Cd3g (CD3 gamma subunit of T-cell receptor complex)

Advanced Search (OLGA)

Gene: Cd3g (CD3 gamma subunit of T-cell receptor complex) Rattus norvegicus

Analyze

Symbol:

Cd3g

Name:

CD3 gamma subunit of T-cell receptor complex

RGD ID:

1307718

Description:

Predicted to enable identical protein binding activity and transmembrane signaling receptor activity. Predicted to be involved in several processes, including positive thymic T cell selection; protein transport; and regulation of lymphocyte apoptotic process. Predicted to be located in cytosol and plasma membrane. Predicted to be part of alpha-beta T cell receptor complex. Predicted to be active in external side of plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 17. Orthologous to human CD3G (CD3 gamma subunit of T-cell receptor complex); PARTICIPATES IN adaptive immune response pathway; interleukin-12 signaling pathway; Chagas disease pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CD3 molecule, gamma; CD3 antigen, gamma polypeptide; CD3 gamma-chain; CD3 molecule, gamma polypeptide; CD3g molecule; LOC300678; T-cell receptor T3 gamma chain; T-cell surface glycoprotein CD3 gamma chain

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CD3G (CD3 gamma subunit of T-cell receptor complex)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cd3g (CD3 antigen, gamma polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cd3g (CD3g molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100979261 (T-cell surface glycoprotein CD3 gamma chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CD3G (CD3 gamma subunit of T-cell receptor complex)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cd3g (CD3g molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CD3G (CD3 gamma subunit of T-cell receptor complex)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CD3G (CD3g molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cd3g (CD3g molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CD3G (CD3 gamma subunit of T-cell receptor complex)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cd3g (CD3 antigen, gamma polypeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cd3g	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	54,177,572 - 54,184,087 (-)	NCBI		GRCr8
mRatBN7.2	8	45,280,797 - 45,287,271 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	45,281,204 - 45,287,147 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	50,776,665 - 50,782,763 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	49,055,387 - 49,061,489 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	46,925,945 - 46,932,045 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	49,274,553 - 49,280,943 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	49,274,960 - 49,280,901 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	47,892,428 - 47,898,819 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	47,924,369 - 47,930,550 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	47,932,753 - 47,939,309 (-)	NCBI
Celera	8	44,865,997 - 44,871,910 (-)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenosine deaminase deficiency (ISO)

CD3epsilon deficiency (ISO)

chromosome 11 partial duplication syndrome (ISO)

Dwarfism (ISO)

Familial Atrial Fibrillation 14 (ISO)

glycogen storage disease Ib (ISO)

immunodeficiency 17 (ISO)

immunodeficiency 18 (ISO)

immunodeficiency 19 (ISO)

inflammatory bowel disease 28 (ISO)

intellectual disability (ISO)

isolated microphthalmia 5 (ISO)

long QT syndrome 10 (ISO)

RASopathy (ISO)

severe combined immunodeficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3',5'-cyclic AMP (ISO)

3,4-methylenedioxymethamphetamine (EXP)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

alendronic acid (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

aluminium trifluoride (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

aristolochic acid A (EXP)

benzene (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

calcidiol (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

chromium(6+) (ISO)

cyclophosphamide (ISO)

dexamethasone (ISO)

diazinon (EXP)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dieldrin (EXP)

diethylstilbestrol (ISO)

dimethyl sulfoxide (ISO)

dioxygen (ISO)

diuron (EXP,ISO)

furan (EXP)

gentamycin (EXP)

hydroquinone O-beta-D-glucopyranoside (ISO)

ketoconazole (ISO)

kojic acid (ISO)

lipopolysaccharide (ISO)

methylmercury chloride (EXP)

nickel atom (ISO)

nickel dichloride (EXP)

nitrofen (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

raloxifene (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium fluoride (ISO)

tamibarotene (ISO)

testosterone (ISO)

Theaflavin 3,3'-digallate (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IEA)

biological_process (ND)

cell surface receptor signaling pathway (IBA,IEA,ISO,ISS)

establishment or maintenance of cell polarity (IEA,ISO,ISS)

positive thymic T cell selection (IBA)

protein transport (IEA,ISO,ISS)

regulation of lymphocyte apoptotic process (IEA,ISO,ISS)

Cellular Component

alpha-beta T cell receptor complex (IBA,IEA,ISO)

cytosol (IEA,ISO)

external side of plasma membrane (IBA)

membrane (IEA)

plasma membrane (ISO)

Molecular Function

identical protein binding (IEA,ISO)

protein binding (ISO,ISS)

transmembrane signaling receptor activity (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

adaptive immune response pathway (ISO)

Chagas disease pathway (IEA)

interleukin-12 signaling pathway (ISO)

measles pathway (IEA)

T cell receptor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	In vitro production and characterization of partly assembled human CD3 complexes.	Kastrup J, etal., Scand J Immunol 2002 Nov;56(5):436-42.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	Assembly of the TCR/CD3 complex: CD3 epsilon/delta and CD3 epsilon/gamma dimers associate indistinctly with both TCR alpha and TCR beta chains. Evidence for a double TCR heterodimer model.	San Jose E, etal., Eur J Immunol 1998 Jan;28(1):12-21.

Additional References at PubMed

PMID:1531205	PMID:9208839	PMID:12407027	PMID:12794121	PMID:14967045

Genomics

Comparative Map Data

Cd3g
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	54,177,572 - 54,184,087 (-)	NCBI		GRCr8
mRatBN7.2	8	45,280,797 - 45,287,271 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	45,281,204 - 45,287,147 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	50,776,665 - 50,782,763 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	49,055,387 - 49,061,489 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	46,925,945 - 46,932,045 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	49,274,553 - 49,280,943 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	49,274,960 - 49,280,901 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	47,892,428 - 47,898,819 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	47,924,369 - 47,930,550 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	47,932,753 - 47,939,309 (-)	NCBI
Celera	8	44,865,997 - 44,871,910 (-)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

CD3G
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	118,344,344 - 118,355,161 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	118,344,344 - 118,355,161 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	118,215,059 - 118,225,876 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	117,720,311 - 117,729,261 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	117,720,310 - 117,729,261	NCBI
Celera	11	115,372,928 - 115,382,366 (+)	NCBI		Celera
Cytogenetic Map	11	q23.3	NCBI
HuRef	11	114,148,956 - 114,158,393 (+)	NCBI		HuRef
CHM1_1	11	118,101,492 - 118,110,943 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	118,360,702 - 118,371,519 (+)	NCBI		T2T-CHM13v2.0

Cd3g
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	44,880,870 - 44,891,729 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	44,880,870 - 44,891,729 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	44,969,572 - 44,980,431 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	44,969,572 - 44,980,431 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	44,777,655 - 44,788,514 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	44,720,683 - 44,731,419 (-)	NCBI		MGSCv36	mm8
Celera	9	42,234,684 - 42,245,549 (-)	NCBI		Celera
Cytogenetic Map	9	A5.2	NCBI
cM Map	9	24.84	NCBI

Cd3g
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	19,486,284 - 19,494,922 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	19,486,066 - 19,496,474 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100979261
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	119,036,442 - 119,056,649 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	120,141,391 - 120,161,609 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	113,179,270 - 113,190,104 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	117,111,132 - 117,120,566 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	117,111,132 - 117,120,566 (+)	Ensembl	panpan1.1		panPan2

CD3G
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	15,379,788 - 15,391,271 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	15,380,633 - 15,391,214 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	15,429,235 - 15,442,031 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	15,320,796 - 15,333,597 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	15,320,127 - 15,333,550 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	15,459,062 - 15,471,859 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	15,362,517 - 15,375,316 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	15,403,667 - 15,416,467 (-)	NCBI		UU_Cfam_GSD_1.0

Cd3g
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	100,482,219 - 100,490,660 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936542	3,405,084 - 3,412,104 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CD3G
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	45,645,364 - 45,704,745 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	45,645,243 - 45,656,779 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	50,686,376 - 50,697,901 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CD3G
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	109,721,150 - 109,730,267 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	109,720,789 - 109,732,014 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	16,305,415 - 16,315,058 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cd3g
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624784	13,738,686 - 13,748,415 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624784	13,738,424 - 13,748,311 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cd3g
50 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	149
Count of miRNA genes:	124
Interacting mature miRNAs:	134
Transcripts:	ENSRNOT00000021390
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	58482492	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	26644912	46711092	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	28242912	53961020	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
5684993	Bmd84	Bone mineral density QTL 84	4.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	8	42692684	50095447	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	29502665	50095447	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	41	49	89	88	57	25	57	6	203	86	29	44	52	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001077646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006242932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC136866	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S79711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021390 ⟹ ENSRNOP00000021390

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	45,281,204 - 45,287,147 (-)	Ensembl
Rnor_6.0 Ensembl	8	49,274,960 - 49,280,901 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109307 ⟹ ENSRNOP00000088440

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	45,281,204 - 45,287,094 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117902 ⟹ ENSRNOP00000078789

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	45,283,654 - 45,287,147 (-)	Ensembl

RefSeq Acc Id:

NM_001077646 ⟹ NP_001071114

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	54,177,977 - 54,183,918 (-)	NCBI
mRatBN7.2	8	45,281,204 - 45,287,147 (-)	NCBI
Rnor_6.0	8	49,274,960 - 49,280,901 (-)	NCBI
Rnor_5.0	8	47,892,428 - 47,898,819 (-)	NCBI
RGSC_v3.4	8	47,924,369 - 47,930,550 (-)	RGD
Celera	8	44,865,997 - 44,871,910 (-)	RGD

Sequence:

show sequence

GCCGGCTACTAAGGAACTCTCGACACTTCTACTGGAGAAGCAAAGAAACTAACATGGAGCAGGG
GAAAGGTTTGGCTGGCCTCTTCCTGGTGATCTCTCTTCTTCAAGGCACCATGGCCCAGCAAAAA
GAAGAAAAGCATTTGGTAAAAGTGGATGACAGCCAAGGAGATGGCTCTGTACTTCTGACTTGTG
ACTTCAATGAGAAGACTATCACATGGCTTAAAGATGGGCACAGAATAAGTCCTCCAAATGCAAC
TAAAAGCACGTGGAATCTGGGCAACGGTGCCAAAGACCCTCGAGGCATGTATCAGTGCCGAGGA
GCAAAGAAGAAGTCGCAGCTCCTGCAAGTGTACTACAGACTGTGTGAGAACTGCATTGAGCTAA
ATATGGGCACTGTGTCCGGCTTTATCTTCGCTGAAATCATCAGCATTTTCTTCCTTGCTGTTGG
TGTATACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCAAGAGCTTCAGACAAGCAGACTCTG
TTGCAAAATGAACAGGTCTACCAGCCCCTCAAGGACCGGGAATATGAACAGTACAGCCGTCTCC
AAGGAAACCAAGTGAGAAAGAAGTGAACTCAGCAGGAATTC

hide sequence

RefSeq Acc Id:

XM_006242932 ⟹ XP_006242994

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	54,177,572 - 54,184,087 (-)	NCBI
mRatBN7.2	8	45,280,797 - 45,287,242 (-)	NCBI
Rnor_6.0	8	49,274,553 - 49,280,943 (-)	NCBI
Rnor_5.0	8	47,892,428 - 47,898,819 (-)	NCBI

Sequence:

show sequence

TGGCTGGGTGGCTGGGCGGCTGGGCGGCTGGGTGGCTGGGTGGCCGGCTACTAAGGAACTCTCG
ACACTTCTACTGGAGAAGCAAAGAGACTAACATGGAGCAGGGGAAGGGTTTGGCTGGCCTCTTC
CTGGTGATCTCTCTTCTTCAAGGCACCATGGCCCAGCAAAAACAAGAAAAGCATTTGGTAAAAG
TGGATGACAGCCAAGGAGATGGCTCTGTACTTCTGACTTGTGACTTGAATGAGAAGACAATCAC
ATGGCTTAAAGATGGGCACAGAATAAGTCCTCCAAATGCAACTAAAAGCACGTGGAATCTGGGC
AACGGTGCCAAAGACCCTCGAGGCATGTATCAGTGCCGAGGAGCAAAGAAGAAGTCGCAGCTCC
TGCAAGTGTACTACAGACTGTGTGAGAACTGCATTGAGCTAAATATGGGCACTGTGTCCGGCTT
TATCTTCGCTGAAATCATCAGCATTTTCTTCCTTGCTGTTGGTGTATACTTCATTGCTGGACAG
GATGGAGTTCGCCAGTCAAGAGCTTCAGACAAGCAGACTCTGTTGCAAAATGAACAGGTCTACC
AGCCCCTCAAGGACCGGGAATATGAACAGTACAGCCGTCTCCAAGGAAACCAAGTGAGAAAGAA
GTGAACTCAGCAGGAATTCAGAATTTCCTTTGTGATGAAGGACTGTCTTGCCTATTACATCATC
AACCTTGGCTATGATCTACCTGATGGCACTGGTACCCACCCTCACTCAGTGTGATAAGTAATAA
ACCATCCCTATTTGACTGAGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001071114	(Get FASTA)	NCBI Sequence Viewer
	XP_006242994	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB21286	(Get FASTA)	NCBI Sequence Viewer
	EDL95343	(Get FASTA)	NCBI Sequence Viewer
	EDL95344	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021390.4
	ENSRNOP00000078789.1
	ENSRNOP00000088440.1
GenBank Protein	Q64159	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001071114 ⟸ NM_001077646
- Peptide Label:	precursor
- UniProtKB:	F1M9F8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEQGKGLAGLFLVISLLQGTMAQQKEEKHLVKVDDSQGDGSVLLTCDFNEKTITWLKDGHRISP PNATKSTWNLGNGAKDPRGMYQCRGAKKKSQLLQVYYRLCENCIELNMGTVSGFIFAEIISIFF LAVGVYFIAGQDGVRQSRASDKQTLLQNEQVYQPLKDREYEQYSRLQGNQVRKK hide sequence

RefSeq Acc Id:	XP_006242994 ⟸ XM_006242932
- Peptide Label:	isoform X1
- Sequence:	show sequence MEQGKGLAGLFLVISLLQGTMAQQKQEKHLVKVDDSQGDGSVLLTCDLNEKTITWLKDGHRISP PNATKSTWNLGNGAKDPRGMYQCRGAKKKSQLLQVYYRLCENCIELNMGTVSGFIFAEIISIFF LAVGVYFIAGQDGVRQSRASDKQTLLQNEQVYQPLKDREYEQYSRLQGNQVRKK hide sequence

Ensembl Acc Id:

ENSRNOP00000021390 ⟸ ENSRNOT00000021390

Ensembl Acc Id:

ENSRNOP00000078789 ⟸ ENSRNOT00000117902

Ensembl Acc Id:

ENSRNOP00000088440 ⟸ ENSRNOT00000109307

Protein Domains

CD3 gamma/delta subunit Ig-like Ig-like Immunoglobulin subtype ITAM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64159-F1-model_v2	AlphaFold	Q64159	1-182	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695906

Promoter ID:

EPDNEW_R6431

Type:

initiation region

Name:

Cd3g_1

Description:

CD3g molecule

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	49,280,946 - 49,281,006	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307718	AgrOrtholog
BioCyc Gene	G2FUF-30690	BioCyc
Ensembl Genes	ENSRNOG00000015945	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021390.7	UniProtKB/TrEMBL
	ENSRNOT00000109307.1	UniProtKB/TrEMBL
	ENSRNOT00000117902.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	CD3_esu/gsu/dsu	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Phos_immunorcpt_sig_ITAM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:300678	UniProtKB/Swiss-Prot
NCBI Gene	300678	ENTREZGENE
PANTHER	PTHR10570	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	T-CELL SURFACE GLYCOPROTEIN CD3 GAMMA CHAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ig_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ITAM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cd3g	PhenoGen
PROSITE	ITAM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015945	RatGTEx
SMART	IGc2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A9Z4_RAT	UniProtKB/TrEMBL
	A0A8I6G3U5_RAT	UniProtKB/TrEMBL
	A6J420_RAT	UniProtKB/TrEMBL
	A6J421_RAT	UniProtKB/TrEMBL
	CD3G_RAT	UniProtKB/Swiss-Prot
	F1M9F8	ENTREZGENE, UniProtKB/TrEMBL
	Q64159	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-03-14	Cd3g	CD3 gamma subunit of T-cell receptor complex	Cd3g	CD3g molecule	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-02	Cd3g	CD3g molecule	Cd3g	CD3 molecule, gamma	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-06-27	Cd3g	CD3 molecule, gamma polypeptide	Cd3g	CD3 antigen, gamma polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Cd3g	CD3 antigen, gamma polypeptide	Cd3g_predicted	CD3 antigen, gamma polypeptide (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Cd3g_predicted	CD3 antigen, gamma polypeptide (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)