Symbol:
Chst8
Name:
carbohydrate sulfotransferase 8
RGD ID:
1308979
Description:
Predicted to enable dermatan 4-sulfotransferase activity. Predicted to be involved in hormone biosynthetic process and sulfur compound metabolic process. Predicted to act upstream of or within proteoglycan biosynthetic process. Orthologous to human CHST8 (carbohydrate sulfotransferase 8); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; all-trans-retinoic acid.
Type:
protein-coding (Ensembl: pseudogene)
RefSeq Status:
PROVISIONAL
Previously known as:
carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8; LOC308511
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CHST8 (carbohydrate sulfotransferase 8) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Chst8 (carbohydrate sulfotransferase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Chst8 (carbohydrate sulfotransferase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CHST8 (carbohydrate sulfotransferase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CHST8 (carbohydrate sulfotransferase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Chst8 (carbohydrate sulfotransferase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CHST8 (carbohydrate sulfotransferase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CHST8 (carbohydrate sulfotransferase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Chst8 (carbohydrate sulfotransferase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CHST8 (carbohydrate sulfotransferase 8)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Chst8 (carbohydrate sulfotransferase 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:ch211-269c21.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG13937
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Drosophila melanogaster (fruit fly):
CG31743
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Xenopus tropicalis (tropical clawed frog):
chst8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 96,431,144 - 96,572,880 (-) NCBI GRCr8 mRatBN7.2 1 87,294,144 - 87,435,900 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 87,294,540 - 87,435,900 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 92,697,574 - 92,839,129 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 101,163,551 - 101,305,117 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 94,455,862 - 94,597,430 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 90,542,095 - 90,685,257 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 90,542,096 - 90,685,257 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 91,681,356 - 91,822,788 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 87,152,490 - 87,311,536 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 87,230,992 - 87,232,087 (-) NCBI Celera 1 81,658,173 - 81,797,008 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Chst8 Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane increases expression ISO RGD:1319068 6480464 2,2-bis(4-hydroxyphenyl)-1,1,1-trichloroethane results in increased expression of CHST8 mRNA CTD PMID:25575267 Chst8 Rat 17beta-estradiol multiple interactions ISO RGD:1319067 6480464 Estradiol promotes the reaction [ESR2 protein affects the expression of CHST8 mRNA] CTD PMID:20404318 Chst8 Rat 17beta-estradiol increases expression ISO RGD:1319067 6480464 Estradiol results in increased expression of CHST8 mRNA CTD PMID:31614463 Chst8 Rat 17beta-estradiol increases expression ISO RGD:1319068 6480464 Estradiol results in increased expression of CHST8 mRNA CTD PMID:25575267 Chst8 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1319068 6480464 Tetrachlorodibenzodioxin affects the expression of CHST8 mRNA CTD PMID:21570461 Chst8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CHST8 mRNA CTD PMID:33387578 Chst8 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1319068 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of CHST8 mRNA CTD PMID:20188158 Chst8 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1319068 6480464 bisphenol S results in decreased expression of CHST8 mRNA CTD PMID:30951980 Chst8 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CHST8 mRNA CTD PMID:24780913 Chst8 Rat aflatoxin B1 decreases expression ISO RGD:1319067 6480464 Aflatoxin B1 results in decreased expression of CHST8 mRNA CTD PMID:22100608 Chst8 Rat aflatoxin B1 increases methylation ISO RGD:1319067 6480464 Aflatoxin B1 results in increased methylation of CHST8 intron CTD PMID:30157460 Chst8 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CHST8 mRNA CTD PMID:20488242 Chst8 Rat all-trans-retinoic acid multiple interactions ISO RGD:1319068 