Advanced Search (OLGA)

Gene: Cbarp (CACN subunit beta associated regulatory protein) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cbarp

Name:

CACN subunit beta associated regulatory protein

RGD ID:

1307185

Description:

Predicted to enable transmembrane transporter binding activity. Involved in negative regulation of voltage-gated calcium channel activity. Located in secretory granule. Orthologous to human CBARP (CACN subunit beta associated regulatory protein); INTERACTS WITH 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CACN beta subunit associated regulatory protein; calcium channel, voltage-dependent, beta subunit associated regulatory protein; Dos; downstream of Stk11; LOC314622; MGC189449

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,217,314 - 10,225,855 (+)	NCBI		GRCr8
mRatBN7.2	7	9,566,637 - 9,575,204 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	9,566,364 - 9,575,204 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	12,449,657 - 12,458,156 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,324,996 - 14,333,495 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,186,091 - 12,194,592 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,433,422 - 12,441,048 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,433,933 - 12,441,048 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	12,603,527 - 12,611,153 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	11,079,431 - 11,087,057 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	11,079,064 - 11,086,662 (+)	NCBI
Celera	7	7,743,241 - 7,750,842 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cbarp	Rat	cerebral creatine deficiency syndrome		ISO	CBARP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cerebral creatine deficiency syndrome	ClinVar	PMID:15108290 and PMID:28492532
Cbarp	Rat	cyclic hematopoiesis		ISO	CBARP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cyclical neutropenia	ClinVar	PMID:28492532
Cbarp	Rat	Peutz-Jeghers syndrome		ISO	CBARP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Peutz-Jeghers syndrome	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cbarp	Rat	1,2-dimethylhydrazine	increases expression	ISO	Cbarp (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of DOS mRNA	CTD	PMID:22206623
Cbarp	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Cbarp (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CBARP mRNA	CTD	PMID:22206623
Cbarp	Rat	17alpha-ethynylestradiol	decreases expression	EXP		6480464	Ethinyl Estradiol results in decreased expression of CBARP mRNA	CTD	PMID:17557909
Cbarp	Rat	17beta-estradiol	increases expression	ISO	CBARP (Homo sapiens)	6480464	Estradiol results in increased expression of CBARP mRNA	CTD	PMID:31614463
Cbarp	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2 more ...	CTD	PMID:27291303
Cbarp	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Cbarp (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of CBARP mRNA	CTD	PMID:19933214
Cbarp	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of CBARP mRNA	CTD	PMID:33387578
Cbarp	Rat	3,3',5,5'-tetrabromobisphenol A	increases expression	ISO	Cbarp (Mus musculus)	6480464	tetrabromobisphenol A results in increased expression of CBARP mRNA	CTD	PMID:25172293
Cbarp	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	Cbarp (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CBARP mRNA	CTD	PMID:20188158
Cbarp	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	CBARP (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CBARP mRNA	CTD	PMID:28628672
Cbarp	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	Cbarp (Mus musculus)	6480464	bisphenol S results in decreased methylation of CBARP exon	CTD	PMID:33297965
Cbarp	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Cbarp (Mus musculus)	6480464	bisphenol S affects the methylation of CBARP gene	CTD	PMID:31683443
Cbarp	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2 and 6-dinitrotoluene affects the expression of CBARP mRNA	CTD	PMID:21346803
Cbarp	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Cbarp (Mus musculus)	6480464	Fenretinide results in increased expression of CBARP mRNA	CTD	PMID:28973697
