,155 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 219,247,672 - 219,249,207 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 226,118,079 - 226,119,806 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 206,583,181 - 206,584,885 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 206,732,510 - 206,738,336 (+) NCBI Celera 1 198,838,563 - 198,840,290 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
NUDT8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 67,627,938 - 67,629,937 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 67,627,938 - 67,629,937 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 67,395,409 - 67,397,408 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 67,151,985 - 67,153,977 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 67,151,985 - 67,153,977 NCBI Celera 11 64,729,875 - 64,731,853 (-) NCBI Celera Cytogenetic Map 11 q13.2 NCBI HuRef 11 63,724,676 - 63,726,675 (-) NCBI HuRef CHM1_1 11 67,278,457 - 67,280,456 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 67,622,625 - 67,624,624 (-) NCBI T2T-CHM13v2.0
Nudt8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 4,050,580 - 4,052,102 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 4,050,580 - 4,052,103 (+) Ensembl GRCm39 Ensembl GRCm38 19 4,000,580 - 4,002,102 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 4,000,626 - 4,005,816 (+) Ensembl GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 4,000,580 - 4,002,103 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 4,000,580 - 4,002,102 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 4,000,580 - 4,002,102 (+) NCBI MGSCv36 mm8 Celera 19 3,871,676 - 3,873,198 (+) NCBI Celera Cytogenetic Map 19 A NCBI
Nudt8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955422 17,867,395 - 17,876,272 (+) NCBI ChiLan1.0 ChiLan1.0
NUDT8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 68,857,163 - 68,859,829 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 69,899,826 - 69,902,490 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 62,988,580 - 62,990,780 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 66,299,863 - 66,301,889 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 66,299,863 - 66,301,893 (-) Ensembl panpan1.1 panPan2
NUDT8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 49,874,630 - 49,876,703 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 48,484,050 - 48,486,026 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 50,795,833 - 50,797,809 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 50,795,848 - 50,797,729 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 50,009,005 - 50,010,966 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 49,583,979 - 49,585,940 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 50,377,697 - 50,379,673 (+) NCBI UU_Cfam_GSD_1.0
Nudt8
NUDT8
Nudt8
.
Predicted Target Of
Count of predictions: 104 Count of miRNA genes: 91 Interacting mature miRNAs: 93 Transcripts: ENSRNOT00000024237 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 2314011 Gluco56 Glucose level QTL 56 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 199773958 202166723 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat
RH143449
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 201,293,552 - 201,293,680 (+) MAPPER mRatBN7.2 Rnor_6.0 1 219,247,476 - 219,247,603 NCBI Rnor6.0 Rnor_5.0 1 226,118,127 - 226,118,254 UniSTS Rnor5.0 RGSC_v3.4 1 206,583,206 - 206,583,333 UniSTS RGSC3.4 Celera 1 198,838,611 - 198,838,738 UniSTS RH 3.4 Map 1 1559.3 UniSTS Cytogenetic Map 1 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024237 ⟹ ENSRNOP00000024237
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 201,292,619 - 201,295,224 (+) Ensembl Rnor_6.0 Ensembl 1 219,247,672 - 219,249,207 (+) Ensembl
RefSeq Acc Id:
NM_001400850 ⟹ NP_001387779
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 210,723,209 - 210,724,717 (+) NCBI mRatBN7.2 1 201,293,723 - 201,295,231 (+) NCBI
RefSeq Acc Id:
XM_008760189 ⟹ XP_008758411
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 210,723,214 - 210,724,717 (+) NCBI mRatBN7.2 1 201,293,660 - 201,295,233 (+) NCBI Rnor_6.0 1 219,247,428 - 219,249,154 (+) NCBI
Sequence:
CTGCCTCAGCAGGCCTGGTCTGGAACTCCTCCAAGATCCCACTCCAGCAGGCACTGTCTCGTCCATCTCGGAGGCTCCACCTCTGCAGGCACTGTACCGCCGGACTCTAAGGCTTTGCAAGGGCAGTC
hide sequence
RefSeq Acc Id:
XM_063268129 ⟹ XP_063124199
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 210,723,214 - 210,724,717 (+) NCBI
RefSeq Acc Id:
XP_008758411 ⟸ XM_008760189
- Peptide Label:
isoform X2
- UniProtKB:
D3ZEH6 (UniProtKB/TrEMBL)
- Sequence:
MLPDCLSAEDEQRCRQLLARTTAGLRSRPAAAAVLVPLCLVRGVPALLYTLRSSRLVGRHKGEVSFPGGKCDPGDQDVIHTALRETQEELGLEVSKEHVWGVLQPVYDRVSHPHPVTPSTPGDRRKAT
hide sequence
Ensembl Acc Id:
ENSRNOP00000024237 ⟸ ENSRNOT00000024237
RefSeq Acc Id:
NP_001387779 ⟸ NM_001400850
- UniProtKB:
A6HYQ7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124199 ⟸ XM_063268129
- Peptide Label:
isoform X1
RGD ID: 13690617 Promoter ID: EPDNEW_R1131 Type: multiple initiation site Name: Nudt8_1 Description: nudix hydrolase 8 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 219,247,679 - 219,247,739 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-10
Nudt8
nudix hydrolase 8
Nudt8
nudix (nucleoside diphosphate linked moiety X)-type motif 8
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-05-24
Nudt8
nudix (nucleoside diphosphate linked moiety X)-type motif 8
LOC683919
similar to nudix-type motif 8
Data merged from RGD:1596574
1643240 APPROVED
2008-04-30
Nudt8
nudix (nucleoside diphosphate linked moiety X)-type motif 8
Nudt8_predicted
nudix (nucleoside diphosphate linked moiety X)-type motif 8 (predicted)
'predicted' is removed
2292626 APPROVED
2006-11-20
LOC683919
similar to nudix-type motif 8
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Nudt8_predicted
nudix (nucleoside diphosphate linked moiety X)-type motif 8 (predicted)
Symbol and Name status set to approved
70820 APPROVED
