Symbol:
Fahd1
Name:
fumarylacetoacetate hydrolase domain containing 1
RGD ID:
1304560
Description:
Predicted to enable hydrolase activity, acting on acid carbon-carbon bonds, in ketonic substances; oxaloacetate decarboxylase activity; and oxaloacetate tautomerase activity. Predicted to be involved in oxaloacetate metabolic process and pyruvate metabolic process. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in mitochondrion. Orthologous to human FAHD1 (fumarylacetoacetate hydrolase domain containing 1); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
acylpyruvase FAHD1, mitochondrial; fumarylacetoacetate hydrolase domain-containing protein 1; LOC302980; OAA decarboxylase; oxaloacetate decarboxylase; oxaloacetate decarboxylase, mitochondrial; oxaloacetate tautomerase FAHD1, mitochondrial; RGD1304560; similar to RIKEN cDNA 1110025H10
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FAHD1 (fumarylacetoacetate hydrolase domain containing 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Fahd1 (fumarylacetoacetate hydrolase domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fahd1 (fumarylacetoacetate hydrolase domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100975679 (acylpyruvase FAHD1, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FAHD1 (fumarylacetoacetate hydrolase domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fahd1 (fumarylacetoacetate hydrolase domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FAHD1 (fumarylacetoacetate hydrolase domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FAHD1 (fumarylacetoacetate hydrolase domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fahd1 (fumarylacetoacetate hydrolase domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
FAHD1 (fumarylacetoacetate hydrolase domain containing 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fahd1 (fumarylacetoacetate hydrolase domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fahd1 (fumarylacetoacetate hydrolase domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
FMP41
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG5793
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
fahd-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fahd1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Candidate Gene For:
Alc5 Alc9
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,378,058 - 14,379,497 (-) NCBI GRCr8 mRatBN7.2 10 13,873,539 - 13,874,978 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,873,527 - 13,875,012 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,620,597 - 18,622,036 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 18,109,457 - 18,110,896 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,608,674 - 13,610,113 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 14,214,518 - 14,215,957 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 14,214,519 - 14,215,957 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 14,030,533 - 14,031,972 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 14,101,624 - 14,103,063 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 14,101,624 - 14,103,063 (-) NCBI Celera 10 13,552,748 - 13,554,187 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fahd1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FAHD1 mRNA] CTD PMID:31150632 Fahd1 Rat (1->4)-beta-D-glucan multiple interactions ISO Fahd1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of FAHD1 mRNA CTD PMID:36331819 Fahd1 Rat 1,2-dimethylhydrazine decreases expression ISO Fahd1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of FAHD1 mRNA CTD PMID:22206623 Fahd1 Rat 1,2-dimethylhydrazine multiple interactions ISO Fahd1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of FAHD1 mRNA CTD PMID:22206623 Fahd1 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of FAHD1 mRNA CTD PMID:25380136 and PMID:30723492 Fahd1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of FAHD1 protein CTD PMID:32145629 Fahd1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FAHD1 mRNA CTD PMID:21215274 and PMID:33387578 Fahd1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fahd1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FAHD1 mRNA CTD PMID:21570461 Fahd1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of FAHD1 protein CTD PMID:26597043 Fahd1 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of FAHD1 mRNA CTD PMID:25380136 Fahd1 Rat 4,4'-sulfonyldiphenol increases expression ISO Fahd1 (Mus musculus) 6480464 bisphenol S results in increased expression of FAHD1 mRNA CTD PMID:39298647 Fahd1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of FAHD1 mRNA CTD PMID:31881176 Fahd1 Rat aflatoxin B1 decreases methylation ISO FAHD1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of FAHD1 gene CTD PMID:27153756 Fahd1 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of FAHD1 mRNA CTD PMID:21839799 Fahd1 Rat benzo[a]pyrene decreases expression ISO FAHD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of FAHD1 mRNA CTD PMID:32234424 Fahd1 Rat benzo[a]pyrene increases methylation ISO FAHD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FAHD1 3' UTR CTD PMID:27901495 Fahd1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO FAHD1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Fahd1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FAHD1 mRNA and bisphenol A results in increased expression of FAHD1 protein CTD PMID:25181051 and PMID:32145629 Fahd1 Rat bisphenol A decreases expression ISO FAHD1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of FAHD1 mRNA CTD PMID:33670352 Fahd1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FAHD1 mRNA CTD PMID:30816183 and PMID:32528016 Fahd1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of FAHD1 gene CTD PMID:28505145 Fahd1 Rat bisphenol AF increases expression ISO FAHD1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of FAHD1 protein CTD PMID:34186270 Fahd1 Rat Bisphenol B increases expression ISO FAHD1 (Homo sapiens) 6480464 bisphenol B results in increased expression of FAHD1 protein CTD PMID:34186270 Fahd1 Rat bisphenol F increases expression ISO FAHD1 (Homo sapiens) 6480464 bisphenol F results in increased expression of FAHD1 protein CTD PMID:34186270 Fahd1 Rat cadmium atom increases expression ISO FAHD1 (Homo sapiens) 6480464 Cadmium results in increased expression of FAHD1 mRNA CTD PMID:24376830 Fahd1 Rat carteolol affects expression ISO FAHD1 (Homo sapiens) 6480464 Carteolol affects the expression of FAHD1 mRNA CTD PMID:37120125 Fahd1 Rat ciguatoxin CTX1B affects expression ISO Fahd1 (Mus musculus) 6480464 Ciguatoxins affects the expression of FAHD1 mRNA CTD PMID:18353800 Fahd1 Rat clofibrate increases expression ISO Fahd1 (Mus musculus) 6480464 Clofibrate results in increased expression of FAHD1 mRNA CTD PMID:17585979 Fahd1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of FAHD1 mRNA CTD PMID:24386269 Fahd1 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of FAHD1 protein CTD PMID:25100957 Fahd1 Rat copper(II) sulfate decreases expression ISO FAHD1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of FAHD1 mRNA CTD PMID:19549813 Fahd1 Rat cyclosporin A decreases expression ISO FAHD1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FAHD1 mRNA CTD PMID:25562108 Fahd1 Rat Dibutyl phosphate affects expression ISO FAHD1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of FAHD1 mRNA CTD PMID:37042841 Fahd1 Rat dibutyl phthalate decreases expression ISO Fahd1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of FAHD1 mRNA CTD PMID:21266533 Fahd1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of FAHD1 mRNA CTD PMID:29391264 Fahd1 Rat folic acid decreases expression ISO Fahd1 (Mus musculus) 6480464 Folic Acid results in decreased expression of FAHD1 mRNA CTD PMID:25629700 Fahd1 Rat folic acid multiple interactions ISO Fahd1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of FAHD1 mRNA CTD PMID:22206623 Fahd1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of FAHD1 mRNA CTD PMID:25539665 and PMID:26194646 Fahd1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of FAHD1 mRNA CTD PMID:33387578 Fahd1 Rat glutathione decreases expression EXP 6480464 Glutathione deficiency results in decreased expression of FAHD1 mRNA CTD PMID:20621112 Fahd1 Rat ivermectin decreases expression ISO FAHD1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of FAHD1 protein CTD PMID:32959892 Fahd1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of FAHD1 mRNA CTD PMID:30467583 Fahd1 Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of FAHD1 mRNA CTD PMID:21515302 Fahd1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Fahd1 (Mus musculus) 6480464 [MYBPC3 protein affects the susceptibility to benzyloxycarbonylleucyl-leucyl-leucine aldehyde] which results in decreased expression of FAHD1 mRNA CTD PMID:25566086 Fahd1 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of FAHD1 mRNA CTD PMID:19638242 Fahd1 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of FAHD1 mRNA CTD PMID:25380136 Fahd1 Rat nickel atom multiple interactions ISO FAHD1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of FAHD1 mRNA] CTD PMID:14575637 Fahd1 Rat nickel atom affects expression ISO FAHD1 (Homo sapiens) 6480464 Nickel affects the expression of FAHD1 mRNA CTD PMID:14575637 Fahd1 Rat ochratoxin A decreases expression ISO FAHD1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of FAHD1 mRNA CTD PMID:22124623 Fahd1 Rat paracetamol affects expression ISO Fahd1 (Mus musculus) 6480464 Acetaminophen affects the expression of FAHD1 mRNA CTD PMID:17562736 Fahd1 Rat paracetamol decreases expression ISO FAHD1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of FAHD1 mRNA CTD PMID:21420995 and PMID:25704631 Fahd1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of FAHD1 mRNA CTD PMID:32479839 and PMID:33387578 Fahd1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Fahd1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of FAHD1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of FAHD1 mRNA CTD PMID:36331819 Fahd1 Rat perfluorooctanoic acid increases expression ISO FAHD1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of FAHD1 protein CTD PMID:26879310 Fahd1 Rat phenobarbital decreases expression ISO Fahd1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of FAHD1 mRNA CTD PMID:19482888 Fahd1 Rat phenobarbital affects expression ISO FAHD1 (Homo sapiens) 6480464 Phenobarbital affects the expression of FAHD1 mRNA CTD PMID:19159669 Fahd1 Rat phenobarbital multiple interactions ISO Fahd1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of FAHD1 mRNA] CTD PMID:19482888 Fahd1 Rat pirinixic acid multiple interactions ISO Fahd1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of FAHD1 mRNA and [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of FAHD1 mRNA CTD PMID:19710929 Fahd1 Rat pirinixic acid decreases expression ISO Fahd1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of FAHD1 mRNA CTD PMID:18445702 Fahd1 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Fahd1 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of FAHD1 mRNA CTD PMID:28903501 Fahd1 Rat propiconazole decreases expression ISO Fahd1 (Mus musculus) 6480464 propiconazole results in decreased expression of FAHD1 mRNA CTD PMID:21278054 Fahd1 Rat silicon dioxide decreases expression ISO Fahd1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of FAHD1 mRNA CTD PMID:23221170 Fahd1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of FAHD1 protein CTD PMID:29459688 Fahd1 Rat sodium arsenite decreases expression ISO FAHD1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of FAHD1 mRNA CTD PMID:38568856 Fahd1 Rat sunitinib increases expression ISO FAHD1 (Homo sapiens) 6480464 Sunitinib results in increased expression of FAHD1 mRNA CTD PMID:31533062 Fahd1 Rat tamoxifen affects expression ISO Fahd1 (Mus musculus) 6480464 Tamoxifen affects the expression of FAHD1 mRNA CTD PMID:20937368 Fahd1 Rat tetrachloromethane decreases expression ISO Fahd1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of FAHD1 mRNA CTD PMID:27339419 and PMID:31919559 Fahd1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FAHD1 mRNA] CTD PMID:31150632 Fahd1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of FAHD1 mRNA CTD PMID:31150632 and PMID:33387578 Fahd1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of FAHD1 mRNA CTD PMID:23411599 and PMID:34492290 Fahd1 Rat thiram decreases expression ISO FAHD1 (Homo sapiens) 6480464 Thiram results in decreased expression of FAHD1 mRNA CTD PMID:38568856 Fahd1 Rat titanium dioxide decreases methylation ISO Fahd1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FAHD1 gene CTD PMID:35295148 Fahd1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of FAHD1 mRNA CTD PMID:33387578 Fahd1 Rat trichostatin A multiple interactions ISO FAHD1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of FAHD1 mRNA] CTD PMID:14575637 Fahd1 Rat triphenyl phosphate affects expression ISO FAHD1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of FAHD1 mRNA CTD PMID:37042841 Fahd1 Rat urethane decreases expression ISO FAHD1 (Homo sapiens) 6480464 Urethane results in decreased expression of FAHD1 mRNA CTD PMID:28818685 Fahd1 Rat valproic acid affects expression ISO FAHD1 (Homo sapiens) 6480464 Valproic Acid affects the expression of FAHD1 mRNA CTD PMID:25979313 Fahd1 Rat valproic acid increases expression ISO FAHD1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FAHD1 mRNA CTD PMID:23179753 and PMID:27188386 Fahd1 Rat vancomycin increases expression ISO Fahd1 (Mus musculus) 6480464 Vancomycin results in increased expression of FAHD1 mRNA CTD PMID:18930951
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) carteolol (ISO) ciguatoxin CTX1B (ISO) clofibrate (ISO) cobalt dichloride (EXP) cocaine (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) endosulfan (EXP) folic acid (ISO) furan (EXP) gentamycin (EXP) glutathione (EXP) ivermectin (ISO) methapyrilene (EXP) Muraglitazar (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nickel atom (ISO) ochratoxin A (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) propiconazole (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sunitinib (ISO) tamoxifen (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO)
Fahd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,378,058 - 14,379,497 (-) NCBI GRCr8 mRatBN7.2 10 13,873,539 - 13,874,978 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,873,527 - 13,875,012 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,620,597 - 18,622,036 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 18,109,457 - 18,110,896 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,608,674 - 13,610,113 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 14,214,518 - 14,215,957 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 14,214,519 - 14,215,957 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 14,030,533 - 14,031,972 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 14,101,624 - 14,103,063 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 14,101,624 - 14,103,063 (-) NCBI Celera 10 13,552,748 - 13,554,187 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
FAHD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 1,827,206 - 1,840,207 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 1,826,967 - 1,840,207 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 1,877,207 - 1,890,208 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 1,817,226 - 1,830,173 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 1,817,225 - 1,818,909 NCBI Celera 16 2,089,471 - 2,102,473 (+) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 1,800,249 - 1,813,209 (+) NCBI HuRef CHM1_1 16 1,877,193 - 1,890,193 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 1,842,993 - 1,856,076 (+) NCBI T2T-CHM13v2.0
Fahd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 25,067,866 - 25,069,276 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 25,067,866 - 25,069,338 (-) Ensembl GRCm39 Ensembl GRCm38 17 24,848,896 - 24,850,302 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 24,848,892 - 24,850,364 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 24,985,841 - 24,987,247 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 24,565,856 - 24,577,737 (-) NCBI MGSCv36 mm8 Celera 17 25,375,861 - 25,377,266 (-) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 12.53 NCBI
Fahd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955442 15,450,066 - 15,451,797 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100975679 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 2,093,654 - 2,099,243 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 5,874,794 - 5,887,000 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 449,359 - 451,070 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3
FAHD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 39,082,536 - 39,084,248 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 39,070,562 - 39,083,971 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 40,321,707 - 40,323,374 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 39,399,045 - 39,400,712 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 6 39,075,779 - 39,077,446 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 39,048,338 - 39,050,005 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 39,527,051 - 39,528,718 (-) NCBI UU_Cfam_GSD_1.0
Fahd1
FAHD1
FAHD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 1,731,150 - 1,732,086 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 1,731,239 - 1,731,913 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 29,351,613 - 29,352,918 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fahd1
.
Predicted Target Of
Count of predictions: 17 Count of miRNA genes: 17 Interacting mature miRNAs: 17 Transcripts: ENSRNOT00000019767 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 737820 Alc9 Alcohol consumption QTL 9 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 19233348 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 631828 Alc5 Alcohol consumption QTL 5 2.4 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 17245662 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631660 Hcar1 Hepatocarcinoma resistance QTL 1 3.4 0.0001 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 10 6154182 15990232 Rat 1576304 Schws7 Schwannoma susceptibility QTL 7 0.0115 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 4765527 19816042 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat
RH133587
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 13,873,671 - 13,873,891 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,214,651 - 14,214,870 NCBI Rnor6.0 Rnor_5.0 10 14,030,666 - 14,030,885 UniSTS Rnor5.0 RGSC_v3.4 10 14,101,757 - 14,101,976 UniSTS RGSC3.4 Celera 10 13,552,881 - 13,553,100 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019767 ⟹ ENSRNOP00000019767
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 13,873,527 - 13,875,012 (-) Ensembl Rnor_6.0 Ensembl 10 14,214,519 - 14,215,957 (-) Ensembl
RefSeq Acc Id:
NM_001024991 ⟹ NP_001020162
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 14,378,058 - 14,379,497 (-) NCBI mRatBN7.2 10 13,873,539 - 13,874,978 (-) NCBI Rnor_6.0 10 14,214,518 - 14,215,957 (-) NCBI Rnor_5.0 10 14,030,533 - 14,031,972 (-) NCBI RGSC_v3.4 10 14,101,624 - 14,103,063 (-) RGD Celera 10 13,552,748 - 13,554,187 (-) RGD
Sequence:
GGAAGTAGGTGGAGAAGGAGGTGGGAGGCTAAGCGTGCGCCTCCTGGTCTCTCTGGGGCAGTCGCCCGCGCGCCAAGACCTTTCGCTGACCTCAGCGTCCCGCTGCTGCGCAAGGAAGGGCGGGGCCA
hide sequence
RefSeq Acc Id:
NP_001020162 ⟸ NM_001024991
- UniProtKB:
Q6AYQ8 (UniProtKB/Swiss-Prot), A6HCX6 (UniProtKB/TrEMBL)
- Sequence:
MASTKPLSRFWEWGKNIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGRRGEAVPEAAAMDYVAGYALCLDMTARDVQDECKKKGLPWTLAKSFTSSCPV
hide sequence
Ensembl Acc Id:
ENSRNOP00000019767 ⟸ ENSRNOT00000019767
RGD ID: 13697029 Promoter ID: EPDNEW_R7554 Type: multiple initiation site Name: Fahd1_1 Description: fumarylacetoacetate hydrolase domain containing 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 14,215,968 - 14,216,028 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Fahd1
fumarylacetoacetate hydrolase domain containing 1
RGD1304560
similar to RIKEN cDNA 1110025H10
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1304560
similar to RIKEN cDNA 1110025H10
RGD1304560_predicted
similar to RIKEN cDNA 1110025H10 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1304560_predicted
similar to RIKEN cDNA 1110025H10 (predicted)
LOC302980_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC302980_predicted
similar to RIKEN cDNA 1110025H10 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
