Symbol:
Imp3
Name:
IMP U3 small nucleolar ribonucleoprotein 3
RGD ID:
1306825
Description:
Predicted to be involved in ribosomal small subunit biogenesis. Predicted to act upstream of or within rRNA processing. Predicted to be located in cytosol; nucleolus; and nucleoplasm. Predicted to be part of Mpp10 complex and small-subunit processome. Orthologous to human IMP3 (IMP U3 small nucleolar ribonucleoprotein 3); PARTICIPATES IN ribosome biogenesis pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 3-chloropropane-1,2-diol.
Type:
protein-coding (Ensembl: pseudogene)
RefSeq Status:
PROVISIONAL
Previously known as:
IMP3, U3 small nucleolar ribonucleoprotein; IMP3, U3 small nucleolar ribonucleoprotein, homolog; IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast); LOC315697; RGD1306825; similar to RIKEN cDNA 1190002L16; U3 small nucleolar ribonucleoprotein protein IMP3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IMP3 (IMP U3 small nucleolar ribonucleoprotein 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Imp3 (IMP3, U3 small nucleolar ribonucleoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Imp3 (IMP U3 small nucleolar ribonucleoprotein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IMP3 (IMP U3 small nucleolar ribonucleoprotein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IMP3 (IMP U3 small nucleolar ribonucleoprotein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Imp3 (IMP U3 small nucleolar ribonucleoprotein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IMP3 (IMP U3 small nucleolar ribonucleoprotein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IMP3 (IMP U3 small nucleolar ribonucleoprotein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Imp3 (IMP U3 small nucleolar ribonucleoprotein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
IMP3 (IMP U3 small nucleolar ribonucleoprotein 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Imp3 (IMP3, U3 small nucleolar ribonucleoprotein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
imp3 (IMP U3 small nucleolar ribonucleoprotein 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
IMP3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C48B6.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4866
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 66,235,498 - 66,236,386 (+) NCBI GRCr8 mRatBN7.2 8 57,339,528 - 57,340,416 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 57,339,496 - 57,340,414 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 62,862,921 - 62,863,809 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 61,141,764 - 61,142,652 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 59,006,205 - 59,007,093 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 61,607,021 - 61,607,909 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 61,607,015 - 61,608,457 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 60,176,548 - 60,177,436 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 60,685,389 - 60,686,277 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 60,701,412 - 60,705,332 (+) NCBI Celera 8 56,807,836 - 56,808,724 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Imp3 Rat 17beta-estradiol affects expression ISO IMP3 (Homo sapiens) 6480464 Estradiol affects the expression of IMP3 mRNA CTD PMID:22574217 Imp3 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Imp3 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Imp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IMP3 mRNA CTD PMID:21215274 and PMID:33387578 Imp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of IMP3 mRNA CTD PMID:34747641 Imp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Imp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of IMP3 mRNA CTD PMID:21570461 Imp3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of IMP3 mRNA CTD PMID:21346803 Imp3 Rat 2-hydroxypropanoic acid decreases expression ISO IMP3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of IMP3 mRNA CTD PMID:30851411 Imp3 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of IMP3 protein CTD PMID:34915118 Imp3 Rat arsane multiple interactions ISO IMP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of IMP3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of IMP3 mRNA CTD PMID:39836092 Imp3 Rat arsenic atom multiple interactions ISO IMP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of IMP3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of IMP3 mRNA CTD PMID:39836092 Imp3 Rat atrazine decreases expression ISO IMP3 (Homo sapiens) 6480464 Atrazine results in decreased expression of IMP3 mRNA CTD PMID:22378314 Imp3 Rat bisphenol A increases expression ISO IMP3 (Homo sapiens) 6480464 bisphenol A results in increased expression of IMP3 mRNA CTD PMID:25047013 Imp3 Rat bisphenol A increases expression ISO Imp3 (Mus musculus) 6480464 bisphenol A results in increased expression of IMP3 mRNA CTD PMID:33221593 Imp3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IMP3 mRNA CTD PMID:34947998 Imp3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of IMP3 mRNA CTD PMID:25181051 more ... Imp3 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of IMP3 mRNA CTD PMID:24136188 Imp3 Rat cadmium atom increases expression ISO IMP3 (Homo sapiens) 6480464 Cadmium results in increased expression of IMP3 mRNA CTD PMID:24376830 Imp3 Rat cadmium dichloride decreases expression ISO IMP3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of IMP3 mRNA CTD PMID:38568856 Imp3 Rat carbon nanotube decreases expression ISO Imp3 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of IMP3 mRNA CTD PMID:25554681 Imp3 Rat CGP 52608 multiple interactions ISO IMP3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to IMP3 gene] CTD PMID:28238834 Imp3 Rat chloropicrin decreases expression ISO IMP3 (Homo sapiens) 6480464 chloropicrin results in decreased expression of IMP3 mRNA CTD PMID:26352163 Imp3 Rat cisplatin multiple interactions ISO IMP3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of IMP3 mRNA CTD PMID:27392435 Imp3 Rat cisplatin increases expression ISO IMP3 (Homo sapiens) 6480464 Cisplatin results in increased expression of IMP3 mRNA CTD PMID:27392435 Imp3 Rat clobetasol increases expression ISO Imp3 (Mus musculus) 6480464 Clobetasol results in increased expression of IMP3 mRNA CTD PMID:27462272 Imp3 Rat clofibrate multiple interactions ISO Imp3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of IMP3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of IMP3 mRNA] CTD PMID:17585979 Imp3 Rat clofibrate decreases expression ISO Imp3 (Mus musculus) 6480464 Clofibrate results in decreased expression of IMP3 mRNA CTD PMID:17585979 Imp3 Rat copper(II) sulfate decreases expression ISO IMP3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of IMP3 mRNA CTD PMID:19549813 Imp3 Rat cyclosporin A decreases expression ISO IMP3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of IMP3 mRNA CTD PMID:20106945 and PMID:25562108 Imp3 Rat DDE increases expression ISO IMP3 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of IMP3 mRNA CTD PMID:38568856 Imp3 Rat Dibutyl phosphate affects expression ISO IMP3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of IMP3 mRNA CTD PMID:37042841 Imp3 Rat doxorubicin decreases expression ISO IMP3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of IMP3 mRNA CTD PMID:29803840 Imp3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of IMP3 mRNA CTD PMID:29391264 Imp3 Rat ethyl methanesulfonate decreases expression ISO IMP3 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of IMP3 mRNA CTD PMID:23649840 Imp3 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of IMP3 mRNA CTD PMID:34044035 Imp3 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of IMP3 mRNA CTD PMID:24136188 Imp3 Rat formaldehyde decreases expression ISO IMP3 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of IMP3 mRNA CTD PMID:20655997 and PMID:23649840 Imp3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of IMP3 mRNA CTD PMID:33387578 Imp3 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of IMP3 mRNA CTD PMID:24136188 Imp3 Rat ivermectin decreases expression ISO IMP3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of IMP3 protein CTD PMID:32959892 Imp3 Rat leflunomide decreases expression ISO IMP3 (Homo sapiens) 6480464 leflunomide results in decreased expression of IMP3 mRNA CTD PMID:28988120 Imp3 Rat manganese atom multiple interactions ISO IMP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of IMP3 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of IMP3 mRNA CTD PMID:39836092 Imp3 Rat manganese(0) multiple interactions ISO IMP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of IMP3 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of IMP3 mRNA CTD PMID:39836092 Imp3 Rat manganese(II) chloride multiple interactions ISO IMP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of IMP3 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of IMP3 mRNA CTD PMID:39836092 Imp3 Rat methyl methanesulfonate decreases expression ISO IMP3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of IMP3 mRNA CTD PMID:23649840 Imp3 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of IMP3 mRNA CTD PMID:24136188 Imp3 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of IMP3 mRNA CTD PMID:24136188 Imp3 Rat nitrates multiple interactions ISO Imp3 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of IMP3 mRNA CTD PMID:35964746 Imp3 Rat paracetamol multiple interactions ISO Imp3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of IMP3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of IMP3 mRNA] CTD PMID:17585979 Imp3 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of IMP3 mRNA CTD PMID:19162173 Imp3 Rat quercetin decreases expression ISO IMP3 (Homo sapiens) 6480464 Quercetin results in decreased expression of IMP3 mRNA CTD PMID:21632981 Imp3 Rat rac-lactic acid decreases expression ISO IMP3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of IMP3 mRNA CTD PMID:30851411 Imp3 Rat silver atom decreases expression ISO IMP3 (Homo sapiens) 6480464 Silver results in decreased expression of IMP3 mRNA CTD PMID:26014281 Imp3 Rat silver(0) decreases expression ISO IMP3 (Homo sapiens) 6480464 Silver results in decreased expression of IMP3 mRNA CTD PMID:26014281 Imp3 Rat sodium arsenite decreases expression ISO IMP3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of IMP3 mRNA CTD PMID:38568856 Imp3 Rat sodium arsenite multiple interactions ISO IMP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of IMP3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of IMP3 mRNA CTD PMID:39836092 Imp3 Rat sodium arsenite increases expression ISO IMP3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of IMP3 mRNA CTD PMID:34032870 Imp3 Rat sunitinib increases expression ISO IMP3 (Homo sapiens) 6480464 Sunitinib results in increased expression of IMP3 mRNA CTD PMID:31533062 Imp3 Rat thiram decreases expression ISO IMP3 (Homo sapiens) 6480464 Thiram results in decreased expression of IMP3 mRNA CTD PMID:38568856 Imp3 Rat trichloroethene increases expression ISO Imp3 (Mus musculus) 6480464 Trichloroethylene results in increased expression of IMP3 mRNA CTD PMID:19448997 Imp3 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of IMP3 mRNA CTD PMID:33387578 Imp3 Rat tungsten increases expression ISO Imp3 (Mus musculus) 6480464 Tungsten results in increased expression of IMP3 mRNA CTD PMID:30912803 Imp3 Rat urethane decreases expression ISO IMP3 (Homo sapiens) 6480464 Urethane results in decreased expression of IMP3 mRNA CTD PMID:28818685 Imp3 Rat valproic acid increases expression ISO IMP3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of IMP3 mRNA CTD PMID:23179753
Imported Annotations - KEGG (archival)
17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) bisphenol A (EXP,ISO) buspirone (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) DDE (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) endosulfan (EXP) ethyl methanesulfonate (ISO) fipronil (EXP) flutamide (EXP) formaldehyde (ISO) gentamycin (EXP) glafenine (EXP) ivermectin (ISO) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methyl methanesulfonate (ISO) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) paracetamol (ISO) perfluorooctanoic acid (EXP) quercetin (ISO) rac-lactic acid (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sunitinib (ISO) thiram (ISO) trichloroethene (EXP,ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO)
Imp3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 66,235,498 - 66,236,386 (+) NCBI GRCr8 mRatBN7.2 8 57,339,528 - 57,340,416 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 57,339,496 - 57,340,414 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 62,862,921 - 62,863,809 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 61,141,764 - 61,142,652 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 59,006,205 - 59,007,093 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 61,607,021 - 61,607,909 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 61,607,015 - 61,608,457 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 60,176,548 - 60,177,436 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 60,685,389 - 60,686,277 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 60,701,412 - 60,705,332 (+) NCBI Celera 8 56,807,836 - 56,808,724 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
IMP3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 75,639,093 - 75,640,224 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 75,639,085 - 75,648,706 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 75,931,434 - 75,932,565 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 73,718,491 - 73,719,650 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 73,718,496 - 73,719,611 NCBI Celera 15 52,856,412 - 52,857,650 (-) NCBI Celera Cytogenetic Map 15 q24.2 NCBI HuRef 15 52,687,710 - 52,688,948 (-) NCBI HuRef CHM1_1 15 76,050,886 - 76,052,124 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 73,509,801 - 73,510,932 (-) NCBI T2T-CHM13v2.0
Imp3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 56,844,784 - 56,845,682 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 56,844,759 - 56,845,682 (+) Ensembl GRCm39 Ensembl GRCm38 9 56,937,500 - 56,938,398 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 56,937,475 - 56,938,398 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 56,785,307 - 56,786,205 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 56,735,637 - 56,736,535 (+) NCBI MGSCv36 mm8 Celera 9 54,162,594 - 54,163,492 (+) NCBI Celera Cytogenetic Map 9 B NCBI cM Map 9 30.53 NCBI
Imp3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955450 2,690,814 - 2,692,336 (+) NCBI ChiLan1.0 ChiLan1.0
IMP3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 64,832,715 - 64,842,117 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 68,996,613 - 68,998,203 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 54,547,455 - 54,548,633 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 74,140,632 - 74,141,810 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 74,141,156 - 74,141,710 (-) Ensembl panpan1.1 panPan2
IMP3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 38,431,236 - 38,432,107 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 38,424,520 - 38,432,143 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 38,361,474 - 38,362,342 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 38,636,569 - 38,637,437 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 38,635,297 - 38,637,365 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 38,588,052 - 38,588,920 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 38,633,621 - 38,634,489 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 38,870,376 - 38,871,244 (-) NCBI UU_Cfam_GSD_1.0
Imp3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 116,557,586 - 116,558,903 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 34,406,305 - 34,406,859 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 34,405,968 - 34,407,044 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IMP3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 58,023,368 - 58,024,496 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 58,023,368 - 58,024,496 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 62,712,260 - 62,713,388 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IMP3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 7,793,302 - 7,794,976 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 7,793,899 - 7,794,453 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 133,899,769 - 133,900,996 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Imp3
.
Predicted Target Of
Count of predictions: 315 Count of miRNA genes: 188 Interacting mature miRNAs: 220 Transcripts: ENSRNOT00000023456 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
RH128683
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 57,340,199 - 57,340,398 (+) MAPPER mRatBN7.2 Rnor_6.0 8 61,607,693 - 61,607,891 NCBI Rnor6.0 Rnor_5.0 8 60,177,220 - 60,177,418 UniSTS Rnor5.0 RGSC_v3.4 8 60,686,061 - 60,686,259 UniSTS RGSC3.4 Celera 8 56,808,508 - 56,808,706 UniSTS RH 3.4 Map 8 650.6 UniSTS Cytogenetic Map 8 q24 UniSTS
RH129738
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 57,340,092 - 57,340,306 (+) MAPPER mRatBN7.2 Rnor_6.0 8 61,607,586 - 61,607,799 NCBI Rnor6.0 Rnor_5.0 8 60,177,113 - 60,177,326 UniSTS Rnor5.0 RGSC_v3.4 8 60,685,954 - 60,686,167 UniSTS RGSC3.4 Celera 8 56,808,401 - 56,808,614 UniSTS RH 3.4 Map 4 169.9 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023456 ⟹ ENSRNOP00000023456
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 57,339,496 - 57,340,414 (+) Ensembl Rnor_6.0 Ensembl 8 61,607,015 - 61,608,457 (+) Ensembl
RefSeq Acc Id:
NM_001108152 ⟹ NP_001101622
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 66,235,498 - 66,236,386 (+) NCBI mRatBN7.2 8 57,339,528 - 57,340,416 (+) NCBI Rnor_6.0 8 61,607,021 - 61,607,909 (+) NCBI Rnor_5.0 8 60,176,548 - 60,177,436 (+) NCBI RGSC_v3.4 8 60,685,389 - 60,686,277 (+) RGD Celera 8 56,807,836 - 56,808,724 (+) RGD
Sequence:
TTCTCCATCATGGTGCGGAAGCTTAAGTTCCATGAGCAGAAGCTGCTGAAACAGGTGGACTTCCTAAACTGGGAAGTCACCGACCATAACCTTCACGAGCTGCGCGTACTGCGACGGTACGGGCTCCA
hide sequence
RefSeq Acc Id:
NP_001101622 ⟸ NM_001108152
- UniProtKB:
B2RZ12 (UniProtKB/TrEMBL)
- Sequence:
MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYGLQRREEYTRYNQLSRAVRELARRLRDLPERDPFRVRASAALLDKLYALGLVPTRGSLELCDSVSASSFCRRRLPTLLLKLRMAQHLQAAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000023456 ⟸ ENSRNOT00000023456
RGD ID: 13696003 Promoter ID: EPDNEW_R6528 Type: multiple initiation site Name: Imp3_1 Description: IMP3, U3 small nucleolar ribonucleoprotein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 61,606,997 - 61,607,057 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-10
Imp3
IMP U3 small nucleolar ribonucleoprotein 3
Imp3
IMP3, U3 small nucleolar ribonucleoprotein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2014-03-07
Imp3
IMP3, U3 small nucleolar ribonucleoprotein
Imp3
IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Imp3
IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)
Imp3_predicted
IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast) (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Imp3_predicted
IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast) (predicted)
RGD1306825_predicted
similar to RIKEN cDNA 1190002L16 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1306825_predicted
similar to RIKEN cDNA 1190002L16 (predicted)
LOC315697_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC315697_predicted
similar to RIKEN cDNA 1190002L16 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