Cbarp	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of CBARP mRNA	CTD	PMID:31881176
Cbarp	Rat	aflatoxin B1	increases expression	ISO	Cbarp (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of CBARP mRNA	CTD	PMID:19770486
Cbarp	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CBARP mRNA	CTD	PMID:35163327
Cbarp	Rat	benzo[a]pyrene	increases methylation	ISO	CBARP (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of CBARP promoter	CTD	PMID:27901495
Cbarp	Rat	beta-lapachone	increases expression	ISO	CBARP (Homo sapiens)	6480464	beta-lapachone results in increased expression of CBARP mRNA	CTD	PMID:38218311
Cbarp	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of CBARP mRNA	CTD	PMID:25181051
Cbarp	Rat	bisphenol A	multiple interactions	ISO	CBARP (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CBARP mRNA	CTD	PMID:28628672
Cbarp	Rat	bisphenol F	decreases expression	ISO	Cbarp (Mus musculus)	6480464	bisphenol F results in decreased expression of CBARP mRNA	CTD	PMID:38685157
Cbarp	Rat	cadmium atom	multiple interactions	ISO	CBARP (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CBARP mRNA	CTD	PMID:35301059
Cbarp	Rat	cadmium dichloride	multiple interactions	ISO	CBARP (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CBARP mRNA	CTD	PMID:35301059
Cbarp	Rat	caffeine	affects phosphorylation	ISO	CBARP (Homo sapiens)	6480464	Caffeine affects the phosphorylation of CBARP protein	CTD	PMID:35688186
Cbarp	Rat	carbon nanotube	decreases expression	ISO	Cbarp (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Cbarp	Rat	chloroprene	increases expression	ISO	Cbarp (Mus musculus)	6480464	Chloroprene results in increased expression of CBARP mRNA	CTD	PMID:23125180
Cbarp	Rat	chlorpyrifos	increases expression	ISO	Cbarp (Mus musculus)	6480464	Chlorpyrifos results in increased expression of CBARP mRNA	CTD	PMID:37019170
Cbarp	Rat	choline	multiple interactions	ISO	Cbarp (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CBARP gene	CTD	PMID:20938992
Cbarp	Rat	cisplatin	decreases expression	ISO	CBARP (Homo sapiens)	6480464	Cisplatin results in decreased expression of CBARP mRNA	CTD	PMID:27392435
Cbarp	Rat	coumarin	decreases phosphorylation	ISO	CBARP (Homo sapiens)	6480464	coumarin results in decreased phosphorylation of CBARP protein	CTD	PMID:35688186
Cbarp	Rat	cyclosporin A	decreases methylation	ISO	CBARP (Homo sapiens)	6480464	Cyclosporine results in decreased methylation of CBARP promoter	CTD	PMID:27989131
Cbarp	Rat	dexamethasone	multiple interactions	ISO	CBARP (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CBARP mRNA	CTD	PMID:28628672
Cbarp	Rat	dicrotophos	increases expression	ISO	CBARP (Homo sapiens)	6480464	dicrotophos results in increased expression of CBARP mRNA	CTD	PMID:28302478
Cbarp	Rat	dioxygen	multiple interactions	EXP		6480464	[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of CBARP mRNA	CTD	PMID:33729688
Cbarp	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of CBARP mRNA	CTD	PMID:29391264
Cbarp	Rat	ethanol	increases expression	ISO	Cbarp (Mus musculus)	6480464	Ethanol results in increased expression of CBARP mRNA	CTD	PMID:30319688
Cbarp	Rat	ethanol	affects expression	ISO	Cbarp (Mus musculus)	6480464	Ethanol affects the expression of DOS mRNA	CTD	PMID:30319688
Cbarp	Rat	ethanol	affects splicing	ISO	Cbarp (Mus musculus)	6480464	Ethanol affects the splicing of CBARP mRNA	CTD	PMID:30319688
Cbarp	Rat	folic acid	multiple interactions	ISO	Cbarp (Mus musculus)	6480464	[1 more ...	CTD	PMID:20938992 and PMID:22206623
Cbarp	Rat	FR900359	increases phosphorylation	ISO	CBARP (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of CBARP protein	CTD	PMID:37730182
Cbarp	Rat	indometacin	multiple interactions	ISO	CBARP (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CBARP mRNA	CTD	PMID:28628672
Cbarp	Rat	L-methionine	multiple interactions	ISO	Cbarp (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CBARP gene	CTD	PMID:20938992
Cbarp	Rat	Licochalcone B	increases expression	ISO	CBARP (Homo sapiens)	6480464	licochalcone B results in increased expression of CBARP mRNA	CTD	PMID:33647349
Cbarp	Rat	manganese(II) chloride	increases expression	EXP		6480464	manganese chloride results in increased expression of DOS mRNA	CTD	PMID:28801915
Cbarp	Rat	N-nitrosodiethylamine	multiple interactions	ISO	Cbarp (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of CBARP gene	CTD	PMID:23968726
Cbarp	Rat	O-methyleugenol	decreases expression	ISO	CBARP (Homo sapiens)	6480464	methyleugenol results in decreased expression of CBARP mRNA	CTD	PMID:32234424
Cbarp	Rat	okadaic acid	increases expression	ISO	CBARP (Homo sapiens)	6480464	Okadaic Acid results in increased expression of CBARP mRNA	CTD	PMID:38832940
Cbarp	Rat	ozone	multiple interactions	ISO	Cbarp (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CBARP mRNA	CTD	PMID:34911549
Cbarp	Rat	paracetamol	affects expression	ISO	Cbarp (Mus musculus)	6480464	Acetaminophen affects the expression of CBARP mRNA	CTD	PMID:17562736
Cbarp	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of CBARP mRNA	CTD	PMID:33387578
Cbarp	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Cbarp (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of CBARP mRNA	CTD	PMID:36331819
Cbarp	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CBARP mRNA	CTD	PMID:35163327
Cbarp	Rat	perfluorooctanoic acid	increases expression	ISO	CBARP (Homo sapiens)	6480464	perfluorooctanoic acid results in increased expression of CBARP mRNA	CTD	PMID:37738295
Cbarp	Rat	piperonyl butoxide	multiple interactions	ISO	Cbarp (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of CBARP gene	CTD	PMID:23968726
Cbarp	Rat	resveratrol	multiple interactions	ISO	CBARP (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of CBARP mRNA	CTD	PMID:23557933
Cbarp	Rat	sodium arsenite	increases expression	ISO	CBARP (Homo sapiens)	6480464	sodium arsenite results in increased expression of CBARP mRNA	CTD	PMID:38568856
Cbarp	Rat	sunitinib	increases expression	ISO	CBARP (Homo sapiens)	6480464	Sunitinib results in increased expression of CBARP mRNA	CTD	PMID:31533062
Cbarp	Rat	testosterone	increases expression	ISO	Cbarp (Mus musculus)	6480464	Testosterone deficiency results in increased expression of CBARP mRNA	CTD	PMID:33848595
Cbarp	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of CBARP mRNA	CTD	PMID:34492290
Cbarp	Rat	titanium dioxide	decreases methylation	ISO	Cbarp (Mus musculus)	6480464	titanium dioxide results in decreased methylation of DOS gene more ...	CTD	PMID:35295148
Cbarp	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of CBARP mRNA	CTD	PMID:33387578
Cbarp	Rat	Triptolide	increases expression	ISO	Cbarp (Mus musculus)	6480464	triptolide results in increased expression of CBARP mRNA	CTD	PMID:32835833
Cbarp	Rat	triptonide	affects expression	ISO	Cbarp (Mus musculus)	6480464	triptonide affects the expression of CBARP mRNA	CTD	PMID:33045310
Cbarp	Rat	urethane	increases expression	ISO	CBARP (Homo sapiens)	6480464	Urethane results in increased expression of CBARP mRNA	CTD	PMID:28818685
Cbarp	Rat	valproic acid	increases expression	ISO	Cbarp (Mus musculus)	6480464	Valproic Acid results in increased expression of CBARP mRNA	CTD	PMID:20546886
Cbarp	Rat	valproic acid	increases methylation	ISO	CBARP (Homo sapiens)	6480464	Valproic Acid results in increased methylation of CBARP gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cbarp	Rat	negative regulation of calcium ion transmembrane transport	involved_in	ISO	Cbarp (Mus musculus)	1624291	PMID:24751537	RGD	PMID:24751537
Cbarp	Rat	negative regulation of calcium ion transmembrane transport	involved_in	IEA	UniProtKB:Q66L44 and ensembl:ENSMUSP00000101008	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cbarp	Rat	negative regulation of calcium ion-dependent exocytosis	involved_in	ISO	Cbarp (Mus musculus)	1624291	PMID:24751537	RGD	PMID:24751537
Cbarp	Rat	negative regulation of calcium ion-dependent exocytosis	involved_in	IBA	MGI:1354170 and PANTHER:PTN002408417	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cbarp	Rat	negative regulation of calcium ion-dependent exocytosis	involved_in	IEA	UniProtKB:Q66L44 and ensembl:ENSMUSP00000101008	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cbarp	Rat	negative regulation of voltage-gated calcium channel activity		IMP		10047103		RGD
Cbarp	Rat	negative regulation of voltage-gated calcium channel activity	involved_in	ISO	Cbarp (Mus musculus)	1624291	PMID:24751537	RGD	PMID:24751537

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cbarp	Rat	growth cone	located_in	ISO	Cbarp (Mus musculus)	1624291	PMID:24751537	RGD	PMID:24751537
Cbarp	Rat	growth cone	located_in	IEA	UniProtKB:Q66L44 and ensembl:ENSMUSP00000101008	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cbarp	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cbarp	Rat	plasma membrane	located_in	ISO	Cbarp (Mus musculus)	1624291	PMID:24751537	RGD	PMID:24751537
Cbarp	Rat	plasma membrane	located_in	IEA	UniProtKB:Q66L44 and ensembl:ENSMUSP00000101008	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cbarp	Rat	plasma membrane	is_active_in	IBA	MGI:1354170 and PANTHER:PTN002408417	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cbarp	Rat	secretory granule	located_in	IDA		10047103		RGD
Cbarp	Rat	secretory granule	located_in	IEA	UniProtKB:Q66L44 and ensembl:ENSMUSP00000101008	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cbarp	Rat	secretory granule	located_in	ISO	Cbarp (Mus musculus)	1624291	PMID:24751537	RGD	PMID:24751537

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cbarp	Rat	protein binding	enables	ISO	CBARP (Homo sapiens)	1624291	UniProtKB:Q14849 more ...	RGD	PMID:28514442 and PMID:33961781
Cbarp	Rat	protein binding	enables	ISO	CBARP (Homo sapiens) and UniProtKB:Q8N350-4	1624291	UniProtKB:O43639 more ...	RGD	PMID:32296183
Cbarp	Rat	transmembrane transporter binding	enables	ISO	Cbarp (Mus musculus)	1624291	UniProtKB:P54283 more ...	RGD	PMID:24751537
Cbarp	Rat	transmembrane transporter binding	enables	IEA	InterPro:IPR037658	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cbarp	Rat	transmembrane transporter binding	enables	IEA	UniProtKB:Q66L44 and ensembl:ENSMUSP00000101008	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cbarp	Rat	transmembrane transporter binding	enables	IBA	MGI:1354170 and PANTHER:PTN002408417	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	BARP suppresses voltage-gated calcium channel activity and Ca2+-evoked exocytosis.	Beguin P, etal., J Cell Biol. 2014 Apr 28;205(2):233-49. doi: 10.1083/jcb.201304101. Epub 2014 Apr 21.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932

Cbarp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,217,314 - 10,225,855 (+)	NCBI		GRCr8
mRatBN7.2	7	9,566,637 - 9,575,204 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	9,566,364 - 9,575,204 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	12,449,657 - 12,458,156 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,324,996 - 14,333,495 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,186,091 - 12,194,592 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,433,422 - 12,441,048 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,433,933 - 12,441,048 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	12,603,527 - 12,611,153 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	11,079,431 - 11,087,057 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	11,079,064 - 11,086,662 (+)	NCBI
Celera	7	7,743,241 - 7,750,842 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

CBARP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	1,228,287 - 1,238,502 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	1,228,287 - 1,238,027 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	1,228,286 - 1,238,004 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	1,180,947 - 1,188,990 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	1,180,954 - 1,188,841	NCBI
Celera	19	1,164,180 - 1,172,223 (-)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	1,005,343 - 1,039,838 (-)	NCBI		HuRef
CHM1_1	19	1,229,860 - 1,237,926 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	1,196,845 - 1,207,060 (-)	NCBI		T2T-CHM13v2.0