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CHST8 mRNA CTD PMID:36189433 Chst8 Rat all-trans-retinoic acid decreases expression ISO RGD:1319068 6480464 Tretinoin results in decreased expression of CHST8 mRNA CTD PMID:36189433 Chst8 Rat all-trans-retinoic acid increases expression ISO RGD:1319067 6480464 Tretinoin results in increased expression of CHST8 mRNA CTD PMID:23724009 Chst8 Rat arsenite(3-) increases methylation ISO RGD:1319067 6480464 arsenite results in increased methylation of CHST8 promoter CTD PMID:23974009 Chst8 Rat benzo[a]pyrene increases methylation ISO RGD:1319068 6480464 Benzo(a)pyrene results in increased methylation of CHST8 intron CTD PMID:27901495 Chst8 Rat benzo[a]pyrene increases methylation ISO RGD:1319067 6480464 Benzo(a)pyrene results in increased methylation of CHST8 exon CTD PMID:27901495 Chst8 Rat benzo[a]pyrene affects methylation ISO RGD:1319067 6480464 Benzo(a)pyrene affects the methylation of CHST8 3' UTR; Benzo(a)pyrene affects the methylation of CHST8 5' more ... CTD PMID:27901495|PMID:30157460 Chst8 Rat benzo[e]pyrene increases methylation ISO RGD:1319067 6480464 benzo(e)pyrene results in increased methylation of CHST8 intron CTD PMID:30157460 Chst8 Rat Benzo[ghi]perylene increases expression ISO RGD:1319068 6480464 1,12-benzoperylene results in increased expression of CHST8 mRNA CTD PMID:26377693 Chst8 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1319068 6480464 [Streptozocin co-treated with Dietary Fats co-treated with Diethylhexyl Phthalate] results in decreased expression of CHST8 more ... CTD PMID:33484791 Chst8 Rat bisphenol A increases expression ISO RGD:1319068 6480464 bisphenol A results in increased expression of CHST8 mRNA CTD PMID:25575267 Chst8 Rat bisphenol A increases methylation ISO RGD:1319067 6480464 bisphenol A results in increased methylation of CHST8 gene CTD PMID:31601247 Chst8 Rat bisphenol A multiple interactions ISO RGD:1319067 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CHST8 gene CTD PMID:31601247 Chst8 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CHST8 gene CTD PMID:28505145 Chst8 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CHST8 mRNA CTD PMID:25181051 Chst8 Rat bisphenol F decreases expression ISO RGD:1319068 6480464 bisphenol F results in decreased expression of CHST8 mRNA CTD PMID:30951980 Chst8 Rat buta-1,3-diene decreases expression ISO RGD:1319068 6480464 1,3-butadiene results in decreased expression of CHST8 mRNA CTD PMID:29038090 Chst8 Rat butanal increases expression ISO RGD:1319067 6480464 butyraldehyde results in increased expression of CHST8 mRNA CTD PMID:26079696 Chst8 Rat cadmium atom increases expression ISO RGD:1319067 6480464 Cadmium results in increased expression of CHST8 mRNA CTD PMID:24376830 Chst8 Rat carbamazepine affects expression ISO RGD:1319067 6480464 Carbamazepine affects the expression of CHST8 mRNA CTD PMID:25979313 Chst8 Rat carbon nanotube affects expression ISO RGD:1319068 6480464 Nanotubes, Carbon affects the expression of CHST8 mRNA CTD PMID:25554681 Chst8 Rat carbon nanotube decreases expression ISO RGD:1319068 6480464 Nanotubes, Carbon analog results in decreased expression of CHST8 mRNA CTD PMID:25554681 Chst8 Rat choline multiple interactions ISO RGD:1319068 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Chst8 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of CHST8 mRNA CTD PMID:26033743 Chst8 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of CHST8 mRNA CTD PMID:30556269 Chst8 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of CHST8 mRNA CTD PMID:26033743 Chst8 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of CHST8 mRNA CTD PMID:30556269 Chst8 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of CHST8 mRNA CTD PMID:26577399 Chst8 Rat diethylstilbestrol increases expression ISO RGD:1319068 6480464 Diethylstilbestrol results in increased expression of CHST8 mRNA CTD PMID:25575267 Chst8 Rat epoxiconazole increases expression ISO RGD:1319068 6480464 epoxiconazole results in increased expression of CHST8 mRNA CTD PMID:35436446 Chst8 Rat estriol increases expression ISO RGD:1319068 6480464 Estriol results in increased expression of CHST8 mRNA CTD PMID:25575267 Chst8 Rat fenofibrate multiple interactions EXP 6480464 [Fenofibrate co-treated with Diethylnitrosamine] results in increased expression of CHST8 mRNA CTD PMID:18253720 Chst8 Rat folic acid multiple interactions ISO RGD:1319068 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Chst8 Rat fulvestrant multiple interactions ISO RGD:1319067 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CHST8 gene