Symbol:
Nudcd2
Name:
NudC domain containing 2
RGD ID:
1307203
Description:
Predicted to enable unfolded protein binding activity. Predicted to be involved in protein folding. Predicted to be located in cytosol; intercellular bridge; and mitotic spindle. Predicted to be active in cytoplasm. Orthologous to human NUDCD2 (NudC domain containing 2); INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
hypothetical LOC287199; LOC287199; MGC109498; nudC domain-containing protein 2; RGD1307203
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 25,665,493 - 25,671,010 (+) NCBI GRCr8 mRatBN7.2 10 25,163,247 - 25,168,738 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 25,163,220 - 25,168,738 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 29,925,615 - 29,931,099 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 29,414,142 - 29,419,626 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 24,900,803 - 24,906,287 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 25,890,943 - 25,896,432 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 25,890,943 - 25,896,432 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 25,741,115 - 25,746,616 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 25,763,129 - 25,768,887 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 25,764,177 - 25,769,934 (+) NCBI Celera 10 24,722,652 - 24,728,139 (+) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nudcd2 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1551612 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NUDCD2 mRNA CTD PMID:36331819 Nudcd2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1551612 6480464 Tetrachlorodibenzodioxin affects the expression of NUDCD2 mRNA CTD PMID:21570461 Nudcd2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of NUDCD2 mRNA CTD PMID:21346803 Nudcd2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of NUDCD2 mRNA CTD PMID:21346803 Nudcd2 Rat 2-acetamidofluorene increases expression ISO RGD:1551612 6480464 2-Acetylaminofluorene results in increased expression of NUDCD2 mRNA CTD PMID:21607683 Nudcd2 Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1353286 6480464 Lactic Acid results in decreased expression of NUDCD2 mRNA CTD PMID:30851411 Nudcd2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1353286 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Nudcd2 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1551612 6480464 bisphenol S results in increased expression of NUDCD2 mRNA CTD PMID:39298647 Nudcd2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NUDCD2 mRNA CTD PMID:30047161 Nudcd2 Rat aflatoxin B1 increases expression ISO RGD:1551612 6480464 Aflatoxin B1 results in increased expression of NUDCD2 mRNA CTD PMID:19770486 Nudcd2 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of NUDCD2 mRNA CTD PMID:33354967 Nudcd2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of NUDCD2 mRNA CTD PMID:35163327 Nudcd2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of NUDCD2 mRNA CTD PMID:30047161 Nudcd2 Rat benzo[a]pyrene increases expression ISO RGD:1551612 6480464 Benzo(a)pyrene results in increased expression of NUDCD2 mRNA CTD PMID:19770486|PMID:22228805 Nudcd2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1353286 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of NUDCD2 mRNA CTD PMID:20018196 Nudcd2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NUDCD2 mRNA CTD PMID:25181051 Nudcd2 Rat bisphenol A decreases expression ISO RGD:1353286 6480464 bisphenol A results in decreased expression of NUDCD2 protein CTD PMID:33376534 Nudcd2 Rat bisphenol A multiple interactions ISO RGD:1353286 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Nudcd2 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of NUDCD2 promoter CTD PMID:22457795 Nudcd2 Rat carbon nanotube increases expression ISO RGD:1551612 6480464 Nanotubes, Carbon analog results in increased expression of NUDCD2 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Nudcd2 Rat chromium(6+) affects expression ISO RGD:1551612 6480464 chromium hexavalent ion affects the expression of NUDCD2 mRNA CTD PMID:28472532 Nudcd2 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of NUDCD2 mRNA CTD PMID:30047161 Nudcd2 Rat copper(II) sulfate decreases expression ISO RGD:1353286 