Symbol:
Klk8
Name:
kallikrein related-peptidase 8
RGD ID:
1305998
Description:
Predicted to enable serine-type endopeptidase activity. Predicted to be involved in several processes, including keratinocyte proliferation; memory; and neuron projection morphogenesis. Predicted to act upstream of or within synapse organization. Predicted to be located in cytoplasm. Predicted to be part of serine protease inhibitor complex. Predicted to be active in extracellular space and secretory granule. Orthologous to human KLK8 (kallikrein related peptidase 8); INTERACTS WITH acrylamide; ammonium chloride; benzo[a]pyrene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
brain serine protease 1; bsp1; kallikrein 8 (neuropsin/ovasin); kallikrein h; kallikrein-8; Klnh; LOC308565; neuropsin; NP; serine protease 19
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 103,388,352 - 103,395,195 (+) NCBI GRCr8 mRatBN7.2 1 94,251,803 - 94,258,646 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 94,251,803 - 94,258,646 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 99,637,211 - 99,644,054 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 108,109,882 - 108,116,725 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 101,399,519 - 101,406,395 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 99,735,168 - 99,742,011 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 99,734,993 - 99,742,009 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 100,803,926 - 100,810,769 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 94,227,185 - 94,234,028 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 94,305,772 - 94,312,139 (+) NCBI Celera 1 88,520,339 - 88,527,182 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Klk8 Rat 17alpha-ethynylestradiol affects expression ISO Klk8 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of KLK8 mRNA CTD PMID:17555576 Klk8 Rat 17alpha-ethynylestradiol multiple interactions ISO Klk8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of KLK8 mRNA CTD PMID:17942748 Klk8 Rat 17alpha-ethynylestradiol decreases expression ISO Klk8 (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of KLK8 mRNA CTD PMID:17942748 Klk8 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Klk8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of KLK8 mRNA CTD PMID:17942748 Klk8 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Klk8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KLK8 mRNA CTD PMID:21570461 Klk8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Klk8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KLK8 mRNA CTD PMID:17035482 Klk8 Rat 2-hydroxypropanoic acid decreases expression ISO KLK8 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of KLK8 mRNA CTD PMID:30851411 Klk8 Rat 4,4'-sulfonyldiphenol increases expression ISO Klk8 (Mus musculus) 6480464 bisphenol S results in increased expression of KLK8 mRNA CTD PMID:30951980 Klk8 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of KLK8 mRNA CTD PMID:28959563 Klk8 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KLK8 mRNA CTD PMID:16483693 Klk8 Rat arsane multiple interactions ISO KLK8 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLK8 mRNA CTD PMID:32525701 Klk8 Rat arsenic atom multiple interactions ISO KLK8 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLK8 mRNA CTD PMID:32525701 Klk8 Rat benzalkonium chloride increases expression ISO Klk8 (Mus musculus) 6480464 Benzalkonium Compounds results in increased expression of KLK8 mRNA CTD PMID:30171875 Klk8 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of KLK8 mRNA CTD PMID:21839799 Klk8 Rat benzo[a]pyrene affects methylation ISO KLK8 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KLK8 5' UTR and Benzo(a)pyrene affects the methylation of KLK8 promoter CTD PMID:27901495 Klk8 Rat benzo[a]pyrene decreases methylation ISO KLK8 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of KLK8 exon CTD PMID:27901495 Klk8 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KLK8 mRNA CTD PMID:25181051 Klk8 Rat bisphenol A increases expression ISO Klk8 (Mus musculus) 6480464 bisphenol A results in increased expression of KLK8 mRNA CTD PMID:32156529 Klk8 Rat butanal increases expression ISO KLK8 (Homo sapiens) 6480464 butyraldehyde results in increased expression of KLK8 mRNA CTD PMID:26079696 Klk8 Rat cadmium atom increases expression ISO KLK8 (Homo sapiens) 6480464 Cadmium results in increased expression of KLK8 mRNA CTD PMID:21120746 Klk8 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of KLK8 mRNA CTD PMID:33453195 Klk8 Rat calcitriol increases expression ISO KLK8 (Homo sapiens) 6480464 Calcitriol results in increased expression of KLK8 mRNA CTD PMID:26485663 Klk8 Rat calcium atom increases activity ISO KLK8 (Homo sapiens) 6480464 Calcium results in increased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat calcium dichloride increases activity ISO KLK8 (Homo sapiens) 6480464 Calcium Chloride results in increased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat calcium(0) increases activity ISO KLK8 (Homo sapiens) 6480464 Calcium results in increased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat carbon nanotube decreases expression ISO Klk8 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of KLK8 mRNA CTD PMID:25554681 Klk8 Rat chymostatin decreases activity ISO KLK8 (Homo sapiens) 6480464 chymostatin results in decreased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat cisplatin multiple interactions ISO KLK8 (Homo sapiens) 6480464 [Cisplatin co-treated with panobinostat] affects the expression of KLK8 mRNA CTD PMID:21791302 Klk8 Rat cisplatin affects response to substance ISO KLK8 (Homo sapiens) 6480464 KLK8 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Klk8 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of KLK8 mRNA CTD PMID:26577399 Klk8 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of KLK8 mRNA CTD PMID:23640034 Klk8 Rat diazinon increases methylation ISO KLK8 (Homo sapiens) 6480464 Diazinon results in increased methylation of KLK8 gene CTD PMID:22964155 Klk8 Rat dibenz[a,h]anthracene increases expression ISO Klk8 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Klk8 Rat diethylstilbestrol increases expression ISO Klk8 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of KLK8 mRNA CTD PMID:15171707 Klk8 Rat dorsomorphin multiple interactions ISO KLK8 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Klk8 Rat entinostat increases expression ISO KLK8 (Homo sapiens) 6480464 entinostat results in increased expression of KLK8 mRNA CTD PMID:26272509 and PMID:27188386 Klk8 Rat entinostat multiple interactions ISO KLK8 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KLK8 mRNA CTD PMID:27188386 Klk8 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of KLK8 mRNA CTD PMID:30307764 Klk8 Rat folic acid decreases expression ISO Klk8 (Mus musculus) 6480464 Folic Acid results in decreased expression of KLK8 mRNA CTD PMID:25629700 Klk8 Rat leupeptin decreases activity ISO KLK8 (Homo sapiens) 6480464 leupeptin results in decreased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat linsidomine increases oxidation EXP 6480464 linsidomine results in increased oxidation of KLK8 protein CTD PMID:28086193 Klk8 Rat magnesium atom increases activity ISO KLK8 (Homo sapiens) 6480464 Magnesium results in increased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat magnesium dichloride increases activity ISO KLK8 (Homo sapiens) 6480464 Magnesium Chloride results in increased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat magnesium sulfate increases activity ISO KLK8 (Homo sapiens) 6480464 Magnesium Sulfate results in increased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat mercury dibromide decreases expression ISO KLK8 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of KLK8 mRNA CTD PMID:26272509 Klk8 Rat mercury dibromide multiple interactions ISO KLK8 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KLK8 mRNA CTD PMID:27188386 Klk8 Rat methylmercury chloride decreases expression ISO KLK8 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of KLK8 mRNA CTD PMID:28001369 Klk8 Rat Monobutylphthalate decreases expression ISO Klk8 (Mus musculus) 6480464 monobutyl phthalate results in decreased expression of KLK8 mRNA CTD PMID:35278568 Klk8 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Klk8 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of KLK8 mRNA CTD PMID:27776689 Klk8 Rat nickel sulfate decreases activity ISO KLK8 (Homo sapiens) 6480464 nickel sulfate results in decreased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat ozone decreases expression ISO Klk8 (Mus musculus) 6480464 Ozone results in decreased expression of KLK8 mRNA CTD PMID:12763052 and PMID:33026818 Klk8 Rat panobinostat multiple interactions ISO KLK8 (Homo sapiens) 6480464 [Cisplatin co-treated with Panobinostat] affects the expression of KLK8 mRNA more ... CTD PMID:21791302 and PMID:27188386 Klk8 Rat panobinostat increases expression ISO KLK8 (Homo sapiens) 6480464 panobinostat results in increased expression of KLK8 mRNA CTD PMID:26272509 Klk8 Rat pentanal increases expression ISO KLK8 (Homo sapiens) 6480464 pentanal results in increased expression of KLK8 mRNA CTD PMID:26079696 Klk8 Rat perfluorohexanesulfonic acid increases expression ISO Klk8 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of KLK8 mRNA CTD PMID:37995155 Klk8 Rat permethrin increases expression ISO KLK8 (Homo sapiens) 6480464 Permethrin results in increased expression of KLK8 mRNA CTD PMID:37047231 Klk8 Rat phenylmercury acetate decreases expression ISO KLK8 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of KLK8 mRNA CTD PMID:26272509 Klk8 Rat phenylmercury acetate multiple interactions ISO KLK8 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KLK8 mRNA CTD PMID:27188386 Klk8 Rat potassium atom increases activity ISO KLK8 (Homo sapiens) 6480464 Potassium results in increased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat potassium chloride increases activity ISO KLK8 (Homo sapiens) 6480464 Potassium Chloride results in increased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat propanal increases expression ISO KLK8 (Homo sapiens) 6480464 propionaldehyde results in increased expression of KLK8 mRNA CTD PMID:26079696 Klk8 Rat rac-lactic acid decreases expression ISO KLK8 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of KLK8 mRNA CTD PMID:30851411 Klk8 Rat SB 431542 multiple interactions ISO KLK8 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Klk8 Rat sodium arsenate multiple interactions ISO KLK8 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLK8 mRNA CTD PMID:32525701 Klk8 Rat sodium arsenite affects methylation ISO KLK8 (Homo sapiens) 6480464 sodium arsenite affects the methylation of KLK8 gene CTD PMID:28589171 Klk8 Rat sodium arsenite increases expression ISO Klk8 (Mus musculus) 6480464 sodium arsenite results in increased expression of KLK8 mRNA CTD PMID:37682722 Klk8 Rat tamoxifen affects expression ISO Klk8 (Mus musculus) 6480464 Tamoxifen affects the expression of KLK8 mRNA CTD PMID:17555576 Klk8 Rat titanium dioxide decreases expression ISO Klk8 (Mus musculus) 6480464 titanium dioxide results in decreased expression of KLK8 mRNA CTD PMID:23557971 and PMID:29264374 Klk8 Rat titanium dioxide decreases methylation ISO Klk8 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KLK8 promoter CTD PMID:35295148 Klk8 Rat trichostatin A increases expression ISO KLK8 (Homo sapiens) 6480464 trichostatin A results in increased expression of KLK8 mRNA CTD PMID:24935251 Klk8 Rat triclosan increases expression ISO KLK8 (Homo sapiens) 6480464 Triclosan results in increased expression of KLK8 mRNA CTD PMID:30510588 Klk8 Rat valproic acid affects expression ISO KLK8 (Homo sapiens) 6480464 Valproic Acid affects the expression of KLK8 mRNA CTD PMID:25979313 Klk8 Rat valproic acid decreases expression ISO KLK8 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of KLK8 mRNA CTD PMID:28001369 Klk8 Rat valproic acid increases methylation ISO KLK8 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of KLK8 gene CTD PMID:29154799 Klk8 Rat zinc atom decreases activity ISO KLK8 (Homo sapiens) 6480464 Zinc results in decreased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat zinc sulfate decreases activity ISO KLK8 (Homo sapiens) 6480464 Zinc Sulfate results in decreased activity of KLK8 protein CTD PMID:16800733 Klk8 Rat zinc(0) decreases activity ISO KLK8 (Homo sapiens) 6480464 Zinc results in decreased activity of KLK8 protein CTD PMID:16800733
Biological Process
ERBB4 signaling pathway (ISO) keratinocyte proliferation (IEA,ISO,ISS) memory (IEA,ISO,ISS) neuron projection morphogenesis (IEA,ISO,ISS) protein maturation (IBA) proteolysis (IEA) regulation of synapse organization (IEA,ISO,ISS) response to wounding (IEA,ISO,ISS) synapse organization (IEA,ISO)
Klk8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 103,388,352 - 103,395,195 (+) NCBI GRCr8 mRatBN7.2 1 94,251,803 - 94,258,646 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 94,251,803 - 94,258,646 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 99,637,211 - 99,644,054 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 108,109,882 - 108,116,725 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 101,399,519 - 101,406,395 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 99,735,168 - 99,742,011 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 99,734,993 - 99,742,009 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 100,803,926 - 100,810,769 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 94,227,185 - 94,234,028 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 94,305,772 - 94,312,139 (+) NCBI Celera 1 88,520,339 - 88,527,182 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
KLK8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 50,996,008 - 51,001,604 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 50,996,007 - 51,002,711 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 51,499,264 - 51,504,860 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 56,191,076 - 56,196,770 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 19 48,551,304 - 48,557,002 (-) NCBI Celera Cytogenetic Map 19 q13.41 NCBI HuRef 19 47,832,022 - 47,837,724 (-) NCBI HuRef CHM1_1 19 51,501,264 - 51,506,956 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 54,084,477 - 54,090,075 (-) NCBI T2T-CHM13v2.0
Klk8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 43,447,001 - 43,453,250 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 43,447,001 - 43,453,250 (+) Ensembl GRCm39 Ensembl GRCm38 7 43,797,532 - 43,803,826 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 43,797,577 - 43,803,826 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 51,052,947 - 51,059,192 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 43,665,619 - 43,671,864 (+) NCBI MGSCv36 mm8 Celera 7 39,264,227 - 39,270,471 (+) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 28.26 NCBI
Klk8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955558 1,479,465 - 1,484,244 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955558 1,479,383 - 1,484,209 (+) NCBI ChiLan1.0 ChiLan1.0
KLK8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 57,064,435 - 57,071,926 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 58,985,935 - 58,993,429 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 47,963,060 - 47,969,065 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 56,832,643 - 56,858,549 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 56,852,838 - 56,858,549 (-) Ensembl panpan1.1 panPan2
KLK8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 105,874,788 - 105,880,788 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 105,874,328 - 105,894,933 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 105,447,690 - 105,453,149 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 106,383,585 - 106,389,592 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 106,383,023 - 106,389,606 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 106,055,527 - 106,060,983 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 105,696,936 - 105,702,365 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 106,492,411 - 106,497,865 (+) NCBI UU_Cfam_GSD_1.0
Klk8
KLK8
KLK8 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 44,015,996 - 44,021,665 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 44,016,005 - 44,021,943 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 24,042,323 - 24,048,366 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Klk8
.
Predicted Target Of
Count of predictions: 59 Count of miRNA genes: 56 Interacting mature miRNAs: 59 Transcripts: ENSRNOT00000025174 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
2
50
23
34
8
7
8
6
57
10
43
30
42
26
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025174 ⟹ ENSRNOP00000025174
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 94,251,803 - 94,258,646 (+) Ensembl Rnor_6.0 Ensembl 1 99,734,993 - 99,742,009 (+) Ensembl
RefSeq Acc Id:
NM_001107509 ⟹ NP_001100979
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 103,388,352 - 103,395,195 (+) NCBI mRatBN7.2 1 94,251,803 - 94,258,646 (+) NCBI Rnor_6.0 1 99,735,168 - 99,742,011 (+) NCBI Rnor_5.0 1 100,803,926 - 100,810,769 (+) NCBI RGSC_v3.4 1 94,227,185 - 94,234,028 (+) RGD Celera 1 88,520,339 - 88,527,182 (+) RGD
Sequence:
GACACACCGAAGGGAAGTCCGGGGGCCGCTTCCACCGAGTCCGAGTGACCCCGCCCCCTGCATTCTGGAAGGTGAGGCGCAGAAGTCCCCAGACATGGACCTCAGGCGCAGGGACTTTCCCCTTCCGT
hide sequence
RefSeq Acc Id:
XM_063261767 ⟹ XP_063117837
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 103,388,356 - 103,395,195 (+) NCBI
RefSeq Acc Id:
XM_063261770 ⟹ XP_063117840
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 103,388,361 - 103,395,195 (+) NCBI
RefSeq Acc Id:
NP_001100979 ⟸ NM_001107509
- Peptide Label:
precursor
- UniProtKB:
O88780 (UniProtKB/Swiss-Prot), G3V8E9 (UniProtKB/TrEMBL), A6JAK0 (UniProtKB/TrEMBL)
- Sequence:
MGRPPPCAIQTWILLFLLMGAWAGLTRAQGSKILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTAAHCKKDKYSVRLGDHSLQKRDEPEQEIQVARSIQHPCFNSSNPEDHSHDIMLIRLQN
hide sequence
Ensembl Acc Id:
ENSRNOP00000025174 ⟸ ENSRNOT00000025174
RefSeq Acc Id:
XP_063117837 ⟸ XM_063261767
- Peptide Label:
isoform X1
- UniProtKB:
O88780 (UniProtKB/Swiss-Prot), A6JAK0 (UniProtKB/TrEMBL), G3V8E9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117840 ⟸ XM_063261770
- Peptide Label:
isoform X1
- UniProtKB:
O88780 (UniProtKB/Swiss-Prot), A6JAK0 (UniProtKB/TrEMBL), G3V8E9 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Klk8
kallikrein related-peptidase 8
Klk8
kallikrein 8 (neuropsin/ovasin)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Klk8
kallikrein 8 (neuropsin/ovasin)
Klk8_predicted
kallikrein 8 (neuropsin/ovasin) (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Klk8_predicted
kallikrein 8 (neuropsin/ovasin) (predicted)
Symbol and Name status set to approved
70820 APPROVED