CTD PMID:31601247 Chst8 Rat furan increases methylation EXP 6480464 furan results in increased methylation of CHST8 gene CTD PMID:22079235 Chst8 Rat gallic acid decreases expression ISO RGD:1319067 6480464 Gallic Acid results in decreased expression of CHST8 mRNA CTD PMID:34408198 Chst8 Rat iron dichloride decreases expression ISO RGD:1319067 6480464 ferrous chloride results in decreased expression of CHST8 mRNA CTD PMID:35984750 Chst8 Rat L-methionine multiple interactions ISO RGD:1319068 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Chst8 Rat lead(0) affects expression ISO RGD:1319067 6480464 Lead affects the expression of CHST8 mRNA CTD PMID:28903495 Chst8 Rat methapyrilene increases methylation ISO RGD:1319067 6480464 Methapyrilene results in increased methylation of CHST8 intron CTD PMID:30157460 Chst8 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of CHST8 gene CTD PMID:35440735 Chst8 Rat methylmercury chloride increases expression ISO RGD:1319067 6480464 methylmercuric chloride results in increased expression of CHST8 mRNA CTD PMID:28001369 Chst8 Rat methylphenidate decreases expression ISO RGD:1319068 6480464 Methylphenidate results in decreased expression of CHST8 mRNA CTD PMID:22470460 Chst8 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1319068 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CHST8 mRNA CTD PMID:36189433 Chst8 Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:1319067 6480464 1-Methyl-4-phenylpyridinium results in increased expression of CHST8 mRNA CTD PMID:24810058 Chst8 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Fenofibrate co-treated with Diethylnitrosamine] results in increased expression of CHST8 mRNA CTD PMID:18253720 Chst8 Rat niclosamide increases expression ISO RGD:1319067 6480464 Niclosamide results in increased expression of CHST8 mRNA CTD PMID:36318118 Chst8 Rat okadaic acid increases expression ISO RGD:1319067 6480464 Okadaic Acid results in increased expression of CHST8 mRNA CTD PMID:38832940 Chst8 Rat ozone decreases expression ISO RGD:1319068 6480464 Ozone results in decreased expression of CHST8 mRNA CTD PMID:33026818 Chst8 Rat paracetamol decreases expression ISO RGD:1319067 6480464 Acetaminophen results in decreased expression of CHST8 mRNA CTD PMID:22230336 Chst8 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CHST8 mRNA CTD PMID:33387578 Chst8 Rat paracetamol increases expression ISO RGD:1319067 6480464 Acetaminophen results in increased expression of CHST8 mRNA CTD PMID:29067470 Chst8 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CHST8 mRNA CTD PMID:19013527 Chst8 Rat rotenone increases expression ISO RGD:1319067 6480464 Rotenone results in increased expression of CHST8 mRNA CTD PMID:29955902 Chst8 Rat sodium arsenite affects methylation ISO RGD:1319067 6480464 sodium arsenite affects the methylation of CHST8 gene CTD PMID:28589171 Chst8 Rat streptozocin multiple interactions ISO RGD:1319068 6480464 [Streptozocin co-treated with Dietary Fats co-treated with Diethylhexyl Phthalate] results in decreased expression of CHST8 more ... CTD PMID:33484791 Chst8 Rat tamoxifen increases expression ISO RGD:1319068 6480464 Tamoxifen results in increased expression of CHST8 mRNA CTD PMID:25123088 Chst8 Rat tetraphene increases expression ISO RGD:1319068 6480464 benz(a)anthracene results in increased expression of CHST8 mRNA CTD PMID:26377693 Chst8 Rat titanium dioxide decreases expression ISO RGD:1319068 6480464 titanium dioxide results in decreased expression of CHST8 mRNA CTD PMID:23557971 Chst8 Rat titanium dioxide decreases methylation ISO RGD:1319068 6480464 titanium dioxide results in decreased methylation of CHST8 gene CTD PMID:35295148 Chst8 Rat triptonide increases expression ISO RGD:1319068 6480464 triptonide results in increased expression of CHST8 mRNA CTD PMID:33045310 Chst8 Rat urethane affects expression ISO RGD:1319067 6480464 Urethane affects the expression of CHST8 mRNA CTD PMID:28818685 Chst8 Rat valproic acid increases methylation ISO RGD:1319067 6480464 Valproic Acid results in increased methylation of CHST8 gene CTD PMID:29154799 Chst8 Rat valproic acid increases expression ISO RGD:1319067 6480464 Valproic Acid results in increased expression of CHST8 mRNA CTD PMID:23179753|PMID:28001369 Chst8 Rat valproic acid affects expression ISO RGD:1319067 6480464 Valproic Acid affects the expression of CHST8 mRNA CTD PMID:25979313
