Advanced Search (OLGA)

Gene: Mrpl2 (mitochondrial ribosomal protein L2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Mrpl2

Name:

mitochondrial ribosomal protein L2

RGD ID:

1307147

Description:

Predicted to enable RNA binding activity. Predicted to be a structural constituent of ribosome. Predicted to be involved in mitochondrial translation. Predicted to be located in mitochondrion and nucleoplasm. Predicted to be part of mitochondrial large ribosomal subunit. Orthologous to human MRPL2 (mitochondrial ribosomal protein L2); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

39S ribosomal protein L2, mitochondrial; L2mt; large ribosomal subunit protein uL2m; LOC301240; MGC112706; MRP-L2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPL2 (mitochondrial ribosomal protein L2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mrpl2 (mitochondrial ribosomal protein L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mrpl2 (mitochondrial ribosomal protein L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPL2 (mitochondrial ribosomal protein L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPL2 (mitochondrial ribosomal protein L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrpl2 (mitochondrial ribosomal protein L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPL2 (mitochondrial ribosomal protein L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRPL2 (mitochondrial ribosomal protein L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLC1A1 (solute carrier family 1 member 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MRPL2 (mitochondrial ribosomal protein L2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrpl2 (mitochondrial ribosomal protein L2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrpl2 (mitochondrial ribosomal protein L2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RML2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mRpL2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mrpl-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	21,830,834 - 21,834,607 (-)	NCBI		GRCr8
mRatBN7.2	9	14,333,233 - 14,337,006 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	14,333,234 - 14,337,040 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	22,917,097 - 22,920,866 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	27,979,914 - 27,983,679 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	26,280,472 - 26,284,241 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	16,643,621 - 16,647,394 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	16,643,619 - 16,647,458 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	15,550,236 - 15,554,009 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	10,016,260 - 10,020,033 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	10,013,556 - 10,017,354 (+)	NCBI
Celera	9	12,081,087 - 12,084,860 (-)	NCBI		Celera
Cytogenetic Map	9	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrpl2	Rat	infantile Refsum disease		ISO	RGD:1316168	8554872	ClinVar Annotator: match by term: ADRENOLEUKODYSTROPHY, AUTOSOMAL NEONATAL	ClinVar	PMID:19877282\|PMID:21031596\|PMID:28492532\|PMID:8670792
Mrpl2	Rat	Zellweger syndrome		ISO	RGD:1316168	8554872	ClinVar Annotator: match by term: Peroxisome biogenesis disorders, Zellweger syndrome spectrum	ClinVar	PMID:19877282\|PMID:21031596\|PMID:28492532\|PMID:8670792

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrpl2	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MRPL2 mRNA]	CTD	PMID:31150632
Mrpl2	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1316169	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of MRPL2 mRNA	CTD	PMID:22206623
Mrpl2	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1316169	6480464	1,2-Dimethylhydrazine results in increased expression of MRPL2 mRNA	CTD	PMID:22206623
Mrpl2	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1316169	6480464	Ethinyl Estradiol results in increased expression of MRPL2 mRNA	CTD	PMID:17942748
Mrpl2	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1316169	6480464	Ethinyl Estradiol affects the expression of MRPL2 mRNA	CTD	PMID:17555576
Mrpl2	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1316169	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRPL2 mRNA	CTD	PMID:17942748
Mrpl2	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1316169	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRPL2 mRNA	CTD	PMID:17942748
Mrpl2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of MRPL2 mRNA	CTD	PMID:33387578
Mrpl2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1316169	6480464	Tetrachlorodibenzodioxin affects the expression of MRPL2 mRNA	CTD	PMID:21570461
Mrpl2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of MRPL2 mRNA	CTD	PMID:21215274
Mrpl2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1316169	6480464	Tetrachlorodibenzodioxin results in decreased expression of MRPL2 mRNA	CTD	PMID:21354282
Mrpl2	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Mrpl2	Rat	5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole	affects expression	EXP		6480464	Omeprazole affects the expression of MRPL2 mRNA	CTD	PMID:19483382
Mrpl2	Rat	6-propyl-2-thiouracil	affects expression	EXP		6480464	Propylthiouracil affects the expression of MRPL2 mRNA	CTD	PMID:19483382
Mrpl2	Rat	acrylamide	decreases expression	ISO	RGD:1316168	6480464	Acrylamide results in decreased expression of MRPL2 mRNA	CTD	PMID:32763439
Mrpl2	Rat	amiodarone	affects expression	EXP		6480464	Amiodarone affects the expression of MRPL2 mRNA	CTD	PMID:19483382
Mrpl2	Rat	aristolochic acid A	increases expression	ISO	RGD:1316168	6480464	aristolochic acid I results in increased expression of MRPL2 mRNA	CTD	PMID:33212167
Mrpl2	Rat	arsane	multiple interactions	ISO	RGD:1316168	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Mrpl2	Rat	arsenic atom	multiple interactions	ISO	RGD:1316168	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Mrpl2	Rat	arsenite(3-)	multiple interactions	ISO	RGD:1316168	6480464	arsenite promotes the reaction [G3BP1 protein binds to MRPL2 mRNA]	CTD	PMID:32406909
Mrpl2	Rat	atrazine	increases expression	ISO	RGD:1316168	6480464	Atrazine results in increased expression of MRPL2 mRNA	CTD	PMID:22378314
Mrpl2	Rat	benzbromarone	affects expression	EXP		6480464	Benzbromarone affects the expression of MRPL2 mRNA	CTD	PMID:19483382
Mrpl2	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1316168	6480464	Benzo(a)pyrene results in decreased expression of MRPL2 mRNA	CTD	PMID:20106945
Mrpl2	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1316169	6480464	Diethylhexyl Phthalate results in decreased expression of MRPL2 mRNA	CTD	PMID:35550907
Mrpl2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of MRPL2 mRNA	CTD	PMID:25181051
Mrpl2	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Mrpl2	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of MRPL2 gene	CTD	PMID:28505145
Mrpl2	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Mrpl2	Rat	CGP 52608	multiple interactions	ISO	RGD:1316168	6480464	CGP 52608 promotes the reaction [RORA protein binds to MRPL2 gene]	CTD	PMID:28238834
Mrpl2	Rat	clofibrate	affects expression	EXP		6480464	Clofibrate affects the expression of MRPL2 mRNA	CTD	PMID:19483382
Mrpl2	Rat	clofibrate	decreases expression	ISO	RGD:1316169	6480464	Clofibrate results in decreased expression of MRPL2 mRNA	CTD	PMID:23811191
Mrpl2	Rat	dibutyl phthalate	decreases expression	ISO	RGD:1316169	6480464	Dibutyl Phthalate results in decreased expression of MRPL2 mRNA	CTD	PMID:21266533
Mrpl2	Rat	elemental selenium	multiple interactions	ISO	RGD:1316168	6480464	[Selenium co-treated with Vitamin E] results in increased expression of MRPL2 mRNA	CTD	PMID:19244175
Mrpl2	Rat	elemental selenium	increases expression	ISO	RGD:1316168	6480464	Selenium results in increased expression of MRPL2 mRNA	CTD	PMID:19244175
Mrpl2	Rat	ethanol	affects expression	ISO	RGD:1316169	6480464	Ethanol affects the expression of MRPL2 mRNA	CTD	PMID:30319688
Mrpl2	Rat	fenthion	decreases expression	ISO	RGD:1316169	6480464	Fenthion results in decreased expression of MRPL2 mRNA	CTD	PMID:34813904
Mrpl2	Rat	folic acid	multiple interactions	ISO	RGD:1316169	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of MRPL2 mRNA	CTD	PMID:22206623
Mrpl2	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of MRPL2 mRNA	CTD	PMID:33387578
Mrpl2	Rat	ivermectin	decreases expression	ISO	RGD:1316168	6480464	Ivermectin results in decreased expression of MRPL2 protein	CTD	PMID:32959892
Mrpl2	Rat	L-ethionine	affects expression	EXP		6480464	Ethionine affects the expression of MRPL2 mRNA	CTD	PMID:19483382
Mrpl2	Rat	manganese atom	multiple interactions	ISO	RGD:1316168	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Mrpl2	Rat	manganese(0)	multiple interactions	ISO	RGD:1316168	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Mrpl2	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1316168	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Mrpl2	Rat	methidathion	decreases expression	ISO	RGD:1316169	6480464	methidathion results in decreased expression of MRPL2 mRNA	CTD	PMID:34813904