Cbarp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	79,966,268 - 79,976,189 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	79,966,285 - 79,976,669 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	80,130,434 - 80,140,355 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	80,130,451 - 80,140,835 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	79,593,179 - 79,598,128 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	79,593,179 - 79,598,128 (-)	NCBI		MGSCv36	mm8
Celera	10	81,145,266 - 81,150,215 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Cbarp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	6,671,726 - 6,677,205 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	6,671,719 - 6,678,338 (+)	NCBI	ChiLan1.0	ChiLan1.0

CBARP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	5,570,337 - 5,580,431 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	4,807,138 - 4,817,065 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	19	1,212,854 - 1,220,108 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	1,212,854 - 1,220,104 (-)	Ensembl	panpan1.1		panPan2

CBARP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	57,554,162 - 57,559,126 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	57,554,032 - 57,559,612 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	57,352,590 - 57,361,543 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	58,292,499 - 58,301,436 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	58,294,280 - 58,301,173 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	57,348,311 - 57,356,988 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	57,827,591 - 57,836,230 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	58,030,594 - 58,039,504 (+)	NCBI		UU_Cfam_GSD_1.0

Cbarp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	217,216,615 - 217,233,911 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	601,521 - 607,175 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	601,108 - 607,823 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CBARP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	77,220,972 - 77,230,058 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	77,220,790 - 77,230,418 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa11.1	2	77,228,094 - 77,230,411 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	77,823,483 - 77,831,001 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103233598
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	999,327 - 1,006,632 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666081	7,857,295 - 7,864,976 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cbarp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	7,437,564 - 7,443,353 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	7,435,633 - 7,444,483 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cbarp
19 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	184
Count of miRNA genes:	142
Interacting mature miRNAs:	151
Transcripts:	ENSRNOT00000060690
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

D7Got1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	9,565,207 - 9,565,291 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	12,431,409 - 12,431,492	NCBI	Rnor6.0
Rnor_5.0	7	12,601,514 - 12,601,597	UniSTS	Rnor5.0
RGSC_v3.4	7	11,077,417 - 11,077,501	RGD	RGSC3.4
RGSC_v3.4	7	11,077,418 - 11,077,501	UniSTS	RGSC3.4
RGSC_v3.1	7	11,077,418 - 11,077,501	RGD
Celera	7	7,741,231 - 7,741,314	UniSTS
RH 3.4 Map	7	34.6	UniSTS
RH 3.4 Map	7	34.6	RGD
RH 2.0 Map	7	0.0	RGD
Cytogenetic Map	7	q11	UniSTS

Stk11

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	9,568,257 - 9,568,385 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	12,434,458 - 12,434,585	NCBI	Rnor6.0
Rnor_5.0	7	12,604,563 - 12,604,690	UniSTS	Rnor5.0
RGSC_v3.4	7	11,080,467 - 11,080,594	UniSTS	RGSC3.4
Celera	7	7,744,256 - 7,744,383	UniSTS
Cytogenetic Map	7	q11	UniSTS

BE110397

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	9,568,464 - 9,568,619 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	12,434,665 - 12,434,819	NCBI	Rnor6.0
Rnor_5.0	7	12,604,770 - 12,604,924	UniSTS	Rnor5.0
RGSC_v3.4	7	11,080,674 - 11,080,828	UniSTS	RGSC3.4
Celera	7	7,744,463 - 7,744,617	UniSTS
RH 3.4 Map	7	41.1	UniSTS
Cytogenetic Map	7	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	90	89	58	25	58	6	217	97	93	45	60	31


RefSeq Transcripts	NM_001108070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001388507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141331	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC169056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000060690 ⟹ ENSRNOP00000057421

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	9,566,364 - 9,575,204 (+)	Ensembl
Rnor_6.0 Ensembl	7	12,433,933 - 12,441,048 (+)	Ensembl

RefSeq Acc Id:

NM_001108070 ⟹ NP_001101540

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,218,169 - 10,225,855 (+)	NCBI
mRatBN7.2	7	9,567,515 - 9,575,204 (+)	NCBI
Rnor_6.0	7	12,433,422 - 12,441,048 (+)	NCBI
Rnor_5.0	7	12,603,527 - 12,611,153 (+)	NCBI
RGSC_v3.4	7	11,079,431 - 11,087,057 (+)	RGD
Celera	7	7,743,241 - 7,750,842 (+)	RGD

Sequence:

show sequence

CGAGCCTGGCATCGGGTTCTCTGCGCTTTCCCTCACCGTATCCTGCTTGGGGGGGAGGGGGTCCTGGTGGACGTTCTGTGGGGACTCCATGTCTAGGCTCCCATTCTCGCTGGTCCTCATGATCCCGC
CTTCCTCGCCTTGGGTCTCCAGCCATCTTCCTTCCCACCTCTCATTACCATCCTCACCGAGCCCCACCCCCCTCCAGCCTGAACTCATTTTCCGACCTACATATGCACCCCTTATCACCCACCAAGAC
TGATGCCCGTTGTCTCTGCCTCGGAGCGCTGAGGAGACGTAGCCTTCTTGGGGATACATTCGTTTATTCAAGTCCCCCCACACAACTCCAATACCATCCAGTCTAAGAAATACTGGTGACGTTGGAGC
CTGTGGGCTCTTCTTCCATGGGAAACTGTTATCTCGTTTTAGAGTCAAGACACGGTACTCGGAACAGTCGATCTAGGCGGACGCGACGTCCAACCAACGCTGGCGCGGGGTTATTTTAACAGTCCCTT
TCTGAATCCACCCCACCTCTTGATGTGCCCTAGCCTCAGTTTCTCCACTCGTCTGGCAGAGACCTGCCTCAAAATGCAGCCCACGGCCACCATGGCCACAGCGGCCGCCACTACTGCCACGGTTGCCC
TGACGACTTCGTGGGACAATGCCACCAACCGCCCCACGGCGGAGCCTGACCCCATCTTGGACAACTATGTGCTGCTGGTGGTGGTGATGTCGCTGTTCGTTGGAGGCACGCTGGTGGTGCTGTCTGGC
GTTCTTCTGCTCTGCAAACGCTGCTGGGAGGTGCACCAGCGCTTCAACAGGGCCATGGAAGAAACAGAAAAGACCACCACTACCTACCTGGACAACGGCACCCACCCCATACAAGACTGGGCGCAGTT
CGAGTCCGACTCATCTCTGTTTCCTTAACGCCCAGGCGTAGACCCCGACTGCAGGGGGGAAGACCCCGAGGGCCAGGACACCGAAACAGAGCGCTTCCTAGCCACCACCTCCACCGGTCGCCGCGTGT
CCTTCAACGAGGCTGCCCTGTTTGAACAGAGCCGCAAGGCTCAGGACAAGGGCCGCCGGTACACCCTGACAGAAGGGGATTTCCATCACCTCAAGAATGCCCGCCTCACCCACCTCCACCTACCGCCT
CTCAAAATCGCTACCATCCATGAGTGTGACTCGGGTGAGGCCAGTGCTGCGGCCACGCCCCACCCCCACCCGGCTTCCACCCCCAAGGACAGCTTGGCTATATTCCAGCCCCCTGGGAAGTCCCTCAC
TGGCCACTCGGTGGGCCCCAGCTCTGCCCTCCCAGGTGATCCCTACAGCTCCGTGGACTTCTCGGAGATCAGCCCCTCGGCCTCCAGTGACTCTGGGGAGGGCACCTCGTTAGATGCGGGTACCCGGG
GTACCAAGGCTGCTGGGCCCGAGACAGCACCTGGGGAGATGGGCACAGGCTCCTCCGGGGCTGGCACTGTTTTGCAATTCTTCACTCGGCTACGCCGCCATGCCAGCCTGGATGGAGCCAGCCCCTAC
TTCAAGGTCAAGAAATGGAAGTTGGAGTCCAGCCAGAGAGCGTCCAGTCTGGACACGAGAGGTTCCCCGAAGCGGCACCACTTTCAGCGACAGCGGGCAGCCAGCGAGAGCATGGAGCAGGAGGGGGA
TATCCCCCATGCTGACTTCATTCAATACATTGCCAGCGCAGGCGACTCGGTGGCCTTCCCACCCCCCCGCCCCTTTCTGGCCAGCCCCACCAGCCCGCCCCCCACTCTCGGCAGGCTAGAGGCAGCTG
AGGCGGCGGGAGGAGGAAGCCCCGAGACTCCTCCGGAGCATGGCATCAGTTTGGGGCCCGAGCATGCGCAGCAGCAGGACCCGCAGCAAGAGCAGGACGCCGAGCATGCACAGTGCAGCTACCGTGAT
CTGTGGAGCCTTCGTGCTTCGCTCGAGCTCCACGCAGCCACTGCATCAGACCACAGCAGTAGCGGCAATGACCGTGACTCAGTGCGCAGCGGCGATAGCTCGGGCTCCGGTTCCGGGGGTGGAGGCGC
AGCACCCGCCTTCCCGCCCCCTCCTGAGTCTCCGCCTGCCTTGCGGCCTAAGGACGGCGAAGCCCGACGCCTGTTACAGATGGACAGTGGCTACGCGAGCATCGAGGGACGTGGAGCTGGCGATGAAG
TTTCTGAACTTCCTGCTCCAGCTCGGAGCCCTCCCCGCAGCCCGCGAGCCTGGCCACGCAGGCCGCGCCGCGATTATAGCATCGATGAGAAGACGGACGCTCTTTTCCATGAATTCCTGCGCCACGAT
CCTCATTTTGATGATGCTCCAAGACACCGCGCACGTGCGCATCCTCACACTCATGCGCGGAAGCAATGGCAACAGAGAGGCCGGCAGCACAGCGACCCCGGAGGTGCACGCGTGGCCACGCCCCCTGG
GGCTACCCGCCCCACACGTGCCCCCTTACGCCGTGGGGATAGTGTTGATTGTCCTCCTGAAGGCCGTGCGCCGCCCATCACCGGTGATGACCCATCCATTCCCGTCATTGAGGAGGAGCCTGGTGGTG
GAGGCAGTGGTTGCCCAGGCTCTGGGTTATGTGTTGAGCCCGCCGGGGCACTGCTGGACAAACTAGCAGCTAGCCTCGACGAGAGACTCTTCTCTCCCCGTCTTGCTGAGCCAGTTGCCTCATCCCCG
GTGCTGATTGTCGCTGCTGCCGCCCCTACATCCCCTGACCACAGCCCAGCCTAAGCTCTGTGTACTGGACCTGCCTCTCGGCTGCTTTGCCGGCGGCACGTGGGGCCGCTGTGGGAATGGTGGCGACA
GCGGGAGCAACCTGAGGTTGCTGTGCATGGGTACGCGGCCCAAATCCCAAGTGTGTACAAGGAGTGTCCCCTCGGGCACTTAGCAGGGTGCAGTGGGCCTCCGGATGCACAAGGCCTCCGGACCCAGG
CTCAGCTGCAGGGAGGATGAAGATCTTGGATTCTCAAGTCCATATACGGTTGACCCCCGGCACCCAGCCTCTGGCCACAGATGCGGGTGGAGCAGGTTCTGAGGTGCGCGTGCAGCCTCCCTCCAGGA
TCAGCCGAACCTCCACACTCGTGAGCACGTGCTGGCAGTGCCACTGCATGCGTGAACCTACTGGA

hide sequence

RefSeq Acc Id:

NM_001388507 ⟹ NP_001375436

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,217,353 - 10,225,855 (+)	NCBI
mRatBN7.2	7	9,566,699 - 9,575,204 (+)	NCBI

RefSeq Acc Id:

XM_039078983 ⟹ XP_038934911

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,218,308 - 10,225,855 (+)	NCBI
mRatBN7.2	7	9,566,960 - 9,575,204 (+)	NCBI

RefSeq Acc Id:

XM_039078984 ⟹ XP_038934912

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,217,314 - 10,225,855 (+)	NCBI
mRatBN7.2	7	9,566,637 - 9,575,204 (+)	NCBI

RefSeq Acc Id:

XM_039078985 ⟹ XP_038934913

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,218,308 - 10,224,280 (+)	NCBI
mRatBN7.2	7	9,566,960 - 9,573,625 (+)	NCBI


Protein RefSeqs	NP_001101540	(Get FASTA)	NCBI Sequence Viewer
	NP_001375436	(Get FASTA)	NCBI Sequence Viewer
	XP_038934911	(Get FASTA)	NCBI Sequence Viewer
	XP_038934912	(Get FASTA)	NCBI Sequence Viewer
	XP_038934913	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI69056	(Get FASTA)	NCBI Sequence Viewer
	EDL89327	(Get FASTA)	NCBI Sequence Viewer
	EDL89328	(Get FASTA)	NCBI Sequence Viewer
	EDL89329	(Get FASTA)	NCBI Sequence Viewer
	EDL89330	(Get FASTA)	NCBI Sequence Viewer
	EDL89331	(Get FASTA)	NCBI Sequence Viewer
	EDL89332	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000057421
	ENSRNOP00000057421.4

RefSeq Acc Id:

NP_001101540 ⟸ NM_001108070

- UniProtKB:

A6K8Q7 (UniProtKB/TrEMBL), B5DFH0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGTGSSGAGTVLQFFTRLRRHASLDGASPYFKVKKWKLESSQRASSLDTRGSPKRHHFQRQRAASESMEQEGDIPHADFIQYIASAGDSVAFPPPRPFLASPTSPPPTLGRLEAAEAAGGGSPETPPE
HGISLGPEHAQQQDPQQEQDAEHAQCSYRDLWSLRASLELHAATASDHSSSGNDRDSVRSGDSSGSGSGGGGAAPAFPPPPESPPALRPKDGEARRLLQMDSGYASIEGRGAGDEVSELPAPARSPPR
SPRAWPRRPRRDYSIDEKTDALFHEFLRHDPHFDDAPRHRARAHPHTHARKQWQQRGRQHSDPGGARVATPPGATRPTRAPLRRGDSVDCPPEGRAPPITGDDPSIPVIEEEPGGGGSGCPGSGLCVE
PAGALLDKLAASLDERLFSPRLAEPVASSPVLIVAAAAPTSPDHSPA

hide sequence

Ensembl Acc Id:

ENSRNOP00000057421 ⟸ ENSRNOT00000060690

RefSeq Acc Id:	XP_038934912 ⟸ XM_039078984
- Peptide Label:	isoform X2
- UniProtKB:	F1MAS1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001375436 ⟸ NM_001388507
- UniProtKB:	A6K8Q7 (UniProtKB/TrEMBL), B5DFH0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038934911 ⟸ XM_039078983
- Peptide Label:	isoform X1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1MAS1-F1-model_v2	AlphaFold	F1MAS1	1-431	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34917	BioCyc
Ensembl Genes	ENSRNOG00000024349	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000060690	ENTREZGENE
	ENSRNOT00000060690.5	UniProtKB/TrEMBL
InterPro	CBARP	UniProtKB/TrEMBL
KEGG Report	rno:314622	UniProtKB/TrEMBL
NCBI Gene	314622	ENTREZGENE
PANTHER	PTHR28597	UniProtKB/TrEMBL
	VOLTAGE-DEPENDENT CALCIUM CHANNEL BETA SUBUNIT-ASSOCIATED REGULATORY PROTEIN	UniProtKB/TrEMBL
PhenoGen	Cbarp	PhenoGen
RatGTEx	ENSRNOG00000024349	RatGTEx
UniProt	A6K8Q7	ENTREZGENE, UniProtKB/TrEMBL
	B5DFH0	ENTREZGENE, UniProtKB/TrEMBL
	F1MAS1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-03	Cbarp	CACN subunit beta associated regulatory protein	Cbarp	CACN beta subunit associated regulatory protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-11	Cbarp	CACN beta subunit associated regulatory protein	Cbarp	calcium channel, voltage-dependent, beta subunit associated regulatory protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-07-22	Cbarp	calcium channel, voltage-dependent, beta subunit associated regulatory protein	Dos	downstream of Stk11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Dos	downstream of Stk11	Dos_predicted	downstream of Stk11 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Dos_predicted	downstream of Stk11 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar