Symbol:
Rps6ka5
Name:
ribosomal protein S6 kinase A5
RGD ID:
1308336
Description:
Predicted to enable ATP binding activity and protein kinase activity. Predicted to be involved in several processes, including TORC1 signaling; protein modification process; and regulation of DNA-templated transcription. Predicted to be located in nucleus. Predicted to be active in cytoplasm and nucleoplasm. Orthologous to human RPS6KA5 (ribosomal protein S6 kinase A5); PARTICIPATES IN p38 MAPK signaling pathway; the extracellular signal-regulated Raf/Mek/Erk signaling pathway; mitogen activated protein kinase signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine; aristolochic acid A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC314384; mitogen and stress-activated protein kinase 1; Msk1; ribosomal protein S6 kinase alpha-5; ribosomal protein S6 kinase, 90kDa, polypeptide 5; ribosomal protein S6 kinase, polypeptide 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 125,558,434 - 125,736,576 (-) NCBI GRCr8 mRatBN7.2 6 119,828,823 - 120,006,190 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 119,828,846 - 120,006,224 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 119,991,862 - 120,163,014 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 120,288,522 - 120,459,682 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 119,623,372 - 119,794,534 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 124,557,892 - 124,735,787 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 124,557,913 - 124,735,778 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 133,782,163 - 133,959,351 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 124,820,623 - 124,999,790 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 124,827,314 - 125,003,586 (-) NCBI Celera 6 117,356,574 - 117,533,013 (-) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rps6ka5 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RPS6KA5 mRNA CTD PMID:22079256 Rps6ka5 Rat 1,2-dimethylhydrazine decreases expression ISO Rps6ka5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RPS6KA5 mRNA CTD PMID:22206623 Rps6ka5 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO RPS6KA5 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to RPS6KA5 protein CTD PMID:32991956 Rps6ka5 Rat 17beta-estradiol multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of RPS6KA5 mRNA CTD PMID:17404688 Rps6ka5 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Rps6ka5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Rps6ka5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RPS6KA5 mRNA CTD PMID:19933214 Rps6ka5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RPS6KA5 mRNA CTD PMID:34747641 Rps6ka5 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rps6ka5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [RPS6KA5 protein binds to CYP1A1 enhancer] CTD PMID:24519526 Rps6ka5 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Rps6ka5 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of RPS6KA5 mRNA CTD PMID:25172293 Rps6ka5 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Rps6ka5 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of RPS6KA5 mRNA CTD PMID:26251327 Rps6ka5 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of RPS6KA5 mRNA CTD PMID:30071829 Rps6ka5 Rat 3,4-methylenedioxymethamphetamine decreases methylation ISO Rps6ka5 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased methylation of RPS6KA5 promoter CTD PMID:26251327 Rps6ka5 Rat 4,4'-diaminodiphenylmethane increases expression ISO Rps6ka5 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of RPS6KA5 mRNA CTD PMID:18648102 Rps6ka5 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Rps6ka5 (Mus musculus) 6480464 bisphenol S results in decreased methylation of RPS6KA5 promoter CTD PMID:33297965 Rps6ka5 Rat 4-hydroxyphenyl retinamide decreases expression ISO Rps6ka5 (Mus musculus) 6480464 Fenretinide results in decreased expression of RPS6KA5 mRNA CTD PMID:28973697 Rps6ka5 Rat all-trans-retinoic acid decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 Tretinoin results in decreased expression of RPS6KA5 mRNA CTD PMID:33167477 Rps6ka5 Rat aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of RPS6KA5 protein CTD PMID:38428544 Rps6ka5 Rat arsenite(3-) increases activity ISO Rps6ka5 (Mus musculus) 6480464 arsenite results in increased activity of RPS6KA5 protein CTD PMID:11689710 Rps6ka5 Rat avermectin decreases phosphorylation ISO RPS6KA5 (Homo sapiens) 6480464 avermectin results in decreased phosphorylation of RPS6KA5 protein CTD PMID:33381906 Rps6ka5 Rat benzene increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Benzene results in increased expression of RPS6KA5 mRNA CTD PMID:33064461 Rps6ka5 Rat benzo[a]pyrene decreases expression ISO Rps6ka5 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RPS6KA5 mRNA CTD PMID:22228805 Rps6ka5 Rat benzo[a]pyrene affects methylation ISO RPS6KA5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RPS6KA5 3' UTR CTD PMID:27901495 Rps6ka5 Rat benzo[a]pyrene multiple interactions EXP 6480464 4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [Benzo(a)pyrene promotes the reaction [TNF protein results in increased expression of RPS6KA5 protein modified form]] and Benzo(a)pyrene promotes the reaction [TNF protein results in increased expression of RPS6KA5 protein modified form] CTD PMID:25233930 Rps6ka5 Rat beta-naphthoflavone decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of RPS6KA5 mRNA CTD PMID:32858204 Rps6ka5 Rat bis(2-chloroethyl) sulfide decreases expression ISO Rps6ka5 (Mus musculus) 6480464 Mustard Gas results in decreased expression of RPS6KA5 mRNA CTD PMID:18955075 Rps6ka5 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO Rps6ka5 (Mus musculus) 6480464 Mustard Gas results in increased phosphorylation of RPS6KA5 protein CTD PMID:18200059 Rps6ka5 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of RPS6KA5 mRNA CTD PMID:35810816 Rps6ka5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RPS6KA5 mRNA CTD PMID:25181051 more ... Rps6ka5 Rat bisphenol A increases expression ISO Rps6ka5 (Mus musculus) 6480464 bisphenol A results in increased expression of RPS6KA5 mRNA CTD PMID:35598803 Rps6ka5 Rat bisphenol A increases methylation ISO RPS6KA5 (Homo sapiens) 6480464 bisphenol A results in increased methylation of RPS6KA5 gene CTD PMID:31601247 Rps6ka5 Rat cadmium dichloride increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of RPS6KA5 mRNA CTD PMID:38382870 Rps6ka5 Rat calcitriol decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 Calcitriol results in decreased expression of RPS6KA5 mRNA CTD PMID:16002434 Rps6ka5 Rat cannabidiol increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Cannabidiol results in increased expression of RPS6KA5 mRNA CTD PMID:27918106 Rps6ka5 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of RPS6KA5 mRNA CTD PMID:23125180 Rps6ka5 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of RPS6KA5 mRNA and Cocaine results in increased expression of RPS6KA5 protein CTD PMID:17898221 and PMID:25100957 Rps6ka5 Rat cocaine affects response to substance ISO Rps6ka5 (Mus musculus) 6480464 RPS6KA5 affects the susceptibility to Cocaine CTD PMID:16339038 Rps6ka5 Rat cocaine increases activity ISO Rps6ka5 (Mus musculus) 6480464 Cocaine results in increased activity of RPS6KA5 protein CTD PMID:16339038 Rps6ka5 Rat cocaine multiple interactions ISO Rps6ka5 (Mus musculus) 6480464 Cocaine results in increased phosphorylation of and results in increased activity of RPS6KA5 protein and SL 327 inhibits the reaction [Cocaine results in increased phosphorylation of and results in increased activity of RPS6KA5 protein] CTD PMID:16339038 Rps6ka5 Rat copper atom multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of RPS6KA5 mRNA CTD PMID:30911355 Rps6ka5 Rat copper(0) multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of RPS6KA5 mRNA CTD PMID:30911355 Rps6ka5 Rat cyclosporin A increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Cyclosporine results in increased expression of RPS6KA5 mRNA CTD PMID:20106945 Rps6ka5 Rat decabromodiphenyl ether increases expression ISO RPS6KA5 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of RPS6KA5 protein CTD PMID:31675489 Rps6ka5 Rat deoxynivalenol increases phosphorylation ISO Rps6ka5 (Mus musculus) 6480464 deoxynivalenol results in increased phosphorylation of RPS6KA5 protein CTD PMID:16424113 Rps6ka5 Rat Dibutyl phosphate affects expression ISO RPS6KA5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RPS6KA5 mRNA CTD PMID:37042841 Rps6ka5 Rat diclofenac decreases expression ISO Rps6ka5 (Mus musculus) 6480464 Diclofenac results in decreased expression of RPS6KA5 mRNA CTD PMID:26934552 Rps6ka5 Rat dorsomorphin multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RPS6KA5 mRNA CTD PMID:27188386 Rps6ka5 Rat doxorubicin decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RPS6KA5 mRNA CTD PMID:29803840 Rps6ka5 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of RPS6KA5 mRNA CTD PMID:29391264 Rps6ka5 Rat ethyl methanesulfonate increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of RPS6KA5 mRNA CTD PMID:23649840 Rps6ka5 Rat fasudil decreases activity ISO RPS6KA5 (Homo sapiens) 6480464 fasudil results in decreased activity of RPS6KA5 protein CTD PMID:10998351 Rps6ka5 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of RPS6KA5 mRNA CTD PMID:30307764 Rps6ka5 Rat folic acid decreases expression ISO Rps6ka5 (Mus musculus) 6480464 Folic Acid results in decreased expression of RPS6KA5 mRNA CTD PMID:25629700 Rps6ka5 Rat formaldehyde increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Formaldehyde results in increased expression of RPS6KA5 mRNA CTD PMID:23649840 Rps6ka5 Rat FR900359 affects phosphorylation ISO RPS6KA5 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of RPS6KA5 protein CTD PMID:37730182 Rps6ka5 Rat gallic acid multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 Gallic Acid inhibits the reaction [TNF protein results in increased phosphorylation of RPS6KA5 protein] CTD PMID:21420233 Rps6ka5 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RPS6KA5 mRNA CTD PMID:33387578 Rps6ka5 Rat hexane decreases methylation EXP 6480464 n-hexane results in decreased methylation of RPS6KA5 promoter CTD PMID:23740543 Rps6ka5 Rat hydralazine multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RPS6KA5 mRNA CTD PMID:17183730 Rps6ka5 Rat hydrogen peroxide increases activity ISO Rps6ka5 (Mus musculus) 6480464 Hydrogen Peroxide results in increased activity of RPS6KA5 protein CTD PMID:11689710 Rps6ka5 Rat ivermectin decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 Ivermectin results in decreased expression of RPS6KA5 protein CTD PMID:32959892 Rps6ka5 Rat MeIQx increases expression ISO RPS6KA5 (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:20816883 Rps6ka5 Rat metformin multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Metformin co-treated with Pioglitazone] results in decreased expression of RPS6KA5 mRNA CTD PMID:32589349 Rps6ka5 Rat metformin decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 Metformin results in decreased expression of RPS6KA5 mRNA CTD PMID:32589349 Rps6ka5 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of RPS6KA5 gene CTD PMID:35440735 Rps6ka5 Rat methyl methanesulfonate increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of RPS6KA5 mRNA CTD PMID:23649840 Rps6ka5 Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of RPS6KA5 mRNA CTD PMID:25972201 Rps6ka5 Rat ML-7 decreases activity ISO RPS6KA5 (Homo sapiens) 6480464 ML 7 results in decreased activity of RPS6KA5 protein CTD PMID:12534346 Rps6ka5 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide decreases activity ISO RPS6KA5 (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide results in decreased activity of RPS6KA5 protein CTD PMID:10998351 and PMID:18377872 Rps6ka5 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide decreases activity EXP 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide results in decreased activity of RPS6KA5 protein CTD PMID:15522277 Rps6ka5 Rat nickel sulfate increases expression ISO RPS6KA5 (Homo sapiens) 6480464 nickel sulfate results in increased expression of RPS6KA5 mRNA CTD PMID:22714537 Rps6ka5 Rat niclosamide increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Niclosamide results in increased expression of RPS6KA5 mRNA CTD PMID:36318118 Rps6ka5 Rat Nor-9-carboxy-delta9-THC multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of RPS6KA5 gene CTD PMID:30521419 Rps6ka5 Rat obeticholic acid decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of RPS6KA5 mRNA CTD PMID:27939613 Rps6ka5 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RPS6KA5 mRNA CTD PMID:25729387 Rps6ka5 Rat oxidopamine multiple interactions ISO Rps6ka5 (Mus musculus) 6480464 [benserazide more ... CTD PMID:17596448 and PMID:19187092 Rps6ka5 Rat ozone multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of RPS6KA5 mRNA CTD PMID:35430440 Rps6ka5 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of RPS6KA5 mRNA CTD PMID:33387578 Rps6ka5 Rat paraquat increases expression ISO Rps6ka5 (Mus musculus) 6480464 Paraquat results in increased expression of RPS6KA5 mRNA CTD PMID:28012437 Rps6ka5 Rat phenylephrine multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Phenylephrine results in increased phosphorylation of and results in increased activity of RPS6KA5 protein] more ... CTD PMID:15522277 and PMID:19002563 Rps6ka5 Rat pioglitazone multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Metformin co-treated with Pioglitazone] results in decreased expression of RPS6KA5 mRNA CTD PMID:32589349 Rps6ka5 Rat pirinixic acid multiple interactions ISO Rps6ka5 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of RPS6KA5 mRNA CTD PMID:19710929 Rps6ka5 Rat potassium chromate multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RPS6KA5 mRNA CTD PMID:22079256 Rps6ka5 Rat potassium chromate decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of RPS6KA5 mRNA CTD PMID:22079256 Rps6ka5 Rat progesterone multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of RPS6KA5 mRNA CTD PMID:17404688 Rps6ka5 Rat quercetin increases phosphorylation ISO RPS6KA5 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of RPS6KA5 protein CTD PMID:18377872 Rps6ka5 Rat quercetin multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Quercetin results in increased phosphorylation of RPS6KA5 protein] CTD PMID:18377872 Rps6ka5 Rat Ro 31-8220 decreases activity EXP 6480464 Ro 31-8220 results in decreased activity of RPS6KA5 protein CTD PMID:15522277 Rps6ka5 Rat SB 203580 multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [U 0126 co-treated with SB 203580] inhibits the reaction [sodium arsenite results in increased