Symbol:
Car7
Name:
carbonic anhydrase 7
RGD ID:
1306842
Description:
Predicted to enable carbonate dehydratase activity. Predicted to act upstream of or within several processes, including positive regulation of GABAergic synaptic transmission; positive regulation of cellular pH reduction; and regulation of chloride transport. Predicted to be located in cytosol. Orthologous to human CA7 (carbonic anhydrase 7); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 3,7-dihydropurine-6-thione; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Ca7; carbonic anhydrase VII
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CA7 (carbonic anhydrase 7) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Car7 (carbonic anhydrase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ca7 (carbonic anhydrase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CA7 (carbonic anhydrase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CA7 (carbonic anhydrase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ca7 (carbonic anhydrase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CA7 (carbonic anhydrase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CA7 (carbonic anhydrase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ca7 (carbonic anhydrase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CA7 (carbonic anhydrase 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Car7 (carbonic anhydrase 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ca7 (carbonic anhydrase VII)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CAH1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cah-3
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ca7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 435,520 - 444,927 (-) NCBI GRCr8 mRatBN7.2 19 429,063 - 438,478 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 429,075 - 438,467 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 424,817 - 434,251 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 51,853 - 61,284 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 466,826 - 476,258 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 636,545 - 645,935 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 636,545 - 645,937 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 630,356 - 639,746 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 365,680 - 375,074 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 365,695 - 375,513 (-) NCBI Celera 19 424,600 - 433,992 (-) NCBI Celera Cytogenetic Map 19 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Car7 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Car7 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Car7 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Car7 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Car7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Car7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CAR7 mRNA CTD PMID:21570461 Car7 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Car7 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Car7 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CAR7 mRNA CTD PMID:20188158 Car7 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of CAR7 mRNA CTD PMID:23358152 Car7 Rat 4,4'-sulfonyldiphenol decreases expression ISO Car7 (Mus musculus) 6480464 bisphenol S results in decreased expression of CAR7 mRNA CTD PMID:39298647 Car7 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CAR7 mRNA CTD PMID:24780913 Car7 Rat acetazolamide multiple interactions ISO CA7 (Homo sapiens) 6480464 Acetazolamide binds to and results in decreased activity of CA7 protein CTD PMID:28251759 Car7 Rat antirheumatic drug decreases expression ISO CA7 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CA7 mRNA CTD PMID:24449571 Car7 Rat arsane affects methylation ISO CA7 (Homo sapiens) 6480464 Arsenic affects the methylation of CA7 gene CTD PMID:25304211 Car7 Rat arsenic atom affects methylation ISO CA7 (Homo sapiens) 6480464 Arsenic affects the methylation of CA7 gene CTD PMID:25304211 Car7 Rat benzo[a]pyrene increases methylation ISO CA7 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CA7 promoter CTD PMID:27901495 Car7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CA7 mRNA CTD PMID:25181051 Car7 Rat bisphenol A increases expression ISO Car7 (Mus musculus) 6480464 bisphenol A results in increased expression of CAR7 mRNA CTD PMID:34585602 Car7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CAR7 mRNA CTD PMID:30816183 and PMID:32528016 Car7 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CAR7 gene CTD PMID:28505145 Car7 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Butter] affects the expression of CAR7 mRNA and [bisphenol A co-treated with Butter] affects the methylation of CAR7 promoter CTD PMID:28487351 Car7 Rat bisphenol F increases expression ISO Car7 (Mus musculus) 6480464 bisphenol F results in increased expression of CAR7 mRNA CTD PMID:30951980 Car7 Rat bisphenol F multiple interactions ISO CA7 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of CA7 gene CTD PMID:31601247 Car7 Rat bisphenol F increases methylation ISO CA7 (Homo sapiens) 6480464 bisphenol F results in increased methylation of CA7 gene CTD PMID:31601247 Car7 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of CAR7 promoter CTD PMID:22457795 Car7 Rat copper atom multiple interactions ISO CA7 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of CA7 mRNA CTD PMID:24690739 Car7 Rat copper(0) multiple interactions ISO CA7 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of CA7 mRNA CTD PMID:24690739 Car7 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of CAR7 mRNA CTD PMID:26577399 Car7 Rat cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of CAR7 mRNA CTD PMID:27281708 Car7 Rat disulfiram multiple interactions ISO CA7 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of CA7 mRNA CTD PMID:24690739 Car7 Rat famotidine multiple interactions ISO CA7 (Homo sapiens) 6480464 Famotidine binds to and results in decreased activity of CA7 protein CTD PMID:30344913 Car7 Rat fulvestrant multiple interactions ISO CA7 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of CA7 gene CTD PMID:31601247 Car7 Rat hydralazine multiple interactions ISO CA7 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of CA7 mRNA CTD PMID:17183730 Car7 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of CAR7 mRNA CTD PMID:20080153 Car7 Rat maneb multiple interactions ISO Car7 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of CAR7 mRNA CTD PMID:36117858 Car7 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of CAR7 mRNA CTD PMID:23358152 Car7 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of CAR7 mRNA CTD PMID:26720608 Car7 Rat oryzalin multiple interactions ISO CA7 (Homo sapiens) 6480464 oryzalin binds to and results in decreased activity of CA7 protein CTD PMID:28251759 Car7 Rat paracetamol affects expression ISO Car7 (Mus musculus) 6480464 Acetaminophen affects the expression of CAR7 mRNA CTD PMID:17562736 Car7 Rat paracetamol decreases expression ISO CA7 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CA7 mRNA CTD PMID:22230336 Car7 Rat paraquat multiple interactions ISO Car7 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of CAR7 mRNA CTD PMID:36117858 Car7 Rat PCB138 multiple interactions ISO Car7 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Car7 Rat phenobarbital affects expression ISO Car7 (Mus musculus) 6480464 Phenobarbital affects the expression of CAR7 mRNA CTD PMID:23091169 Car7 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of CAR7 mRNA CTD PMID:23358152 Car7 Rat resveratrol multiple interactions ISO CA7 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of CA7 mRNA CTD PMID:23557933 Car7 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of CAR7 mRNA CTD PMID:19281266 Car7 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CAR7 mRNA CTD PMID:23411599 Car7 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of CAR7 mRNA CTD PMID:34492290 Car7 Rat titanium dioxide decreases methylation ISO Car7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CAR7 gene CTD PMID:35295148 Car7 Rat titanium dioxide increases methylation ISO Car7 (Mus musculus) 6480464 titanium dioxide results in increased methylation of CAR7 gene CTD PMID:35295148 Car7 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of CAR7 mRNA CTD PMID:33387578 Car7 Rat triptonide increases expression ISO Car7 (Mus musculus) 6480464 triptonide results in increased expression of CAR7 mRNA CTD PMID:33045310 Car7 Rat trovafloxacin decreases expression ISO Car7 (Mus musculus) 6480464 trovafloxacin results in decreased expression of CAR7 mRNA CTD PMID:35537566 Car7 Rat valproic acid multiple interactions ISO CA7 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of CA7 mRNA CTD PMID:17183730 Car7 Rat valproic acid increases methylation ISO CA7 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CA7 gene CTD PMID:29154799
2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3,7-dihydropurine-6-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetazolamide (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) cyclophosphamide (EXP) disulfiram (ISO) famotidine (ISO) fulvestrant (ISO) hydralazine (ISO) ketamine (EXP) maneb (ISO) mercaptopurine (EXP) nitrofen (EXP) oryzalin (ISO) paracetamol (ISO) paraquat (ISO) PCB138 (ISO) phenobarbital (ISO) purine-6-thiol (EXP) resveratrol (ISO) Soman (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triptonide (ISO) trovafloxacin (ISO) valproic acid (ISO)
Car7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 435,520 - 444,927 (-) NCBI GRCr8 mRatBN7.2 19 429,063 - 438,478 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 429,075 - 438,467 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 424,817 - 434,251 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 51,853 - 61,284 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 466,826 - 476,258 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 636,545 - 645,935 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 636,545 - 645,937 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 630,356 - 639,746 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 365,680 - 375,074 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 365,695 - 375,513 (-) NCBI Celera 19 424,600 - 433,992 (-) NCBI Celera Cytogenetic Map 19 p14 NCBI
CA7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 66,844,414 - 66,854,147 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 66,844,414 - 66,854,153 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 66,878,317 - 66,888,050 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 65,435,783 - 65,445,551 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 65,435,891 - 65,445,541 NCBI Celera 16 51,386,593 - 51,396,359 (+) NCBI Celera Cytogenetic Map 16 q22.1 NCBI HuRef 16 52,752,480 - 52,762,235 (+) NCBI HuRef CHM1_1 16 68,285,378 - 68,295,146 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 72,638,709 - 72,648,442 (+) NCBI T2T-CHM13v2.0
Car7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 105,261,326 - 105,276,979 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 105,261,321 - 105,276,975 (+) Ensembl GRCm39 Ensembl GRCm38 8 104,534,694 - 104,550,347 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 104,534,689 - 104,550,343 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 107,064,707 - 107,074,243 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 107,429,936 - 107,439,472 (+) NCBI MGSCv36 mm8 Celera 8 108,773,242 - 108,782,734 (+) NCBI Celera Cytogenetic Map 8 D3 NCBI cM Map 8 53.04 NCBI
Ca7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 23,365,718 - 23,374,548 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 23,365,832 - 23,374,517 (+) NCBI ChiLan1.0 ChiLan1.0
CA7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 76,345,564 - 76,355,356 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 82,258,074 - 82,267,859 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 47,161,021 - 47,170,800 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 66,262,259 - 66,272,316 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 66,262,362 - 66,271,665 (+) Ensembl panpan1.1 panPan2
CA7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 82,446,239 - 82,455,445 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 82,446,246 - 82,455,590 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 82,434,936 - 82,444,145 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 82,882,872 - 82,892,083 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 82,882,877 - 82,892,233 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 82,706,026 - 82,715,234 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 82,392,889 - 82,402,094 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 83,031,862 - 83,041,073 (-) NCBI UU_Cfam_GSD_1.0
Ca7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 42,469,000 - 42,477,123 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 17,112,004 - 17,120,105 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 17,112,004 - 17,120,105 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CA7
CA7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 52,541,008 - 52,551,307 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 52,541,527 - 52,551,389 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 23,360,443 - 23,370,286 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ca7
.
Predicted Target Of
Count of predictions: 397 Count of miRNA genes: 200 Interacting mature miRNAs: 228 Transcripts: ENSRNOT00000016521 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
3
22
98
84
84
59
18
59
5
170
54
82
45
58
25
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016521 ⟹ ENSRNOP00000016521
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 429,075 - 438,467 (-) Ensembl Rnor_6.0 Ensembl 19 636,545 - 645,937 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116794 ⟹ ENSRNOP00000091957
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 429,075 - 436,065 (-) Ensembl
RefSeq Acc Id:
NM_001106165 ⟹ NP_001099635
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 435,522 - 444,914 (-) NCBI mRatBN7.2 19 429,075 - 438,467 (-) NCBI Rnor_6.0 19 636,545 - 645,935 (-) NCBI Rnor_5.0 19 630,356 - 639,746 (-) NCBI RGSC_v3.4 19 365,680 - 375,074 (-) RGD Celera 19 424,600 - 433,992 (-) RGD
Sequence:
AGGCTGCTCCACAGCAGCAAGCGAGGCCGGAGCGGCAGACGGAGCGAGCGGACAGAACGGAGTCGGCAGGTGCAGGGCCGCGGAGACAGCAGCGGCATGACCGGCCACCACTGTTGGGGCTACGGCCA
hide sequence
RefSeq Acc Id:
XM_006255051 ⟹ XP_006255113
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 435,520 - 444,704 (-) NCBI mRatBN7.2 19 429,063 - 438,278 (-) NCBI Rnor_6.0 19 636,547 - 645,569 (-) NCBI Rnor_5.0 19 630,356 - 639,746 (-) NCBI
Sequence:
GCCTCCGCGCAGCGCGGGACTGCAGCGCTGGGTCCCACCGGGCCCCGCACTCTCGCTCCCCCGGCGTGCGCAGCGCTTGCAGGTGGCTTAGGGCGACGGAGGCGGGAGGGGGGTGGCCGAGTCGCAGC
hide sequence
RefSeq Acc Id:
XM_008772243 ⟹ XP_008770465
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 435,520 - 444,927 (-) NCBI mRatBN7.2 19 429,063 - 438,478 (-) NCBI Rnor_6.0 19 636,547 - 645,893 (-) NCBI
Sequence:
CGAGCGGACAGAACGGAGTCGGCAGGTGCAGGGCCGCGGAGACAGCAGCGGCATGACCGGCCACCACTGTTGGGGCTACGGCCAGGACGACGGCCCTTCAAATTGGCACAAGCTGTATCCCATCGCCC
hide sequence
RefSeq Acc Id:
XM_063277835 ⟹ XP_063133905
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 435,520 - 444,708 (-) NCBI
RefSeq Acc Id:
NP_001099635 ⟸ NM_001106165
- UniProtKB:
B2RZ61 (UniProtKB/TrEMBL), A6JXV1 (UniProtKB/TrEMBL), A0A8I6AD38 (UniProtKB/TrEMBL), F7FEQ2 (UniProtKB/TrEMBL)
- Sequence:
MTGHHCWGYGQDDGPSNWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELFYEACMSLSITNNGHSVQVDFNDSDDRTVVAGGPLEGPYRLKQLHFHWGKKRDVGSEHTVDGKSFPSELHLVHWNAK
hide sequence
RefSeq Acc Id:
XP_006255113 ⟸ XM_006255051
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AD38 (UniProtKB/TrEMBL)
- Sequence:
MSLSITNNGHSVQVDFNDSDDRTVVAGGPLEGPYRLKQLHFHWGKKRDVGSEHTVDGKSFPSEL
hide sequence
RefSeq Acc Id:
XP_008770465 ⟸ XM_008772243
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AD38 (UniProtKB/TrEMBL)
- Sequence:
MTGHHCWGYGQDDGPSNWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELFYEACMSLSITNN
hide sequence
Ensembl Acc Id:
ENSRNOP00000016521 ⟸ ENSRNOT00000016521
Ensembl Acc Id:
ENSRNOP00000091957 ⟸ ENSRNOT00000116794
RefSeq Acc Id:
XP_063133905 ⟸ XM_063277835
- Peptide Label:
isoform X3
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Car7
carbonic anhydrase 7
Car7_predicted
carbonic anhydrase 7 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Car7_predicted
carbonic anhydrase 7 (predicted)
Symbol and Name status set to approved
70820 APPROVED