1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) butanal (ISO) cadmium atom (ISO) carbamazepine (ISO) carbon nanotube (ISO) choline (ISO) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) diethylstilbestrol (ISO) epoxiconazole (ISO) estriol (ISO) fenofibrate (EXP) folic acid (ISO) fulvestrant (ISO) furan (EXP) gallic acid (ISO) iron dichloride (ISO) L-methionine (ISO) lead(0) (ISO) methapyrilene (ISO) methoxychlor (EXP) methylmercury chloride (ISO) methylphenidate (ISO) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) niclosamide (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) rotenone (EXP,ISO) sodium arsenite (ISO) streptozocin (ISO) tamoxifen (ISO) tetraphene (ISO) titanium dioxide (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO)
Chst8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 96,431,144 - 96,572,880 (-) NCBI GRCr8 mRatBN7.2 1 87,294,144 - 87,435,900 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 87,294,540 - 87,435,900 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 92,697,574 - 92,839,129 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 101,163,551 - 101,305,117 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 94,455,862 - 94,597,430 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 90,542,095 - 90,685,257 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 90,542,096 - 90,685,257 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 91,681,356 - 91,822,788 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 87,152,490 - 87,311,536 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 87,230,992 - 87,232,087 (-) NCBI Celera 1 81,658,173 - 81,797,008 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
CHST8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 33,621,953 - 33,773,509 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 33,621,953 - 33,773,509 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 34,112,859 - 34,264,414 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 38,867,274 - 38,956,254 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 38,867,273 - 38,956,253 NCBI Celera 19 30,806,474 - 30,958,041 (+) NCBI Celera Cytogenetic Map 19 q13.11 NCBI HuRef 19 30,612,378 - 30,763,394 (+) NCBI HuRef CHM1_1 19 34,114,228 - 34,265,711 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 36,142,649 - 36,294,279 (+) NCBI T2T-CHM13v2.0
Chst8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 34,373,893 - 34,512,136 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 34,373,893 - 34,512,136 (-) Ensembl GRCm39 Ensembl GRCm38 7 34,674,468 - 34,812,711 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 34,674,468 - 34,812,711 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 35,459,487 - 35,597,730 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 34,383,519 - 34,521,436 (-) NCBI MGSCv36 mm8 Celera 7 29,810,004 - 29,947,409 (-) NCBI Celera Cytogenetic Map 7 B2 NCBI cM Map 7 20.53 NCBI
Chst8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 3,356,679 - 3,488,222 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 3,357,368 - 3,486,195 (+) NCBI ChiLan1.0 ChiLan1.0
CHST8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 39,599,185 - 39,754,876 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 41,599,194 - 41,754,989 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 30,549,667 - 30,705,452 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 39,338,488 - 39,445,592 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 39,354,974 - 39,445,592 (+) Ensembl panpan1.1 panPan2
CHST8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 118,458,636 - 118,551,610 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 118,458,625 - 118,524,104 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 117,861,417 - 117,990,971 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 119,058,922 - 119,188,616 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 119,058,911 - 119,183,878 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 118,619,785 - 118,749,190 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 118,245,888 - 118,375,705 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 119,304,573 - 119,434,387 (-) NCBI UU_Cfam_GSD_1.0
Chst8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 9,403,690 - 9,520,771 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936570 2,125,097 - 2,242,218 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936570 2,125,111 - 2,242,172 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CHST8
CHST8 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 28,657,639 - 28,808,906 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 28,722,901 - 28,808,904 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 6,389,650 - 6,556,430 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Chst8
.