6480464 Copper Sulfate results in decreased expression of NUDCD2 mRNA CTD PMID:19549813 Nudcd2 Rat cyclosporin A decreases expression ISO RGD:1353286 6480464 Cyclosporine results in decreased expression of NUDCD2 mRNA CTD PMID:25562108 Nudcd2 Rat dexamethasone multiple interactions ISO RGD:1353286 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Nudcd2 Rat dicrotophos decreases expression ISO RGD:1353286 6480464 dicrotophos results in decreased expression of NUDCD2 mRNA CTD PMID:28302478 Nudcd2 Rat ethanol affects expression ISO RGD:1551612 6480464 Ethanol affects the expression of NUDCD2 mRNA CTD PMID:30319688 Nudcd2 Rat formaldehyde decreases expression ISO RGD:1353286 6480464 Formaldehyde results in decreased expression of NUDCD2 mRNA CTD PMID:23649840 Nudcd2 Rat indometacin multiple interactions ISO RGD:1353286 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Nudcd2 Rat inulin multiple interactions ISO RGD:1551612 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of NUDCD2 mRNA CTD PMID:36331819 Nudcd2 Rat ivermectin decreases expression ISO RGD:1353286 6480464 Ivermectin results in decreased expression of NUDCD2 protein CTD PMID:32959892 Nudcd2 Rat kainic acid increases expression ISO RGD:1551612 6480464 Kainic Acid results in increased expression of NUDCD2 mRNA CTD PMID:17997037 Nudcd2 Rat menadione affects expression ISO RGD:1353286 6480464 Vitamin K 3 affects the expression of NUDCD2 mRNA CTD PMID:20044591 Nudcd2 Rat methyl methanesulfonate decreases expression ISO RGD:1353286 6480464 Methyl Methanesulfonate results in decreased expression of NUDCD2 mRNA CTD PMID:23649840 Nudcd2 Rat N-nitrosodiethylamine increases expression ISO RGD:1551612 6480464 Diethylnitrosamine results in increased expression of NUDCD2 mRNA CTD PMID:21607683 Nudcd2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NUDCD2 mRNA CTD PMID:25729387 Nudcd2 Rat paracetamol affects expression ISO RGD:1551612 6480464 Acetaminophen affects the expression of NUDCD2 mRNA CTD PMID:17562736 Nudcd2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1551612 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NUDCD2 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Nudcd2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of NUDCD2 mRNA CTD PMID:35163327 Nudcd2 Rat quercetin decreases expression ISO RGD:1353286 6480464 Quercetin results in decreased expression of NUDCD2 mRNA CTD PMID:21632981 Nudcd2 Rat rac-lactic acid decreases expression ISO RGD:1353286 6480464 Lactic Acid results in decreased expression of NUDCD2 mRNA CTD PMID:30851411 Nudcd2 Rat resveratrol increases expression ISO RGD:1551612 6480464 resveratrol results in increased expression of NUDCD2 protein CTD PMID:25505154 Nudcd2 Rat resveratrol multiple interactions ISO RGD:1353286 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of NUDCD2 mRNA CTD PMID:23557933 Nudcd2 Rat SB 431542 multiple interactions ISO RGD:1353286 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of NUDCD2 more ... CTD PMID:37664457 Nudcd2 Rat sodium arsenite decreases expression ISO RGD:1353286 6480464 sodium arsenite results in decreased expression of NUDCD2 mRNA CTD PMID:38568856 Nudcd2 Rat sunitinib decreases expression ISO RGD:1353286 6480464 Sunitinib results in decreased expression of NUDCD2 mRNA CTD PMID:31533062 Nudcd2 Rat temozolomide increases expression ISO RGD:1353286 6480464 Temozolomide results in increased expression of NUDCD2 mRNA CTD PMID:31758290 Nudcd2 Rat tetrachloromethane increases expression ISO RGD:1551612 6480464 Carbon Tetrachloride results in increased expression of NUDCD2 mRNA CTD PMID:31919559 Nudcd2 Rat thiram decreases expression ISO RGD:1353286 6480464 Thiram results in decreased expression of NUDCD2 mRNA CTD PMID:38568856 Nudcd2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NUDCD2 mRNA CTD PMID:25729387 Nudcd2 Rat trimellitic anhydride increases expression ISO RGD:1551612 6480464 trimellitic anhydride results in increased expression of NUDCD2 mRNA CTD PMID:19042947 Nudcd2 Rat tungsten increases expression ISO RGD:1551612 6480464 Tungsten results in increased expression of NUDCD2 mRNA CTD PMID:30912803 Nudcd2 Rat valproic acid affects expression ISO RGD:1551612 6480464 Valproic Acid affects the expression of NUDCD2 mRNA CTD PMID:17292431|PMID:17963808 Nudcd2 Rat valproic acid affects expression ISO RGD:1353286 6480464 Valproic Acid affects the expression of NUDCD2 mRNA CTD PMID:25979313 Nudcd2 Rat zearalenone decreases expression ISO RGD:1551612 6480464 Zearalenone results in decreased expression of NUDCD2 protein CTD PMID:36252740
Nudcd2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 25,665,493 - 25,671,010 (+) NCBI GRCr8 mRatBN7.2 10 25,163,247 - 25,168,738 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 25,163,220 - 25,168,738 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 29,925,615 - 29,931,099 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 29,414,142 - 29,419,626 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 24,900,803 - 24,906,287 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 25,890,943 - 25,896,432 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 25,890,943 - 25,896,432 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 25,741,115 - 25,746,616 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 25,763,129 - 25,768,887 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 25,764,177 - 25,769,934 (+) NCBI Celera 10 24,722,652 - 24,728,139 (+) NCBI Celera Cytogenetic Map 10 q12 NCBI
NUDCD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 163,446,526 - 163,460,102 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 163,446,526 - 163,460,404 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 162,873,532 - 162,887,108 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 162,813,164 - 162,819,721 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 162,813,164 - 162,819,721 NCBI Celera 5 158,914,701 - 158,921,251 (-) NCBI Celera Cytogenetic Map 5 q34 NCBI HuRef 5 157,980,278 - 157,986,828 (-) NCBI HuRef CHM1_1 5 162,313,053 - 162,319,610 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 163,981,702 - 163,995,279 (-) NCBI T2T-CHM13v2.0
Nudcd2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 40,624,485 - 40,630,873 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 40,624,494 - 40,630,873 (+) Ensembl GRCm39 Ensembl GRCm38 11 40,733,645 - 40,740,046 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 40,733,667 - 40,740,046 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 40,547,144 - 40,553,548 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 40,577,091 - 40,583,467 (+) NCBI MGSCv36 mm8 Celera 11 44,585,696 - 44,592,094 (+) NCBI Celera Cytogenetic Map 11 A5 NCBI cM Map 11 24.41 NCBI
Nudcd2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955408 16,858,635 - 16,864,617 (-) NCBI ChiLan1.0 ChiLan1.0
NUDCD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 158,622,395 - 158,633,296 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 156,763,567 - 156,772,842 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 158,824,457 - 158,837,185 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 165,607,045 - 165,613,947 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 165,607,128 - 165,613,954 (-) Ensembl panpan1.1 panPan2
NUDCD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 47,787,146 - 47,793,325 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 47,787,371 - 47,793,323 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 47,680,315 - 47,686,411 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 48,218,104 - 48,224,233 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 48,218,321 - 48,228,997 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 48,001,281 - 48,007,403 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 48,159,565 - 48,165,651 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 48,679,386 - 48,685,536 (+) NCBI UU_Cfam_GSD_1.0
Nudcd2
NUDCD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 60,332,492 - 60,346,593 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 60,332,140 - 60,341,722 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 65,172,608 - 65,181,588 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NUDCD2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 65,725,141 - 65,732,228 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 65,721,753 - 65,732,323 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666574 37,804 - 44,852 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nudcd2
.
Predicted Target Of
Count of predictions: 81 Count of miRNA genes: 53 Interacting mature miRNAs: 64 Transcripts: ENSRNOT00000004339 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 631531 Iresp2 Immunoglobin response QTL2 6.3 blood immunoglobulin E amount (VT:0002492) serum immunoglobulin E level (CMO:0002101) 10 22918268 36400810 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat
RH138187
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 14,992,388 - 14,992,585 (+) Marker Load Pipeline mRatBN7.2 7 14,290,207 - 14,290,404 (+) MAPPER mRatBN7.2 Rnor_6.0 7 18,366,810 - 18,367,006 NCBI Rnor6.0 Rnor_5.0 7 18,544,410 - 18,544,606 UniSTS Rnor5.0 RGSC_v3.4 7 16,000,806 - 16,001,002 UniSTS RGSC3.4 Celera 7 13,189,554 - 13,189,750 UniSTS RH 3.4 Map 7 97.82 UniSTS Cytogenetic Map 10 q12 UniSTS
BE098866
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 25,168,262 - 25,168,457 (+) MAPPER mRatBN7.2 Rnor_6.0 10 25,895,957 - 25,896,151 NCBI Rnor6.0 Rnor_5.0 10 25,746,141 - 25,746,335 UniSTS Rnor5.0 Celera 10 24,727,664 - 24,727,858 UniSTS RH 3.4 Map 10 278.4 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000086814 ⟹ ENSRNOP00000069725
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 25,163,220 - 25,168,738 (+) Ensembl Rnor_6.0 Ensembl 10 25,890,943 - 25,896,432 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111631 ⟹ ENSRNOP00000077894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 25,163,242 - 25,168,736 (+) Ensembl
RefSeq Acc Id:
NM_001009621 ⟹ NP_001009621
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 25,665,519 - 25,671,010 (+) NCBI mRatBN7.2 10 25,163,247 - 25,168,738 (+) NCBI Rnor_6.0 10 25,890,943 - 25,896,432 (+) NCBI Rnor_5.0 10 25,741,115 - 25,746,616 (+) NCBI RGSC_v3.4 10 25,763,129 - 25,768,887 (+) RGD Celera 10 24,722,652 - 24,728,139 (+) RGD
Sequence:
GAATTTTGGCGTCACACAGATTAAAAGATCGCCGGCACTTGTCTCCTTTGTTCCAGCGTCAGCGTTCTTGGGATGTCAACAACTCTAGGCTGCCGGTTTTTCCCACCAGGTCTCGCGAGTGTCTTAAA
hide sequence
RefSeq Acc Id:
XM_039085371 ⟹ XP_038941299
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 25,665,493 - 25,671,010 (+) NCBI mRatBN7.2 10 25,163,681 - 25,168,738 (+) NCBI
RefSeq Acc Id:
NP_001009621 ⟸ NM_001009621
- UniProtKB:
Q5M823 (UniProtKB/Swiss-Prot), A6HDK8 (UniProtKB/TrEMBL), A0A8L2R1N7 (UniProtKB/TrEMBL)
- Sequence:
MSAPFEERSGVVPCATPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALAVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000069725 ⟸ ENSRNOT00000086814
RefSeq Acc Id:
XP_038941299 ⟸ XM_039085371
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000077894 ⟸ ENSRNOT00000111631
RGD ID: 13697107 Promoter ID: EPDNEW_R7632 Type: initiation region Name: Nudcd2_1 Description: NudC domain containing 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R7633 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 25,890,933 - 25,890,993 EPDNEW
RGD ID: 13697108 Promoter ID: EPDNEW_R7633 Type: initiation region Name: Nudcd2_2 Description: NudC domain containing 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R7632 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 25,891,185 - 25,891,245 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Nudcd2
NudC domain containing 2
RGD1307203
hypothetical LOC287199
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1307203
hypothetical LOC287199
RGD1307203_predicted
hypothetical LOC287199 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1307203_predicted
hypothetical LOC287199 (predicted)
LOC287199_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC287199_predicted
hypothetical LOC287199 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