activity of RPS6KA5 protein] and SB 203580 inhibits the reaction [sodium arsenite results in increased activity of RPS6KA5 protein] CTD PMID:12547826 Rps6ka5 Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [Phenylephrine results in increased phosphorylation of and results in increased activity of RPS6KA5 protein] CTD PMID:15522277 Rps6ka5 Rat SB 431542 multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RPS6KA5 mRNA CTD PMID:27188386 Rps6ka5 Rat SCH 23390 multiple interactions ISO Rps6ka5 (Mus musculus) 6480464 SCH 23390 inhibits the reaction [[Oxidopamine co-treated with Levodopa] results in increased expression of RPS6KA5 protein] CTD PMID:19187092 Rps6ka5 Rat silicon dioxide increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of RPS6KA5 mRNA CTD PMID:25895662 Rps6ka5 Rat silicon dioxide decreases expression ISO Rps6ka5 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of RPS6KA5 mRNA CTD PMID:29203145 Rps6ka5 Rat silver atom decreases expression ISO Rps6ka5 (Mus musculus) 6480464 Silver results in decreased expression of RPS6KA5 mRNA CTD PMID:27131904 Rps6ka5 Rat silver(0) decreases expression ISO Rps6ka5 (Mus musculus) 6480464 Silver results in decreased expression of RPS6KA5 mRNA CTD PMID:27131904 Rps6ka5 Rat SL-327 multiple interactions ISO Rps6ka5 (Mus musculus) 6480464 SL 327 inhibits the reaction [[benserazide more ... CTD PMID:16339038 and PMID:17596448 Rps6ka5 Rat sodium arsenite multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [U 0126 co-treated with SB 203580] inhibits the reaction [sodium arsenite results in increased activity of RPS6KA5 protein] more ... CTD PMID:12547826 Rps6ka5 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of RPS6KA5 mRNA CTD PMID:35314868 Rps6ka5 Rat sodium arsenite decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RPS6KA5 mRNA CTD PMID:28595984 and PMID:34032870 Rps6ka5 Rat sodium arsenite increases activity ISO RPS6KA5 (Homo sapiens) 6480464 sodium arsenite results in increased activity of RPS6KA5 protein CTD PMID:12547826 Rps6ka5 Rat succimer multiple interactions ISO Rps6ka5 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of RPS6KA5 mRNA CTD PMID:21641980 Rps6ka5 Rat sunitinib increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Sunitinib results in increased expression of RPS6KA5 mRNA CTD PMID:31533062 Rps6ka5 Rat T-2 toxin decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of RPS6KA5 mRNA CTD PMID:34581912 Rps6ka5 Rat temozolomide increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Temozolomide results in increased expression of RPS6KA5 mRNA CTD PMID:31758290 Rps6ka5 Rat titanium dioxide decreases methylation ISO Rps6ka5 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RPS6KA5 gene CTD PMID:35295148 Rps6ka5 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RPS6KA5 mRNA CTD PMID:25729387 Rps6ka5 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of RPS6KA5 mRNA CTD PMID:25729387 Rps6ka5 Rat trichostatin A increases expression ISO RPS6KA5 (Homo sapiens) 6480464 trichostatin A results in increased expression of RPS6KA5 mRNA CTD PMID:24935251 and PMID:26272509 Rps6ka5 Rat trichostatin A multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RPS6KA5 mRNA CTD PMID:27188386 Rps6ka5 Rat triphenyl phosphate affects expression ISO RPS6KA5 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RPS6KA5 mRNA CTD PMID:37042841 Rps6ka5 Rat urethane increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Urethane results in increased expression of RPS6KA5 mRNA CTD PMID:28818685 Rps6ka5 Rat valproic acid multiple interactions ISO RPS6KA5 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RPS6KA5 mRNA CTD PMID:17183730 Rps6ka5 Rat valproic acid decreases methylation ISO RPS6KA5 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of RPS6KA5 gene CTD PMID:28853863 more ... Rps6ka5 Rat valproic acid increases expression ISO RPS6KA5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of RPS6KA5 mRNA CTD PMID:29154799 Rps6ka5 Rat valproic acid decreases expression ISO RPS6KA5 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of RPS6KA5 mRNA CTD PMID:23179753 and PMID:28001369 Rps6ka5 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of RPS6KA5 mRNA CTD PMID:18042343 Rps6ka5 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of RPS6KA5 mRNA CTD PMID:19015723 Rps6ka5 Rat Y-27632 decreases activity ISO RPS6KA5 (Homo sapiens) 6480464 Y 27632 results in decreased activity of RPS6KA5 protein CTD PMID:10998351
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (EXP,ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (EXP) arsenite(3-) (ISO) avermectin (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) cadmium dichloride (ISO) calcitriol (ISO) cannabidiol (ISO) chloroprene (EXP) cocaine (EXP,ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethyl methanesulfonate (ISO) fasudil (ISO) fenvalerate (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) gallic acid (ISO) gentamycin (EXP) hexane (EXP) hydralazine (ISO) hydrogen peroxide (ISO) ivermectin (ISO) MeIQx (ISO) metformin (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) mifepristone (EXP) ML-7 (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP,ISO) nickel sulfate (ISO) niclosamide (ISO) Nor-9-carboxy-delta9-THC (ISO) obeticholic acid (ISO) oxaliplatin (EXP) oxidopamine (ISO) ozone (ISO) paracetamol (EXP) paraquat (ISO) phenylephrine (EXP) pioglitazone (ISO) pirinixic acid (ISO) potassium chromate (ISO) progesterone (ISO) quercetin (ISO) Ro 31-8220 (EXP) SB 203580 (EXP,ISO) SB 431542 (ISO) SCH 23390 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) SL-327 (ISO) sodium arsenite (EXP,ISO) succimer (ISO) sunitinib (ISO) T-2 toxin (ISO) temozolomide (ISO) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) Y-27632 (ISO)
Rps6ka5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 125,558,434 - 125,736,576 (-) NCBI GRCr8 mRatBN7.2 6 119,828,823 - 120,006,190 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 119,828,846 - 120,006,224 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 119,991,862 - 120,163,014 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 120,288,522 - 120,459,682 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 119,623,372 - 119,794,534 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 124,557,892 - 124,735,787 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 124,557,913 - 124,735,778 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 133,782,163 - 133,959,351 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 124,820,623 - 124,999,790 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 124,827,314 - 125,003,586 (-) NCBI Celera 6 117,356,574 - 117,533,013 (-) NCBI Celera Cytogenetic Map 6 q32 NCBI
RPS6KA5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 90,847,861 - 91,060,641 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 90,847,861 - 91,060,641 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 91,314,205 - 91,526,985 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 90,406,912 - 90,596,746 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 90,430,073 - 90,596,746 NCBI Celera 14 71,385,722 - 71,575,427 (-) NCBI Celera Cytogenetic Map 14 q32.11 NCBI HuRef 14 71,512,920 - 71,702,554 (-) NCBI HuRef CHM1_1 14 91,274,932 - 91,464,763 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 85,073,446 - 85,286,084 (-) NCBI T2T-CHM13v2.0
Rps6ka5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 100,514,692 - 100,691,693 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 100,514,698 - 100,693,242 (-) Ensembl GRCm39 Ensembl GRCm38 12 100,548,439 - 100,725,328 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 100,548,439 - 100,726,983 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 101,787,988 - 101,963,238 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 100,950,828 - 101,126,078 (-) NCBI MGSCv36 mm8 Celera 12 101,770,330 - 101,946,292 (-) NCBI Celera Cytogenetic Map 12 E NCBI cM Map 12 50.81 NCBI
Rps6ka5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 13,217,222 - 13,392,674 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 13,218,451 - 13,392,080 (-) NCBI ChiLan1.0 ChiLan1.0
RPS6KA5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 91,990,976 - 92,202,646 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 91,230,779 - 91,419,154 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 71,489,654 - 71,679,250 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 90,840,651 - 91,028,786 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 90,840,655 - 91,028,780 (-) Ensembl panpan1.1 panPan2
RPS6KA5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 61,801,185 - 61,962,846 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 61,802,812 - 61,973,259 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 61,381,750 - 61,551,905 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 62,076,158 - 62,246,525 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 62,052,775 - 62,246,681 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 61,756,580 - 61,926,684 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 61,805,735 - 61,976,310 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 62,135,192 - 62,305,546 (-) NCBI UU_Cfam_GSD_1.0
Rps6ka5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 13,936,110 - 14,130,251 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936488 17,940,327 - 18,132,970 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936488 17,937,421 - 18,132,845 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RPS6KA5
RPS6KA5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 68,620,637 - 68,821,996 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 68,619,349 - 68,763,376 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 55,881,279 - 56,081,538 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rps6ka5
.
Predicted Target Of
Count of predictions: 514 Count of miRNA genes: 270 Interacting mature miRNAs: 348 Transcripts: ENSRNOT00000064716 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
BE108505
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 119,849,738 - 119,849,896 (+) MAPPER mRatBN7.2 Rnor_6.0 6 124,578,806 - 124,578,963 NCBI Rnor6.0 Rnor_5.0 6 133,803,077 - 133,803,234 UniSTS Rnor5.0 RGSC_v3.4 6 124,841,515 - 124,841,672 UniSTS RGSC3.4 Celera 6 117,377,469 - 117,377,626 UniSTS RH 3.4 Map 6 858.8 UniSTS Cytogenetic Map 6 q32 UniSTS
RH138282
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 119,966,370 - 119,966,506 (+) MAPPER mRatBN7.2 Rnor_6.0 6 124,695,946 - 124,696,081 NCBI Rnor6.0 Rnor_5.0 6 133,919,525 - 133,919,660 UniSTS Rnor5.0 RGSC_v3.4 6 124,958,797 - 124,958,932 UniSTS RGSC3.4 Celera 6 117,493,405 - 117,493,540 UniSTS RH 3.4 Map 6 858.2 UniSTS Cytogenetic Map 6 q32 UniSTS
AU049990
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 119,917,369 - 119,917,536 (+) MAPPER mRatBN7.2 Rnor_6.0 6 124,646,427 - 124,646,593 NCBI Rnor6.0 Rnor_5.0 6 133,870,702 - 133,870,868 UniSTS Rnor5.0 RGSC_v3.4 6 124,910,154 - 124,910,320 UniSTS RGSC3.4 Celera 6 117,444,973 - 117,445,139 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000064716 ⟹ ENSRNOP00000063163
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 119,828,846 - 120,006,144 (-) Ensembl Rnor_6.0 Ensembl 6 124,557,913 - 124,735,741 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091693 ⟹ ENSRNOP00000072518
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 119,843,277 - 119,949,175 (-) Ensembl Rnor_6.0 Ensembl 6 124,560,659 - 124,735,778 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105060 ⟹ ENSRNOP00000091483
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 119,828,846 - 120,006,224 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107141 ⟹ ENSRNOP00000089479
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 119,828,846 - 119,949,175 (-) Ensembl
RefSeq Acc Id:
NM_001395592 ⟹ NP_001382521
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 125,558,434 - 125,735,755 (-) NCBI mRatBN7.2 6 119,828,825 - 120,006,151 (-) NCBI
RefSeq Acc Id:
XM_006240438 ⟹ XP_006240500
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 125,558,451 - 125,736,576 (-) NCBI mRatBN7.2 6 119,828,823 - 120,006,186 (-) NCBI Rnor_6.0 6 124,557,892 - 124,735,787 (-) NCBI Rnor_5.0 6 133,782,163 - 133,959,351 (-) NCBI
Sequence:
TGCGCCGTACTAGCGGTGCCCGCTGAGGGGAGGAGGCGGAGGAGCTCCGCGGCCAGAGCGGGAAAGAGACTCGCCTCAGTGTCGGAGTTGTGGCGCTGCGGCAGCTTGGCTCCTGGAGCTGTGAAGAG
hide sequence
RefSeq Acc Id:
XM_017594169 ⟹ XP_017449658
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 125,558,451 - 125,735,586 (-) NCBI mRatBN7.2 6 119,828,823 - 119,951,182 (-) NCBI Rnor_6.0 6 124,557,892 - 124,680,278 (-) NCBI
Sequence:
TTAGTTGTTGTTCTGTTGCTGTGAAGAGACACCGTGACCAAGGCAACACTTATCAAAGAAAGCATTTAATTGGGGTCTTGCCTACAACTTTATATGCCAACTTAACAGGACATGCAGAGAAGGTGGGA
hide sequence
RefSeq Acc Id:
XM_017594171 ⟹ XP_017449660
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 125,558,451 - 125,596,888 (-) NCBI mRatBN7.2 6 119,828,823 - 119,867,313 (-) NCBI Rnor_6.0 6 124,557,892 - 124,596,530 (-) NCBI
Sequence:
AATGCCATAAAAATAATCTCCTGTAGGTTTCCAGAGCATTACTCCTTCTGTTCATTCCTAGCAAGTATCACAGTTGCAGTGTTATGCTTTTGTTCTGTTTTACTTGAGTTTTCTAACATTGAGAACAG
hide sequence
RefSeq Acc Id:
XM_039112350 ⟹ XP_038968278
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 125,558,451 - 125,652,547 (-) NCBI mRatBN7.2 6 119,828,823 - 119,922,936 (-) NCBI
RefSeq Acc Id:
XM_039112351 ⟹ XP_038968279
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 125,573,680 - 125,736,576 (-) NCBI mRatBN7.2 6 119,844,071 - 120,006,190 (-) NCBI
RefSeq Acc Id:
XM_063261972 ⟹ XP_063118042
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 125,558,451 - 125,735,421 (-) NCBI
RefSeq Acc Id:
XM_063261973 ⟹ XP_063118043
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 125,558,451 - 125,646,066 (-) NCBI
RefSeq Acc Id:
XP_006240500 ⟸ XM_006240438
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6ABQ6 (UniProtKB/TrEMBL), A0A8I6A7D1 (UniProtKB/TrEMBL)
- Sequence:
MEGEGGGSGGAGTSGDSGDGGEQLLTVKHELRTAYGKVFLVRKISGHDAGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFTEHE
hide sequence
RefSeq Acc Id:
XP_017449658 ⟸ XM_017594169
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A7D1 (UniProtKB/TrEMBL)
- Sequence:
MKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHL
hide sequence
RefSeq Acc Id:
XP_017449660 ⟸ XM_017594171
- Peptide Label:
isoform X4
- Sequence:
MSSVAKDLLQRLLMKDPKKRLGCGPRDAEEIKEHLFFEKINWDDLAAKKVPAPFKPVIRDELDV
hide sequence
Ensembl Acc Id:
ENSRNOP00000072518 ⟸ ENSRNOT00000091693
Ensembl Acc Id:
ENSRNOP00000063163 ⟸ ENSRNOT00000064716
RefSeq Acc Id:
XP_038968278 ⟸ XM_039112350
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038968279 ⟸ XM_039112351
- Peptide Label:
isoform X5
- UniProtKB:
A6JEH6 (UniProtKB/TrEMBL), D3ZY17 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000091483 ⟸ ENSRNOT00000105060
Ensembl Acc Id:
ENSRNOP00000089479 ⟸ ENSRNOT00000107141
RefSeq Acc Id:
NP_001382521 ⟸ NM_001395592
- UniProtKB:
A0A8I6A7D1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118042 ⟸ XM_063261972
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A7D1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118043 ⟸ XM_063261973
- Peptide Label:
isoform X3
RGD ID: 13694783 Promoter ID: EPDNEW_R5300 Type: single initiation site Name: Rps6ka5_1 Description: ribosomal protein S6 kinase A5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 124,735,781 - 124,735,841 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-04
Rps6ka5
ribosomal protein S6 kinase A5
Rps6ka5
ribosomal protein S6 kinase, polypeptide 5
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Rps6ka5
ribosomal protein S6 kinase, polypeptide 5
Rps6ka5_predicted
ribosomal protein S6 kinase, polypeptide 5 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Rps6ka5_predicted
ribosomal protein S6 kinase, polypeptide 5 (predicted)
Symbol and Name status set to approved
70820 APPROVED