Predicted Target Of
Count of predictions: 86 Count of miRNA genes: 75 Interacting mature miRNAs: 82 Transcripts: ENSRNOT00000037700 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
RH132736
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 87,294,155 - 87,294,341 (+) MAPPER mRatBN7.2 Rnor_6.0 1 90,542,107 - 90,542,292 NCBI Rnor6.0 Rnor_5.0 1 91,681,368 - 91,681,553 UniSTS Rnor5.0 RGSC_v3.4 1 87,152,502 - 87,152,687 UniSTS RGSC3.4 Celera 1 81,658,185 - 81,658,370 UniSTS RH 3.4 Map 1 860.0 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
4
34
113
55
51
23
25
23
6
159
79
93
45
60
28
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000037700 ⟹ ENSRNOP00000030833
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 90,542,096 - 90,685,257 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110239
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 87,294,540 - 87,435,900 (-) Ensembl
RefSeq Acc Id:
NM_001107504 ⟹ NP_001100974
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 96,431,144 - 96,572,880 (-) NCBI mRatBN7.2 1 87,294,144 - 87,435,900 (-) NCBI Rnor_6.0 1 90,542,095 - 90,685,257 (-) NCBI Rnor_5.0 1 91,681,356 - 91,822,788 (-) NCBI RGSC_v3.4 1 87,152,490 - 87,311,536 (-) RGD Celera 1 81,658,173 - 81,797,008 (-) RGD
Sequence:
CCGGCGCGTGAGCCCGATTCGGTAGCACAGCCGGGAAGAGACAGGACCGGGCGGTGGCGGCAGAGACAGGGGGACGCACCCGGTGCAGAGGACCCAATAGGAGCACGCCGCCGCAACCTCTCCCGCGC
hide sequence
RefSeq Acc Id:
XM_063261661 ⟹ XP_063117731
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 96,431,144 - 96,512,352 (-) NCBI
RefSeq Acc Id:
XM_063261662 ⟹ XP_063117732
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 96,431,144 - 96,572,162 (-) NCBI
RefSeq Acc Id:
NP_001100974 ⟸ NM_001107504
- UniProtKB:
B1WBV7 (UniProtKB/TrEMBL)
- Sequence:
MTPRLGTMRLACMFSSILLFGAAGLLLFISLQDPIELSPQQFPGIKFSIRPQHPQHDSHLRIPTERVTRDSPSGSPRGLQLQAPDQPGSHPKAAGSPLRLRQRRRRLLIKKMPAAGTMRGNNSSETFI
hide sequence
Ensembl Acc Id:
ENSRNOP00000030833 ⟸ ENSRNOT00000037700
RefSeq Acc Id:
XP_063117732 ⟸ XM_063261662
- Peptide Label:
isoform X1
- UniProtKB:
B1WBV7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117731 ⟸ XM_063261661
- Peptide Label:
isoform X1
- UniProtKB:
B1WBV7 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-29
Chst8
carbohydrate sulfotransferase 8
Chst8
carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Chst8
carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8
Chst8_predicted
carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Chst8_predicted
carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8 (predicted)
Symbol and Name status set to approved
70820 APPROVED
