Symbol:
Cd3g
Name:
CD3 gamma subunit of T-cell receptor complex
RGD ID:
1307718
Description:
Predicted to enable identical protein binding activity and transmembrane signaling receptor activity. Predicted to be involved in several processes, including positive thymic T cell selection; protein transport; and regulation of lymphocyte apoptotic process. Predicted to be located in cytosol and plasma membrane. Predicted to be part of alpha-beta T cell receptor complex. Predicted to be active in external side of plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 17. Orthologous to human CD3G (CD3 gamma subunit of T-cell receptor complex); PARTICIPATES IN adaptive immune response pathway; interleukin-12 signaling pathway; Chagas disease pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CD3 molecule, gamma; CD3 antigen, gamma polypeptide; CD3 gamma-chain; CD3 molecule, gamma polypeptide; CD3g molecule; LOC300678; T-cell receptor T3 gamma chain; T-cell surface glycoprotein CD3 gamma chain
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CD3G (CD3 gamma subunit of T-cell receptor complex) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Cd3g (CD3 antigen, gamma polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cd3g (CD3g molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100979261 (T-cell surface glycoprotein CD3 gamma chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CD3G (CD3 gamma subunit of T-cell receptor complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cd3g (CD3g molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CD3G (CD3 gamma subunit of T-cell receptor complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CD3G (CD3g molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cd3g (CD3g molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CD3G (CD3 gamma subunit of T-cell receptor complex)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cd3g (CD3 antigen, gamma polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cd3g
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 54,177,572 - 54,184,087 (-) NCBI GRCr8 mRatBN7.2 8 45,280,797 - 45,287,271 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 45,281,204 - 45,287,147 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 50,776,665 - 50,782,763 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 49,055,387 - 49,061,489 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 46,925,945 - 46,932,045 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 49,274,553 - 49,280,943 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 49,274,960 - 49,280,901 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,892,428 - 47,898,819 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,924,369 - 47,930,550 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 47,932,753 - 47,939,309 (-) NCBI Celera 8 44,865,997 - 44,871,910 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cd3g Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of CD3G mRNA CTD PMID:16079270 Cd3g Rat 17beta-estradiol decreases expression ISO Cd3g (Mus musculus) 6480464 Estradiol results in decreased expression of CD3G mRNA CTD PMID:19484750 Cd3g Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CD3G mRNA CTD PMID:34747641 Cd3g Rat 2,4,6-trinitrobenzenesulfonic acid decreases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of CD3G mRNA CTD PMID:23537331 Cd3g Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Cd3g (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Cd3g Rat 3',5'-cyclic AMP decreases phosphorylation ISO Cd3g (Mus musculus) 6480464 Cyclic AMP results in decreased phosphorylation of CD3G protein CTD PMID:2824607 Cd3g Rat 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CD3G mRNA CTD PMID:30071829 Cd3g Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CD3G mRNA CTD PMID:30047161 Cd3g Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19480007 Cd3g Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CD3G mRNA CTD PMID:31881176 Cd3g Rat aflatoxin B1 increases methylation ISO CD3G (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CD3G gene CTD PMID:27153756 Cd3g Rat alendronic acid affects expression EXP 6480464 Alendronate affects the expression of CD3G mRNA CTD PMID:16079270 Cd3g Rat all-trans-retinoic acid increases expression ISO CD3G (Homo sapiens) 6480464 Tretinoin results in increased expression of CD3G mRNA CTD PMID:12875902 Cd3g Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of CD3G mRNA CTD PMID:35163327 Cd3g Rat aluminium trifluoride multiple interactions ISO Cd3g (Mus musculus) 6480464 Tetradecanoylphorbol Acetate inhibits the reaction [aluminum fluoride results in increased phosphorylation of CD3G protein] CTD PMID:2824607 Cd3g Rat aluminium trifluoride increases phosphorylation ISO Cd3g (Mus musculus) 6480464 aluminum fluoride results in increased phosphorylation of CD3G protein CTD PMID:2824607 Cd3g Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of CD3G mRNA CTD PMID:30047161 Cd3g Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CD3G mRNA CTD PMID:16483693 Cd3g Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of CD3G mRNA CTD PMID:30779732 Cd3g Rat antirheumatic drug decreases expression ISO CD3G (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CD3G mRNA CTD PMID:24449571 Cd3g Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in increased expression of CD3G mRNA CTD PMID:23912714 Cd3g Rat benzene decreases expression ISO CD3G (Homo sapiens) 6480464 Benzene results in decreased expression of CD3G mRNA CTD PMID:22214187 Cd3g Rat benzo[a]pyrene decreases expression ISO Cd3g (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CD3G mRNA CTD PMID:21569818 and PMID:22610609 Cd3g Rat benzo[a]pyrene affects methylation ISO CD3G (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CD3G promoter CTD PMID:27901495 Cd3g Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CD3G mRNA CTD PMID:25181051 Cd3g Rat bisphenol A increases expression ISO Cd3g (Mus musculus) 6480464 bisphenol A results in increased expression of CD3G mRNA CTD PMID:38701888 Cd3g Rat cadmium atom decreases expression ISO CD3G (Homo sapiens) 6480464 Cadmium results in decreased expression of CD3G mRNA CTD PMID:24376830 Cd3g Rat calcidiol multiple interactions ISO CD3G (Homo sapiens) 6480464 Calcifediol promotes the reaction [[[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased expression of VDR protein] and Ketoconazole inhibits the reaction [Calcifediol promotes the reaction [[[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased expression of VDR protein]] CTD PMID:24792400 Cd3g Rat calcitriol increases expression ISO CD3G (Homo sapiens) 6480464 Calcitriol results in increased expression of CD3G mRNA CTD PMID:12875902 Cd3g Rat calcitriol multiple interactions ISO CD3G (Homo sapiens) 6480464 [[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased abundance of Calcitriol more ... CTD PMID:24792400 Cd3g Rat carbon nanotube affects expression ISO Cd3g (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of CD3G mRNA CTD PMID:25554681 Cd3g Rat carbon nanotube decreases expression ISO Cd3g (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of CD3G mRNA CTD PMID:25554681 Cd3g Rat CGP 52608 multiple interactions ISO CD3G (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CD3G gene] CTD PMID:28238834 Cd3g Rat chloroprene decreases expression ISO Cd3g (Mus musculus) 6480464 Chloroprene results in decreased expression of CD3G mRNA CTD PMID:23125180 Cd3g Rat chromium(6+) affects expression ISO Cd3g (Mus musculus) 6480464 chromium hexavalent ion affects the expression of CD3G mRNA CTD PMID:28472532 Cd3g Rat cyclophosphamide decreases expression ISO Cd3g (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of CD3G mRNA CTD PMID:21041162 Cd3g Rat dexamethasone decreases expression ISO Cd3g (Mus musculus) 6480464 Dexamethasone results in decreased expression of CD3G mRNA CTD PMID:21041162 Cd3g Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of CD3G mRNA CTD PMID:22546817 Cd3g Rat Dibutyl phosphate affects expression ISO CD3G (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CD3G mRNA CTD PMID:37042841 Cd3g Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CD3G mRNA CTD PMID:21266533 Cd3g Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of CD3G mRNA CTD PMID:22546817 Cd3g Rat diethylstilbestrol decreases expression ISO Cd3g (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of CD3G mRNA CTD PMID:21041162 Cd3g Rat dimethyl sulfoxide affects expression ISO CD3G (Homo sapiens) 6480464 Dimethyl Sulfoxide affects the expression of CD3G mRNA CTD PMID:24834073 Cd3g Rat dioxygen multiple interactions ISO Cd3g (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CD3G mRNA CTD PMID:30529165 Cd3g Rat diuron increases expression EXP 6480464 Diuron results in increased expression of CD3G mRNA CTD PMID:25152437 Cd3g Rat diuron decreases expression ISO CD3G (Homo sapiens) 6480464 Diuron results in decreased expression of CD3G mRNA CTD PMID:35967413 Cd3g Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of CD3G mRNA CTD PMID:21551480 Cd3g Rat furan increases expression EXP 6480464 furan results in increased expression of CD3G mRNA CTD PMID:27387713 Cd3g Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CD3G mRNA CTD PMID:22061828 Cd3g Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO CD3G (Homo sapiens) 6480464 Arbutin results in decreased expression of CD3G mRNA CTD PMID:17103032 Cd3g Rat ketoconazole multiple interactions ISO CD3G (Homo sapiens) 6480464 Ketoconazole inhibits the reaction [[[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased abundance of Calcitriol] and Ketoconazole inhibits the reaction [Calcifediol promotes the reaction [[[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased expression of VDR protein]] CTD PMID:24792400 Cd3g Rat kojic acid decreases expression ISO CD3G (Homo sapiens) 6480464 kojic acid results in decreased expression of CD3G mRNA CTD PMID:16595896 Cd3g Rat lipopolysaccharide multiple interactions ISO CD3G (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Cd3g Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of CD3G mRNA CTD PMID:31378766 Cd3g Rat nickel atom increases expression ISO CD3G (Homo sapiens) 6480464 Nickel results in increased expression of CD3G mRNA CTD PMID:25583101 Cd3g Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of CD3G mRNA CTD PMID:22546817 Cd3g Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of CD3G mRNA CTD PMID:33484710 Cd3g Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CD3G mRNA CTD PMID:25729387 Cd3g Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of CD3G mRNA CTD PMID:25729387 Cd3g Rat ozone multiple interactions ISO Cd3g (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CD3G mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CD3G mRNA CTD PMID:34911549 Cd3g Rat ozone increases expression ISO Cd3g (Mus musculus) 6480464 Ozone results in increased expression of CD3G mRNA CTD PMID:33026818 Cd3g Rat paracetamol increases expression ISO CD3G (Homo sapiens) 6480464 Acetaminophen results in increased expression of CD3G mRNA CTD PMID:26690555 Cd3g Rat perfluorooctane-1-sulfonic acid increases expression ISO Cd3g (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of CD3G mRNA and perfluorooctane sulfonic acid results in increased expression of CD3G protein CTD PMID:26300304 Cd3g Rat phorbol 13-acetate 12-myristate multiple interactions ISO Cd3g (Mus musculus) 6480464 Tetradecanoylphorbol Acetate inhibits the reaction [aluminum fluoride results in increased phosphorylation of CD3G protein] CTD PMID:2824607 Cd3g Rat pirinixic acid decreases expression ISO Cd3g (Mus musculus) 6480464 pirinixic acid results in decreased expression of CD3G mRNA CTD PMID:17426115 Cd3g Rat raloxifene affects expression EXP 6480464 Raloxifene Hydrochloride affects the expression of CD3G mRNA CTD PMID:16079270 Cd3g Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CD3G (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Cd3g Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO CD3G (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of CD3G mRNA CTD PMID:35811015 Cd3g Rat silicon dioxide increases expression ISO Cd3g (Mus musculus) 6480464 Silicon Dioxide results in increased expression of CD3G mRNA CTD PMID:29341224 Cd3g Rat sodium fluoride increases phosphorylation ISO Cd3g (Mus musculus) 6480464 Sodium Fluoride results in increased phosphorylation of CD3G protein CTD PMID:2824607 Cd3g Rat sodium fluoride multiple interactions ISO Cd3g (Mus musculus) 6480464 aluminum chloride promotes the reaction [Sodium Fluoride results in increased phosphorylation of CD3G protein] CTD PMID:2824607 Cd3g Rat tamibarotene decreases expression ISO Cd3g (Mus musculus) 6480464 tamibarotene results in decreased expression of CD3G mRNA CTD PMID:20861477 Cd3g Rat testosterone increases expression ISO Cd3g (Mus musculus) 6480464 Testosterone deficiency results in increased expression of CD3G mRNA CTD PMID:33848595 Cd3g Rat testosterone multiple interactions ISO Cd3g (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Cd3g Rat Theaflavin 3,3'-digallate affects expression ISO CD3G (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of CD3G mRNA CTD PMID:34925699 Cd3g Rat titanium dioxide increases expression ISO Cd3g (Mus musculus) 6480464 titanium dioxide results in increased expression of CD3G mRNA CTD PMID:23557971 Cd3g Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CD3G mRNA CTD PMID:25729387 Cd3g Rat triphenyl phosphate affects expression ISO CD3G (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CD3G mRNA CTD PMID:37042841 Cd3g Rat valproic acid decreases methylation ISO CD3G (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CD3G gene CTD PMID:29154799 Cd3g Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of CD3G mRNA CTD PMID:11717422 Cd3g Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of CD3G mRNA CTD PMID:11717422
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-trinitrobenzenesulfonic acid (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3',5'-cyclic AMP (ISO) 3,4-methylenedioxymethamphetamine (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) aflatoxin B1 (ISO) alendronic acid (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) aluminium trifluoride (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (EXP) benzene (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) calcidiol (ISO) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (ISO) chromium(6+) (ISO) cyclophosphamide (ISO) dexamethasone (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dieldrin (EXP) diethylstilbestrol (ISO) dimethyl sulfoxide (ISO) dioxygen (ISO) diuron (EXP,ISO) furan (EXP) gentamycin (EXP) hydroquinone O-beta-D-glucopyranoside (ISO) ketoconazole (ISO) kojic acid (ISO) lipopolysaccharide (ISO) methylmercury chloride (EXP) nickel atom (ISO) nickel dichloride (EXP) nitrofen (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) raloxifene (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium fluoride (ISO) tamibarotene (ISO) testosterone (ISO) Theaflavin 3,3'-digallate (ISO) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) valproic acid (ISO) zinc atom (EXP) zinc(0) (EXP)
Cd3g Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 54,177,572 - 54,184,087 (-) NCBI GRCr8 mRatBN7.2 8 45,280,797 - 45,287,271 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 45,281,204 - 45,287,147 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 50,776,665 - 50,782,763 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 49,055,387 - 49,061,489 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 46,925,945 - 46,932,045 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 49,274,553 - 49,280,943 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 49,274,960 - 49,280,901 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,892,428 - 47,898,819 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,924,369 - 47,930,550 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 47,932,753 - 47,939,309 (-) NCBI Celera 8 44,865,997 - 44,871,910 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
CD3G Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 118,344,344 - 118,355,161 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 118,344,344 - 118,355,161 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 118,215,059 - 118,225,876 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 117,720,311 - 117,729,261 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 117,720,310 - 117,729,261 NCBI Celera 11 115,372,928 - 115,382,366 (+) NCBI Celera Cytogenetic Map 11 q23.3 NCBI HuRef 11 114,148,956 - 114,158,393 (+) NCBI HuRef CHM1_1 11 118,101,492 - 118,110,943 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 118,360,702 - 118,371,519 (+) NCBI T2T-CHM13v2.0
Cd3g Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 44,880,870 - 44,891,729 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 44,880,870 - 44,891,729 (-) Ensembl GRCm39 Ensembl GRCm38 9 44,969,572 - 44,980,431 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 44,969,572 - 44,980,431 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 44,777,655 - 44,788,514 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 44,720,683 - 44,731,419 (-) NCBI MGSCv36 mm8 Celera 9 42,234,684 - 42,245,549 (-) NCBI Celera Cytogenetic Map 9 A5.2 NCBI cM Map 9 24.84 NCBI
Cd3g Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 19,486,284 - 19,494,922 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 19,486,066 - 19,496,474 (+) NCBI ChiLan1.0 ChiLan1.0
LOC100979261 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 119,036,442 - 119,056,649 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 120,141,391 - 120,161,609 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 113,179,270 - 113,190,104 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 117,111,132 - 117,120,566 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 117,111,132 - 117,120,566 (+) Ensembl panpan1.1 panPan2
CD3G Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 15,379,788 - 15,391,271 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 15,380,633 - 15,391,214 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 15,429,235 - 15,442,031 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 15,320,796 - 15,333,597 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 15,320,127 - 15,333,550 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 15,459,062 - 15,471,859 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 15,362,517 - 15,375,316 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 15,403,667 - 15,416,467 (-) NCBI UU_Cfam_GSD_1.0
Cd3g
CD3G Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 45,645,364 - 45,704,745 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 45,645,243 - 45,656,779 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 50,686,376 - 50,697,901 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CD3G Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 109,721,150 - 109,730,267 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 109,720,789 - 109,732,014 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 16,305,415 - 16,315,058 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cd3g
.
Predicted Target Of
Count of predictions: 149 Count of miRNA genes: 124 Interacting mature miRNAs: 134 Transcripts: ENSRNOT00000021390 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 5684993 Bmd84 Bone mineral density QTL 84 4.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 8 42692684 50095447 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
41
49
89
88
57
25
57
6
203
86
29
44
52
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021390 ⟹ ENSRNOP00000021390
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 45,281,204 - 45,287,147 (-) Ensembl Rnor_6.0 Ensembl 8 49,274,960 - 49,280,901 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109307 ⟹ ENSRNOP00000088440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 45,281,204 - 45,287,094 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117902 ⟹ ENSRNOP00000078789
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 45,283,654 - 45,287,147 (-) Ensembl
RefSeq Acc Id:
NM_001077646 ⟹ NP_001071114
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 54,177,977 - 54,183,918 (-) NCBI mRatBN7.2 8 45,281,204 - 45,287,147 (-) NCBI Rnor_6.0 8 49,274,960 - 49,280,901 (-) NCBI Rnor_5.0 8 47,892,428 - 47,898,819 (-) NCBI RGSC_v3.4 8 47,924,369 - 47,930,550 (-) RGD Celera 8 44,865,997 - 44,871,910 (-) RGD
Sequence:
GCCGGCTACTAAGGAACTCTCGACACTTCTACTGGAGAAGCAAAGAAACTAACATGGAGCAGGGGAAAGGTTTGGCTGGCCTCTTCCTGGTGATCTCTCTTCTTCAAGGCACCATGGCCCAGCAAAAA
hide sequence
RefSeq Acc Id:
XM_006242932 ⟹ XP_006242994
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 54,177,572 - 54,184,087 (-) NCBI mRatBN7.2 8 45,280,797 - 45,287,242 (-) NCBI Rnor_6.0 8 49,274,553 - 49,280,943 (-) NCBI Rnor_5.0 8 47,892,428 - 47,898,819 (-) NCBI
Sequence:
TGGCTGGGTGGCTGGGCGGCTGGGCGGCTGGGTGGCTGGGTGGCCGGCTACTAAGGAACTCTCGACACTTCTACTGGAGAAGCAAAGAGACTAACATGGAGCAGGGGAAGGGTTTGGCTGGCCTCTTC
hide sequence
RefSeq Acc Id:
NP_001071114 ⟸ NM_001077646
- Peptide Label:
precursor
- UniProtKB:
Q64159 (UniProtKB/Swiss-Prot), F1M9F8 (UniProtKB/TrEMBL)
- Sequence:
MEQGKGLAGLFLVISLLQGTMAQQKEEKHLVKVDDSQGDGSVLLTCDFNEKTITWLKDGHRISPPNATKSTWNLGNGAKDPRGMYQCRGAKKKSQLLQVYYRLCENCIELNMGTVSGFIFAEIISIFF
hide sequence
RefSeq Acc Id:
XP_006242994 ⟸ XM_006242932
- Peptide Label:
isoform X1
- Sequence:
MEQGKGLAGLFLVISLLQGTMAQQKQEKHLVKVDDSQGDGSVLLTCDLNEKTITWLKDGHRISP
hide sequence
Ensembl Acc Id:
ENSRNOP00000021390 ⟸ ENSRNOT00000021390
Ensembl Acc Id:
ENSRNOP00000078789 ⟸ ENSRNOT00000117902
Ensembl Acc Id:
ENSRNOP00000088440 ⟸ ENSRNOT00000109307
RGD ID: 13695906 Promoter ID: EPDNEW_R6431 Type: initiation region Name: Cd3g_1 Description: CD3g molecule SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 49,280,946 - 49,281,006 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-03-14
Cd3g
CD3 gamma subunit of T-cell receptor complex
Cd3g
CD3g molecule
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-02
Cd3g
CD3g molecule
Cd3g
CD3 molecule, gamma
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-27
Cd3g
CD3 molecule, gamma polypeptide
Cd3g
CD3 antigen, gamma polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Cd3g
CD3 antigen, gamma polypeptide
Cd3g_predicted
CD3 antigen, gamma polypeptide (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Cd3g_predicted
CD3 antigen, gamma polypeptide (predicted)
Symbol and Name status set to approved
70820 APPROVED