Mrpl2	Rat	methylmercury chloride	decreases expression	ISO	RGD:1316168	6480464	methylmercuric chloride results in decreased expression of MRPL2 mRNA	CTD	PMID:28001369
Mrpl2	Rat	omeprazole	affects expression	EXP		6480464	Omeprazole affects the expression of MRPL2 mRNA	CTD	PMID:19483382
Mrpl2	Rat	pirinixic acid	affects expression	EXP		6480464	pirinixic acid affects the expression of MRPL2 mRNA	CTD	PMID:19483382
Mrpl2	Rat	selenium atom	multiple interactions	ISO	RGD:1316168	6480464	[Selenium co-treated with Vitamin E] results in increased expression of MRPL2 mRNA	CTD	PMID:19244175
Mrpl2	Rat	selenium atom	increases expression	ISO	RGD:1316168	6480464	Selenium results in increased expression of MRPL2 mRNA	CTD	PMID:19244175
Mrpl2	Rat	sodium arsenite	decreases expression	ISO	RGD:1316169	6480464	sodium arsenite results in decreased expression of MRPL2 mRNA	CTD	PMID:16014739
Mrpl2	Rat	sodium arsenite	multiple interactions	ISO	RGD:1316168	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Mrpl2	Rat	sodium arsenite	decreases expression	ISO	RGD:1316168	6480464	sodium arsenite results in decreased expression of MRPL2 mRNA	CTD	PMID:38568856
Mrpl2	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of MRPL2 mRNA	CTD	PMID:19281266
Mrpl2	Rat	tamoxifen	affects expression	ISO	RGD:1316169	6480464	Tamoxifen affects the expression of MRPL2 mRNA	CTD	PMID:17555576
Mrpl2	Rat	temozolomide	increases expression	ISO	RGD:1316168	6480464	Temozolomide results in increased expression of MRPL2 mRNA	CTD	PMID:31758290
Mrpl2	Rat	tert-butyl hydroperoxide	increases expression	ISO	RGD:1316168	6480464	tert-Butylhydroperoxide results in increased expression of MRPL2 mRNA	CTD	PMID:15336504
Mrpl2	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of MRPL2 mRNA	CTD	PMID:31150632
Mrpl2	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MRPL2 mRNA]	CTD	PMID:31150632
Mrpl2	Rat	thioacetamide	affects expression	EXP		6480464	Thioacetamide affects the expression of MRPL2 mRNA	CTD	PMID:19483382
Mrpl2	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of MRPL2 mRNA	CTD	PMID:34492290
Mrpl2	Rat	triphenyl phosphate	affects expression	ISO	RGD:1316168	6480464	triphenyl phosphate affects the expression of MRPL2 mRNA	CTD	PMID:37042841
Mrpl2	Rat	tungsten	increases expression	ISO	RGD:1316169	6480464	Tungsten results in increased expression of MRPL2 mRNA	CTD	PMID:30912803
Mrpl2	Rat	valproic acid	increases expression	ISO	RGD:1316168	6480464	Valproic Acid results in increased expression of MRPL2 mRNA	CTD	PMID:23179753
Mrpl2	Rat	vitamin E	multiple interactions	ISO	RGD:1316168	6480464	[Selenium co-treated with Vitamin E] results in increased expression of MRPL2 mRNA	CTD	PMID:19244175
Mrpl2	Rat	vitamin E	increases expression	ISO	RGD:1316168	6480464	Vitamin E results in increased expression of MRPL2 mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrpl2	Rat	mitochondrial translation	involved_in	IBA	PANTHER:PTN008550512\|SGD:S000000776	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mrpl2	Rat	translation	involved_in	IEA	InterPro:IPR002171\|InterPro:IPR022666\|InterPro:IPR022669	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrpl2	Rat	mitochondrial large ribosomal subunit	part_of	ISS	UniProtKB:Q5T653	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mrpl2	Rat	mitochondrial large ribosomal subunit	part_of	IEA	UniProtKB:Q5T653\|ensembl:ENSP00000373404	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mrpl2	Rat	mitochondrial large ribosomal subunit	part_of	IBA	PANTHER:PTN008550512\|SGD:S000000776\|UniProtKB:Q57Z57\|UniProtKB:Q5T653	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mrpl2	Rat	mitochondrial large ribosomal subunit	part_of	ISO	RGD:1316168	1624291	PMID:25278503, PMID:28892042	RGD	PMID:25278503\|PMID:28892042
Mrpl2	Rat	mitochondrion	located_in	IEA	UniProtKB:Q5T653\|ensembl:ENSP00000373404	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mrpl2	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mrpl2	Rat	mitochondrion	located_in	ISO	RGD:1316168	1624291	PMID:28892042	RGD	GO_REF:0000052\|PMID:28892042
Mrpl2	Rat	mitochondrion	located_in	IEA	UniProtKB-SubCell:SL-0173	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mrpl2	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q5T653\|ensembl:ENSP00000373404	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mrpl2	Rat	nucleoplasm	located_in	ISO	RGD:1316168	1624291		RGD	GO_REF:0000052
Mrpl2	Rat	ribonucleoprotein complex	part_of	IEA	UniProtKB-KW:KW-0687	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mrpl2	Rat	ribosome	located_in	IEA	UniProtKB-KW:KW-0689	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mrpl2	Rat	ribosome	located_in	IEA	InterPro:IPR002171\|InterPro:IPR022666\|InterPro:IPR022669	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mrpl2	Rat	RNA binding	enables	IBA	PANTHER:PTN000343556\|RGD:619827\|TAIR:locus:2060917\|TAIR:locus:2122189\|TAIR:locus:2828126\|TAIR:locus:504954483	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mrpl2	Rat	structural constituent of ribosome	enables	IBA	FB:FBgn0261602\|MGI:1350927\|PANTHER:PTN000343556\|SGD:S000000776\|SGD:S000001280\|SGD:S000002104\|UniProtKB:P60422\|UniProtKB:P62917\|UniProtKB:Q8I3T9	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mrpl2	Rat	structural constituent of ribosome	enables	IEA	InterPro:IPR002171\|InterPro:IPR022666\|InterPro:IPR022669	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:18614015	PMID:22658674	PMID:22681889	PMID:25278503	PMID:28892042

Mrpl2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	21,830,834 - 21,834,607 (-)	NCBI		GRCr8
mRatBN7.2	9	14,333,233 - 14,337,006 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	14,333,234 - 14,337,040 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	22,917,097 - 22,920,866 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	27,979,914 - 27,983,679 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	26,280,472 - 26,284,241 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	16,643,621 - 16,647,394 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	16,643,619 - 16,647,458 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	15,550,236 - 15,554,009 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	10,016,260 - 10,020,033 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	10,013,556 - 10,017,354 (+)	NCBI
Celera	9	12,081,087 - 12,084,860 (-)	NCBI		Celera
Cytogenetic Map	9	q12	NCBI

MRPL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	43,054,029 - 43,059,863 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	43,054,029 - 43,059,438 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	43,021,767 - 43,027,172 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	43,129,745 - 43,135,220 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	43,129,744 - 43,135,220	NCBI
Celera	6	44,574,010 - 44,579,485 (-)	NCBI		Celera
Cytogenetic Map	6	p21.1	NCBI
HuRef	6	42,738,760 - 42,744,234 (-)	NCBI		HuRef
CHM1_1	6	43,024,212 - 43,029,687 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	42,883,100 - 42,888,934 (-)	NCBI		T2T-CHM13v2.0

Mrpl2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	46,957,094 - 46,961,058 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	46,957,155 - 46,961,065 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	46,646,172 - 46,650,132 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	46,646,229 - 46,650,139 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	46,783,197 - 46,787,081 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	46,109,437 - 46,113,323 (+)	NCBI		MGSCv36	mm8
Celera	17	50,082,131 - 50,086,015 (+)	NCBI		Celera
Cytogenetic Map	17	C	NCBI
cM Map	17	22.9	NCBI

Mrpl2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	9,017,939 - 9,022,760 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	9,018,491 - 9,022,998 (-)	NCBI	ChiLan1.0	ChiLan1.0

MRPL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	57,554,349 - 57,559,934 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	53,424,600 - 53,430,286 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	42,646,495 - 42,651,909 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	43,941,460 - 43,946,407 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	43,941,455 - 43,946,407 (-)	Ensembl	panpan1.1		panPan2

MRPL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	11,574,775 - 11,578,616 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	11,574,792 - 11,578,557 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	11,601,792 - 11,605,611 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	12,056,139 - 12,059,946 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	12,056,156 - 12,059,905 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	11,584,773 - 11,588,584 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	11,668,837 - 11,672,652 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	11,762,901 - 11,766,728 (-)	NCBI		UU_Cfam_GSD_1.0

Mrpl2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	47,073,993 - 47,090,150 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	16,881,744 - 16,886,301 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	16,881,750 - 16,886,209 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	38,116,179 - 38,121,756 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	38,116,172 - 38,121,593 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	43,616,539 - 43,621,036 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPL2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	29,100,918 - 29,106,394 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	29,101,498 - 29,106,355 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	43,116,583 - 43,121,570 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Mrpl2
12 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
9	15550296	15550297	C	A	snv	DOB/Oda (KyushuU)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	35
Count of miRNA genes:	34
Interacting mature miRNAs:	35
Transcripts:	ENSRNOT00000024380
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
61450	Ciaa3	CIA Autoantibody QTL 3	6.5		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	9	7954720	22071169	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	1	37999212	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	40594091	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5109826	42921101	Rat
70226	Eae4	Experimental allergic encephalomyelitis QTL 4			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	9	1	25661317	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	1	37999212	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	13533770	42791750	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	1	37999212	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat

RH128497

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	9	21,831,711 - 21,832,186 (+)	Marker Load Pipeline
mRatBN7.2	9	14,334,110 - 14,334,585 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	16,644,499 - 16,644,973	NCBI	Rnor6.0
Rnor_5.0	9	15,551,114 - 15,551,588	UniSTS	Rnor5.0
RGSC_v3.4	9	10,018,681 - 10,019,155	UniSTS	RGSC3.4
Celera	9	12,081,965 - 12,082,439	UniSTS
RH 3.4 Map	9	60.4	UniSTS
Cytogenetic Map	9	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001034136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC100081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214924	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229593	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024380 ⟹ ENSRNOP00000024380

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	14,333,234 - 14,337,040 (-)	Ensembl
Rnor_6.0 Ensembl	9	16,643,619 - 16,647,458 (-)	Ensembl

RefSeq Acc Id:

NM_001034136 ⟹ NP_001029308

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	21,830,834 - 21,834,607 (-)	NCBI
mRatBN7.2	9	14,333,233 - 14,337,006 (-)	NCBI
Rnor_6.0	9	16,643,621 - 16,647,394 (-)	NCBI
Rnor_5.0	9	15,550,236 - 15,554,009 (-)	NCBI
RGSC_v3.4	9	10,016,260 - 10,020,033 (+)	RGD
Celera	9	12,081,087 - 12,084,860 (-)	RGD

Sequence:

show sequence

AGCGAGTTCTGTACGGAGGAATCTGACCATTCCATGGCCCTGTGCGCGCTGGCTAGTGCTCTGCGCTCCTTGAGCCTGGCATCCCCGGCCATTACCGCCCGGGTTCCGACTCTGCTTCCTGTTGGCCA
GAGCAATGTCCTCCTTCAGCTGCCCTCTGCCCTGGCATTGCCCGCTCACCGCCCAGTGCATATGTCTGCGGACCGCAGCGCTAAGTTTGTGTCCTGGAAGAGTCGTATCAAGTACACAGTTAAACCAG
TGAAGATGAGGAAGTCTGGGGGTCGAGACCACACAGGCCGCATCCGAGTGCATGGTATTGGTGGAGGCCACAAGCAGAATTATCGAATGATTGACTTTCTCCGGTTCCGGCCAGAAAAGGGGACCGAG
CCAGAACCCTTTGAGGAGAAGGTTGTGGTAGTCCGCTACGATCCTTGTAGGTCTGCAGACATAGCTCTGGTTGCCGGGGGCAGCCGGAAACGCTGGATCATTGCCACAGAAAACATGAAGGCAGGAGA
TACAATCCTGAACTCTAACCACATCGGCAGAATGGCAGTGGCTGCTCAGGAAGGGGATGCACATCCGCTTGGGGCGCTGCCTGTGGGGACCCTCATCAACAATGTAGAGAGCGAGCCTGGCCGAGGAG
CCCAGTATATCCGAGCTGCAGGGACATGCGGTGTGCTGCTCCGGAAGGTGAATGGAACAGCCATTATCCAGCTGCCCTCGAAGAGGCAAATGCAGGTGCTGGAGTCGTGCACTGCAACTGTAGGCCGG
GTTTCCAACGTTAATCATAACCAGCGGGTCATCGGCAAGGCAGGACGGAACCGCTGGCTAGGCAAGAGGCCTAACAGTGGGCTGTGGCAACGCAAGGGAGGCTGGGCCGGCCGGAAGATTCGGCCACT
GCCACCCATGAAGAGTTACGTGAAGCTGCCCTCCGCTGCTGCCCAAAGCTGATTCCCCTGGACTCAAATAAAATGTTCCTTGTTTTTATCTGTTAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001029308	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI00082	(Get FASTA)	NCBI Sequence Viewer
	EDM18833	(Get FASTA)	NCBI Sequence Viewer
	EDM18834	(Get FASTA)	NCBI Sequence Viewer
	EDM18835	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024380
	ENSRNOP00000024380.5
GenBank Protein	Q498T4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001029308 ⟸ NM_001034136
- Peptide Label:	precursor
- UniProtKB:	Q498T4 (UniProtKB/Swiss-Prot), A6JIP7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALCALASALRSLSLASPAITARVPTLLPVGQSNVLLQLPSALALPAHRPVHMSADRSAKFVSWKSRIKYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKGTEPEPFEEKVVVV RYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAVAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLESCTATVGRVSNVNHNQRVI GKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQS hide sequence

Ensembl Acc Id:

ENSRNOP00000024380 ⟸ ENSRNOT00000024380

Protein Domains

Large ribosomal subunit protein uL2 C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q498T4-F1-model_v2	AlphaFold	Q498T4	1-304	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696513

Promoter ID:

EPDNEW_R7037

Type:

multiple initiation site

Name:

Mrpl2_1

Description:

mitochondrial ribosomal protein L2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	16,647,430 - 16,647,490	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-28235	BioCyc
Ensembl Genes	ENSRNOG00000018057	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000024380	ENTREZGENE
	ENSRNOT00000024380.8	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.30.30	UniProtKB/Swiss-Prot
	2.40.50.140	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7325700	IMAGE-MGC_LOAD
InterPro	NA-bd_OB-fold	UniProtKB/Swiss-Prot
	Rbsml_prot_L2_RNA-bd_dom	UniProtKB/Swiss-Prot
	Rib_L2_dom2	UniProtKB/Swiss-Prot
	Ribosomal_L2	UniProtKB/Swiss-Prot
	Ribosomal_L2_C	UniProtKB/Swiss-Prot
	Translation_prot_SH3-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:301240	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112706	IMAGE-MGC_LOAD
NCBI Gene	301240	ENTREZGENE
PANTHER	LARGE RIBOSOMAL SUBUNIT PROTEIN UL2M	UniProtKB/Swiss-Prot
	PTHR13691	UniProtKB/Swiss-Prot
Pfam	Ribosomal_L2	UniProtKB/Swiss-Prot
	Ribosomal_L2_C	UniProtKB/Swiss-Prot
PhenoGen	Mrpl2	PhenoGen
RatGTEx	ENSRNOG00000018057	RatGTEx
SMART	Ribosomal_L2	UniProtKB/Swiss-Prot
	Ribosomal_L2_C	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50104	UniProtKB/Swiss-Prot
	SSF50249	UniProtKB/Swiss-Prot
UniProt	A6JIP7	ENTREZGENE, UniProtKB/TrEMBL
	A6JIP8_RAT	UniProtKB/TrEMBL
	A6JIP9_RAT	UniProtKB/TrEMBL
	Q498T4	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Mrpl2	mitochondrial ribosomal protein L2	Mrpl2_predicted	mitochondrial ribosomal protein L2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Mrpl2_predicted	mitochondrial ribosomal protein L2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar