Advanced Search (OLGA)

Gene: Dorip1 (dopamine receptor interacting protein 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Dorip1 (Ensembl: C6h14orf28)

Name:

dopamine receptor interacting protein 1 (Ensembl:similar to human chromosome 14 open reading frame 28)

RGD ID:

1307621

Description:

Predicted to act upstream of or within with a positive effect on NMDA selective glutamate receptor signaling pathway and cAMP-mediated signaling. Predicted to act upstream of or within several processes, including G protein-coupled dopamine receptor signaling pathway; memory; and neurogenesis. Orthologous to human DORIP1 (dopamine receptor interacting protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C6h14orf28; hypothetical LOC314168; hypothetical protein LOC314168; LOC314168; RGD1307621; similar to human chromosome 14 open reading frame 28; uncharacterized protein C14orf28 homolog; uncharacterized protein LOC314168

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	88,701,651 - 88,710,204 (+)	NCBI		GRCr8
mRatBN7.2	6	82,965,304 - 82,973,942 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	82,965,328 - 82,972,558 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	83,325,212 - 83,332,215 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	83,624,575 - 83,631,578 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	83,066,308 - 83,073,315 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	86,651,196 - 86,659,371 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	86,651,196 - 86,659,371 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	96,145,979 - 96,155,042 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	86,256,155 - 86,263,086 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	86,262,235 - 86,266,292 (+)	NCBI
Celera	6	81,533,197 - 81,540,085 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dorip1	Rat	Brain-Lung-Thyroid Syndrome		ISO	DORIP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brain-lung-thyroid syndrome	ClinVar	PMID:25741868
Dorip1	Rat	Fanconi anemia		ISO	DORIP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Fanconi anemia	ClinVar	PMID:28492532 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dorip1	Rat	(-)-demecolcine	increases expression	ISO	DORIP1 (Homo sapiens)	6480464	Demecolcine results in increased expression of DORIP1 mRNA	CTD	PMID:23649840
Dorip1	Rat	17beta-estradiol	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	Estradiol results in decreased expression of DORIP1 mRNA	CTD	PMID:31614463
Dorip1	Rat	17beta-hydroxy-5alpha-androstan-3-one	increases expression	ISO	DORIP1 (Homo sapiens)	6480464	Dihydrotestosterone results in increased expression of DORIP1 mRNA	CTD	PMID:29581250
Dorip1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of DORIP1 mRNA	CTD	PMID:32109520
Dorip1	Rat	2,3,7,8-Tetrachlorodibenzofuran	increases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Dorip1	Rat	acrylamide	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	Acrylamide results in decreased expression of DORIP1 mRNA	CTD	PMID:32763439
Dorip1	Rat	aflatoxin B1	decreases methylation	ISO	DORIP1 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of DORIP1 gene	CTD	PMID:27153756
Dorip1	Rat	aristolochic acid A	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of DORIP1 mRNA	CTD	PMID:33212167
Dorip1	Rat	benzo[a]pyrene	decreases methylation	ISO	DORIP1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of DORIP1 promoter	CTD	PMID:27901495
Dorip1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of DORIP1 gene	CTD	PMID:33872906
Dorip1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DORIP1 mRNA	CTD	PMID:25181051 more ...
Dorip1	Rat	butanal	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	butyraldehyde results in decreased expression of DORIP1 mRNA	CTD	PMID:26079696
Dorip1	Rat	copper atom	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of DORIP1 mRNA	CTD	PMID:20971185
Dorip1	Rat	copper(0)	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of DORIP1 mRNA	CTD	PMID:20971185
Dorip1	Rat	cyclosporin A	increases expression	ISO	DORIP1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of DORIP1 mRNA	CTD	PMID:20106945 more ...
Dorip1	Rat	Dibutyl phosphate	affects expression	ISO	DORIP1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of DORIP1 mRNA	CTD	PMID:37042841
Dorip1	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of DORIP1 mRNA	CTD	PMID:21266533
Dorip1	Rat	dioxygen	increases expression	ISO	DORIP1 (Homo sapiens)	6480464	Oxygen deficiency results in increased expression of DORIP1 mRNA	CTD	PMID:26516004
Dorip1	Rat	dorsomorphin	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Dorip1	Rat	ethyl methanesulfonate	increases expression	ISO	DORIP1 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of DORIP1 mRNA	CTD	PMID:23649840
Dorip1	Rat	formaldehyde	increases expression	ISO	DORIP1 (Homo sapiens)	6480464	Formaldehyde results in increased expression of DORIP1 mRNA	CTD	PMID:23649840
Dorip1	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of DORIP1 gene	CTD	PMID:22079235
Dorip1	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of DORIP1 mRNA	CTD	PMID:33387578
Dorip1	Rat	GW 1929	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	GW 1929 promotes the reaction [DORIP1 protein binds to PPARG protein]	CTD	PMID:32407875
Dorip1	Rat	iron dichloride	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	ferrous chloride results in decreased expression of DORIP1 mRNA	CTD	PMID:35984750
Dorip1	Rat	methyl methanesulfonate	increases expression	ISO	DORIP1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of DORIP1 mRNA	CTD	PMID:23649840
Dorip1	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of DORIP1 gene	CTD	PMID:33872906
Dorip1	Rat	nickel atom	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	Nickel results in decreased expression of DORIP1 mRNA	CTD	PMID:24768652 and PMID:25583101
Dorip1	Rat	p-chloromercuribenzoic acid	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	p-Chloromercuribenzoic Acid results in decreased expression of DORIP1 mRNA	CTD	PMID:26272509
Dorip1	Rat	p-chloromercuribenzoic acid	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DORIP1 mRNA	CTD	PMID:27188386
Dorip1	Rat	phenylmercury acetate	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	Phenylmercuric Acetate results in decreased expression of DORIP1 mRNA	CTD	PMID:26272509
Dorip1	Rat	phenylmercury acetate	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DORIP1 mRNA	CTD	PMID:27188386
Dorip1	Rat	potassium chloride	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	[Dronabinol results in decreased susceptibility to Potassium Chloride] which results in decreased expression of DORIP1 mRNA	CTD	PMID:29691375
Dorip1	Rat	quercetin	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	Quercetin results in decreased expression of DORIP1 mRNA	CTD	PMID:21632981
Dorip1	Rat	SB 431542	multiple interactions	ISO	DORIP1 (Homo sapiens)	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Dorip1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of DORIP1 mRNA	CTD	PMID:34492290
Dorip1	Rat	trichostatin A	increases expression	ISO	DORIP1 (Homo sapiens)	6480464	trichostatin A results in increased expression of DORIP1 mRNA	CTD	PMID:24935251
Dorip1	Rat	triphenyl phosphate	affects expression	ISO	DORIP1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of DORIP1 mRNA	CTD	PMID:37042841
Dorip1	Rat	valproic acid	decreases expression	ISO	DORIP1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of DORIP1 mRNA	CTD	PMID:23179753
Dorip1	Rat	valproic acid	affects expression	ISO	DORIP1 (Homo sapiens)	6480464	Valproic Acid affects the expression of DORIP1 mRNA	CTD	PMID:25979313
Dorip1	Rat	valproic acid	increases expression	ISO	DORIP1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of DORIP1 mRNA	CTD	PMID:24935251

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dorip1	Rat	cAMP-mediated signaling	acts_upstream_of_or_within_positive_effect	ISO	Gm527 (Mus musculus)	1624291	PMID:37248637	RGD	PMID:37248637
Dorip1	Rat	cAMP-mediated signaling	acts_upstream_of_or_within_positive_effect	IEA	UniProtKB:Q4KL13 and ensembl:ENSMUSP00000059435	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dorip1	Rat	G protein-coupled dopamine receptor signaling pathway	acts_upstream_of_or_within	ISO	Gm527 (Mus musculus)	1624291	PMID:37248637	RGD	PMID:37248637
Dorip1	Rat	G protein-coupled dopamine receptor signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:Q4KL13 and ensembl:ENSMUSP00000059435	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dorip1	Rat	gene expression	acts_upstream_of_or_within	ISO	Gm527 (Mus musculus)	1624291	PMID:37248637	RGD	PMID:37248637
Dorip1	Rat	gene expression	acts_upstream_of_or_within	IEA	UniProtKB:Q4KL13 and ensembl:ENSMUSP00000059435	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dorip1	Rat	memory	acts_upstream_of_or_within	ISO	Gm527 (Mus musculus)	1624291	PMID:37248637	RGD	PMID:37248637
Dorip1	Rat	memory	acts_upstream_of_or_within	IEA	UniProtKB:Q4KL13 and ensembl:ENSMUSP00000059435	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dorip1	Rat	neurogenesis	acts_upstream_of_or_within	ISO	Gm527 (Mus musculus)	1624291	PMID:37248637	RGD	PMID:37248637
Dorip1	Rat	neurogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q4KL13 and ensembl:ENSMUSP00000059435	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dorip1	Rat	NMDA selective glutamate receptor signaling pathway	acts_upstream_of_or_within_positive_effect	ISO	Gm527 (Mus musculus)	1624291	PMID:37248637	RGD	PMID:37248637
Dorip1	Rat	NMDA selective glutamate receptor signaling pathway	acts_upstream_of_or_within_positive_effect	IEA	UniProtKB:Q4KL13 and ensembl:ENSMUSP00000059435	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Dorip1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	88,701,651 - 88,710,204 (+)	NCBI		GRCr8
mRatBN7.2	6	82,965,304 - 82,973,942 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	82,965,328 - 82,972,558 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	83,325,212 - 83,332,215 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	83,624,575 - 83,631,578 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	83,066,308 - 83,073,315 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	86,651,196 - 86,659,371 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	86,651,196 - 86,659,371 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	96,145,979 - 96,155,042 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	86,256,155 - 86,263,086 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	86,262,235 - 86,266,292 (+)	NCBI
Celera	6	81,533,197 - 81,540,085 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

DORIP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	44,897,275 - 44,907,257 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	44,897,275 - 44,907,257 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	45,366,478 - 45,376,460 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	44,436,257 - 44,446,210 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	14	25,227,762 - 25,237,715 (+)	NCBI		Celera
Cytogenetic Map	14	q21.2	NCBI
HuRef	14	25,477,418 - 25,487,371 (+)	NCBI		HuRef
CHM1_1	14	45,304,736 - 45,314,689 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	39,089,234 - 39,099,216 (+)	NCBI		T2T-CHM13v2.0

Gm527
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	64,964,685 - 64,971,365 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	64,964,680 - 64,971,366 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	64,917,911 - 64,924,591 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	64,917,906 - 64,924,592 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	66,018,898 - 66,025,578 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	65,836,516 - 65,843,196 (+)	NCBI		MGSCv36	mm8
Celera	12	66,050,413 - 66,054,197 (+)	NCBI		Celera
Cytogenetic Map	12	C1	NCBI
cM Map	12	27.21	NCBI

Dorip1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	17,012,125 - 17,024,784 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	17,014,194 - 17,023,953 (-)	NCBI	ChiLan1.0	ChiLan1.0

DORIP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	46,070,659 - 46,080,698 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	45,287,154 - 45,297,194 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	25,514,741 - 25,524,710 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	43,843,018 - 43,852,917 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	43,843,018 - 43,852,917 (+)	Ensembl	panpan1.1		panPan2

C8H14orf28
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	22,366,822 - 22,378,411 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	22,369,790 - 22,375,025 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	22,184,834 - 22,196,392 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	22,525,913 - 22,537,473 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	22,526,893 - 22,535,764 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	22,188,391 - 22,199,954 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	22,254,701 - 22,266,253 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	22,590,803 - 22,602,360 (+)	NCBI		UU_Cfam_GSD_1.0

Dorip1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	54,323,411 - 54,333,350 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936583	4,355,492 - 4,363,107 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936583	4,355,562 - 4,365,470 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C1H14orf28
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	175,145,913 - 175,156,606 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	175,145,918 - 175,156,597 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	194,910,933 - 194,921,563 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DORIP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	22,015,251 - 22,026,008 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	22,015,206 - 22,026,001 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666116	513,820 - 524,488 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dorip1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624731	23,595,490 - 23,605,374 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Dorip1
27 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	114
Count of miRNA genes:	95
Interacting mature miRNAs:	104
Transcripts:	ENSRNOT00000034756
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590290	Uminl2	Urine mineral level QTL 2	3.96	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	6	38783989	83783989	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
9590140	Scort4	Serum corticosterone level QTL 4	14.49	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	38783989	83783989	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
9590306	Scort18	Serum corticosterone level QTL 18	2.88	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	38783989	83783989	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
4889848	Pur25	Proteinuria QTL 25	14	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	56728562	90198260	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001108025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005505516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000034756 ⟹ ENSRNOP00000035231

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	82,965,556 - 82,972,558 (+)	Ensembl
Rnor_6.0 Ensembl	6	86,651,196 - 86,659,371 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101605 ⟹ ENSRNOP00000096306

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	82,965,328 - 82,972,558 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107979 ⟹ ENSRNOP00000081303

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	82,968,274 - 82,972,558 (+)	Ensembl

RefSeq Acc Id:

NM_001108025 ⟹ NP_001101495

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	88,701,818 - 88,708,820 (+)	NCBI
mRatBN7.2	6	82,965,556 - 82,972,558 (+)	NCBI
Rnor_6.0	6	86,651,196 - 86,659,371 (+)	NCBI
Rnor_5.0	6	96,145,979 - 96,155,042 (+)	NCBI
RGSC_v3.4	6	86,256,155 - 86,263,086 (+)	RGD
Celera	6	81,533,197 - 81,540,085 (+)	RGD

Sequence:

show sequence

GGCGGCGGCGGCCCGGGCTCTCCATGAGCGAGCGGCGGCGGCGACGGGTGCGGCGGCACCGGCGGTCTTCGGTCCCGCGGGAGGATGAAGACACTGTTTGAAGAGATCAAAGCATCAATTAAAAATAA
CTATAACCAAGATCGATCATTTTGGAGGCCTGTTCTTCCTTGGGGAGGAGTTTTTACTATCAAAGCTGGCCGCAAAGCAGTATCCTGTACACCCCTCTATGTTGAGATCAGACTGAAAAATACCTGCA
CCATAGATGGATTCTTGATGTTACTGTATGTCATTCTTAATGAGAACGACAACTTCCCCAGGGAACTCTCTCTGCATTTTGGCAGGGAGTTTGTCGACTGTTTTCTTTATTTAATGGACACCTACAGT
TTTACAACTGTGAAGCTGCTTTGGATTTGGGACAAGATGGAAAAACAGCAATACAAATCTGAAGTTCATAAAGCTTCCTTAGTAATTGATTTGTTTGGGAACGAGCATGATAATTTTACCAAAAATCT
TGAAAATCTTATGTCTACCATTCAAGAGAGTTACTGTTCTAACTGGCGCTGCCCTACCCGAGTGCAGGAAGATCAGCAGCGCACAATTAGTATAAATCCTCCCCAAGAAATTCCTCATGGAAACTTGA
TACGACTGGCTGTGGATGAGTTATTCTGTTCCAAGATTGAACTTTGTGAAGAGCGTGGGTGTGGTGGCTTAAGAGAATTTTCCCAACGAGTTTTCTGCCACGGGGCACCCCCTTTTGTTGTGTTAAAT
ATGCAGCATTGGAAATCTGAAGATCTGGCATACGTACCCTATTATTTGGATTTATCTGATCACAAATATTTGCTGGAAGGTGCCACTTTATTTAACAAAGAGGAACACCATTACTCTGCAGCTTTCCA
GATCGACGGACATTGGATGCACTATGATGGCCTCAGAAATGTGAATTTAATTTTGTTAAATAAACCCCCAGAGTTTCTCCTCTTGTCATCATTGGTTTATATTCGAGCAACAGAGAAATAAATATAGA
CTGATGCTGAATTAAATTGTTCTCCCGCCTGCCCGTGCTCCCCAGAGGAAGGGCTCTTGTTCTGTATATACTTGGTATCCAAGGAGACAGTTCAACTATACTAGTTTCAGAGATGGATTTTTCATTGT
TTTGCCCCAGGTAAATGTTTTATATGGACGATCTATGCAAAAATGTATTTTTAAAGTATTTTCTGGGTTATTTTTATACAAGCATATGTTAAGTTCAAATAAAATGTATCTCGTG

hide sequence

RefSeq Acc Id:

XM_039112242 ⟹ XP_038968170

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	88,701,651 - 88,710,204 (+)	NCBI
mRatBN7.2	6	82,965,308 - 82,973,942 (+)	NCBI

RefSeq Acc Id:

XM_039112243 ⟹ XP_038968171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	88,702,044 - 88,710,204 (+)	NCBI
mRatBN7.2	6	82,965,745 - 82,973,942 (+)	NCBI

RefSeq Acc Id:

XM_039112244 ⟹ XP_038968172

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	88,701,651 - 88,707,727 (+)	NCBI
mRatBN7.2	6	82,965,304 - 82,971,465 (+)	NCBI

RefSeq Acc Id:

XR_005505516

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	88,701,651 - 88,707,727 (+)	NCBI
mRatBN7.2	6	82,965,304 - 82,971,468 (+)	NCBI


Protein RefSeqs	NP_001101495	(Get FASTA)	NCBI Sequence Viewer
	XP_038968170	(Get FASTA)	NCBI Sequence Viewer
	XP_038968171	(Get FASTA)	NCBI Sequence Viewer
	XP_038968172	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM03480	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035231
	ENSRNOP00000035231.7
	ENSRNOP00000081303.1
	ENSRNOP00000096306
	ENSRNOP00000096306.1

RefSeq Acc Id:

NP_001101495 ⟸ NM_001108025

- UniProtKB:

D4A3H4 (UniProtKB/TrEMBL), A6HBS5 (UniProtKB/TrEMBL), A0A8I5ZS88 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKTLFEEIKASIKNNYNQDRSFWRPVLPWGGVFTIKAGRKAVSCTPLYVEIRLKNTCTIDGFLMLLYVILNENDNFPRELSLHFGREFVDCFLYLMDTYSFTTVKLLWIWDKMEKQQYKSEVHKASLV
IDLFGNEHDNFTKNLENLMSTIQESYCSNWRCPTRVQEDQQRTISINPPQEIPHGNLIRLAVDELFCSKIELCEERGCGGLREFSQRVFCHGAPPFVVLNMQHWKSEDLAYVPYYLDLSDHKYLLEGA
TLFNKEEHHYSAAFQIDGHWMHYDGLRNVNLILLNKPPEFLLLSSLVYIRATEK

hide sequence

Ensembl Acc Id:

ENSRNOP00000035231 ⟸ ENSRNOT00000034756

RefSeq Acc Id:	XP_038968172 ⟸ XM_039112244
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038968170 ⟸ XM_039112242
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AS79 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038968171 ⟸ XM_039112243
- Peptide Label:	isoform X2
- UniProtKB:	D4A3H4 (UniProtKB/TrEMBL), A6HBS5 (UniProtKB/TrEMBL), A0A8I5ZS88 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A3H4-F1-model_v2	AlphaFold	D4A3H4	1-309	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-37334	BioCyc
Ensembl Genes	ENSRNOG00000023230	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000034756	ENTREZGENE
	ENSRNOT00000034756.7	UniProtKB/TrEMBL
	ENSRNOT00000101605	ENTREZGENE
	ENSRNOT00000101605.1	UniProtKB/TrEMBL
	ENSRNOT00000107979.1	UniProtKB/TrEMBL
InterPro	C14orf28-like	UniProtKB/TrEMBL
KEGG Report	rno:314168	UniProtKB/TrEMBL
NCBI Gene	314168	ENTREZGENE
PANTHER	HYPOTHETICAL LOC314168	UniProtKB/TrEMBL
	PTHR35350	UniProtKB/TrEMBL
PhenoGen	Dorip1	PhenoGen
RatGTEx	ENSRNOG00000023230	RatGTEx
UniProt	A0A8I5ZS88	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AS79	ENTREZGENE, UniProtKB/TrEMBL
	A6HBS5	ENTREZGENE, UniProtKB/TrEMBL
	D4A3H4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-01-08	Dorip1	dopamine receptor interacting protein 1	C6h14orf28	similar to human chromosome 14 open reading frame 28	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2023-09-19	C6h14orf28	similar to human chromosome 14 open reading frame 28	RGD1307621	hypothetical LOC314168	Symbol and Name Changed	1299863	APPROVED
2008-04-30	RGD1307621	hypothetical LOC314168	RGD1307621_predicted	hypothetical LOC314168 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1307621_predicted	hypothetical LOC314168 (predicted)	LOC314168_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC314168_predicted	hypothetical LOC314168 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar