Symbol:
Abca7
Name:
ATP binding cassette subfamily A member 7
RGD ID:
1303134
Description:
Predicted to enable ATPase-coupled transmembrane transporter activity; apolipoprotein A-I receptor activity; and floppase activity. Predicted to be involved in several processes, including phospholipid transport; positive regulation of transport; and regulation of intracellular signal transduction. Predicted to be located in several cellular components, including apical plasma membrane; phagocytic cup; and ruffle membrane. Predicted to be active in intracellular membrane-bounded organelle. Human ortholog(s) of this gene implicated in Alzheimer's disease 9. Orthologous to human ABCA7 (ATP binding cassette subfamily A member 7); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ATP-binding cassette sub-family A member 7; ATP-binding cassette, sub-family A (ABC1), member 7; ATP-binding cassette, sub-family A, member 7; ATP-binding cassette, subfamily A (ABC1), member 7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ABCA7 (ATP binding cassette subfamily A member 7) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Abca7 (ATP-binding cassette, sub-family A member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Abca7 (ATP binding cassette subfamily A member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ABCA7 (ATP binding cassette subfamily A member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ABCA7 (ATP binding cassette subfamily A member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Abca7 (ATP binding cassette subfamily A member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ABCA7 (ATP binding cassette subfamily A member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ABCA7 (ATP binding cassette subfamily A member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Abca7 (ATP binding cassette subfamily A member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Abca7 (ATP-binding cassette, sub-family A member 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ABCA7 (ATP binding cassette subfamily A member 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
abt-2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|SonicParanoid)
Danio rerio (zebrafish):
abca7
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 10,342,092 - 10,362,094 (-) NCBI GRCr8 mRatBN7.2 7 9,691,452 - 9,711,466 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 9,691,449 - 9,711,425 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 12,573,976 - 12,592,469 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 14,449,312 - 14,467,805 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 12,310,438 - 12,328,932 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 12,742,433 - 12,762,423 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 12,742,433 - 12,762,341 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 12,912,155 - 12,932,147 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 11,203,983 - 11,222,960 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 11,203,982 - 11,222,960 (-) NCBI Celera 7 7,867,206 - 7,885,960 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Abca7 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1552857 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ABCA7 mRNA CTD PMID:36331819 Abca7 Rat (2,4,5-trichlorophenoxy)acetic acid increases expression ISO RGD:1552857 6480464 2,4,5-Trichlorophenoxyacetic Acid results in increased expression of ABCA7 mRNA CTD PMID:18579281 Abca7 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1552857 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ABCA7 mRNA CTD PMID:22206623 Abca7 Rat 17alpha-ethynylestradiol affects expression ISO RGD:1552857 6480464 Ethinyl Estradiol affects the expression of ABCA7 mRNA CTD PMID:17555576 Abca7 Rat 17beta-estradiol decreases expression ISO RGD:1552857 6480464 Estradiol results in decreased expression of ABCA7 mRNA CTD PMID:39298647 Abca7 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of ABCA7 mRNA CTD PMID:27291303 Abca7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552857 6480464 Tetrachlorodibenzodioxin affects the expression of ABCA7 mRNA CTD PMID:21570461 Abca7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ABCA7 mRNA CTD PMID:33387578 Abca7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1552857 6480464 Tetrachlorodibenzodioxin results in decreased expression of ABCA7 mRNA CTD PMID:24680724 Abca7 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of ABCA7 mRNA CTD PMID:21346803 Abca7 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1552857 6480464 bisphenol S results in decreased expression of ABCA7 mRNA CTD PMID:39298647 Abca7 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1552857 6480464 bisphenol S affects the methylation of ABCA7 gene CTD PMID:31683443 Abca7 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ABCA7 mRNA CTD PMID:24780913 Abca7 Rat acrylamide decreases expression ISO RGD:1601775 6480464 Acrylamide results in decreased expression of ABCA7 mRNA CTD PMID:32763439 Abca7 Rat aflatoxin B1 increases expression ISO RGD:1552857 6480464 Aflatoxin B1 results in increased expression of ABCA7 mRNA CTD PMID:19770486 Abca7 Rat all-trans-retinoic acid increases expression ISO RGD:1601775 6480464 Tretinoin results in increased expression of ABCA7 mRNA CTD PMID:23724009|PMID:33167477 Abca7 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of ABCA7 mRNA CTD PMID:35163327 Abca7 Rat antirheumatic drug decreases expression ISO RGD:1601775 6480464 Antirheumatic Agents results in decreased expression of ABCA7 mRNA CTD PMID:24449571 Abca7 Rat aristolochic acid A increases expression ISO RGD:1601775 6480464 aristolochic acid I results in increased expression of ABCA7 mRNA CTD PMID:33212167 Abca7 Rat arsane multiple interactions ISO RGD:1601775 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Abca7 Rat arsenic atom multiple interactions ISO RGD:1601775 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Abca7 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ABCA7 gene CTD PMID:28931070 Abca7 Rat benzo[b]fluoranthene increases expression ISO RGD:1552857 6480464 benzo(b)fluoranthene results in increased expression of ABCA7 mRNA CTD PMID:26377693 Abca7 Rat bisphenol A affects expression ISO RGD:1601775 6480464 bisphenol A affects the expression of ABCA7 mRNA CTD PMID:22574217 Abca7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ABCA7 mRNA CTD PMID:30816183|PMID:32528016 Abca7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ABCA7 mRNA CTD PMID:25181051 Abca7 Rat bisphenol F decreases expression ISO RGD:1552857 6480464 bisphenol F results in decreased expression of ABCA7 mRNA CTD PMID:38685157 Abca7 Rat cadmium dichloride affects methylation EXP 6480464 Cadmium Chloride affects the methylation of ABCA7 promoter CTD PMID:22457795 Abca7 Rat cadmium dichloride increases expression ISO RGD:1601775 6480464 Cadmium Chloride results in increased expression of ABCA7 mRNA CTD PMID:38568856 Abca7 Rat carbon nanotube decreases expression ISO RGD:1552857 6480464 Nanotubes, Carbon analog results in decreased expression of ABCA7 mRNA CTD PMID:25620056 Abca7 Rat chromium(6+) affects expression ISO RGD:1552857 6480464 chromium hexavalent ion affects the expression of ABCA7 mRNA CTD PMID:28472532 Abca7 Rat cisplatin multiple interactions ISO RGD:1601775 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ABCA7 mRNA CTD PMID:27392435 Abca7 Rat cisplatin increases expression ISO RGD:1601775 6480464 Cisplatin results in increased expression of ABCA7 mRNA CTD PMID:27392435 Abca7 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of ABCA7 mRNA CTD PMID:24386269 Abca7 Rat copper(II) sulfate increases expression ISO RGD:1601775 6480464 Copper Sulfate results in increased expression of ABCA7 mRNA CTD PMID:19549813 Abca7 Rat copper(II) sulfate increases expression ISO RGD:1552857 6480464 Copper Sulfate results in increased expression of ABCA7 mRNA CTD PMID:18579281 Abca7 Rat diuron decreases expression ISO RGD:1601775 6480464 Diuron results in decreased expression of ABCA7 mRNA CTD PMID:35967413 Abca7 Rat doxorubicin decreases expression ISO RGD:1601775 6480464 Doxorubicin results in decreased expression of ABCA7 mRNA CTD PMID:29803840 Abca7 Rat elemental selenium increases expression ISO RGD:1601775 6480464 Selenium results in increased expression of ABCA7 mRNA CTD PMID:19244175 Abca7 Rat ethanol increases expression ISO RGD:1552857 6480464 Ethanol results in increased expression of ABCA7 mRNA CTD PMID:30319688 Abca7 Rat ethyl methanesulfonate increases expression ISO RGD:1601775 6480464 Ethyl Methanesulfonate results in increased expression of ABCA7 mRNA CTD PMID:23649840 Abca7 Rat folic acid multiple interactions ISO RGD:1552857 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ABCA7 mRNA CTD PMID:22206623 Abca7 Rat FR900359 increases phosphorylation ISO RGD:1601775 6480464 FR900359 results in increased phosphorylation of ABCA7 protein CTD PMID:37730182 Abca7 Rat maleic acid increases expression ISO RGD:1601775 6480464 maleic acid results in increased expression of ABCA7 mRNA CTD PMID:28392987 Abca7 Rat manganese atom multiple interactions ISO RGD:1601775 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Abca7 Rat manganese(0) multiple interactions ISO RGD:1601775 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Abca7 Rat manganese(II) chloride multiple interactions ISO RGD:1601775 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Abca7 Rat mono(2-ethylhexyl) phthalate decreases expression ISO RGD:1552857 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of ABCA7 mRNA CTD PMID:22401849 Abca7 Rat ozone multiple interactions ISO RGD:1601775 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ABCA7 mRNA CTD PMID:35430440 Abca7 Rat paclitaxel increases expression ISO RGD:1601775 6480464 Paclitaxel results in increased expression of ABCA7 mRNA CTD PMID:20737486 Abca7 Rat paracetamol affects expression ISO RGD:1552857 6480464 Acetaminophen affects the expression of ABCA7 mRNA CTD PMID:17562736 Abca7 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1552857 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ABCA7 mRNA CTD PMID:36331819 Abca7 Rat pirinixic acid decreases expression ISO RGD:1552857 6480464 pirinixic acid results in decreased expression of ABCA7 mRNA CTD PMID:17426115 Abca7 Rat quercetin decreases expression ISO RGD:1601775 6480464 Quercetin results in decreased expression of ABCA7 mRNA CTD PMID:21632981 Abca7 Rat selenium atom increases expression ISO RGD:1601775 6480464 Selenium results in increased expression of ABCA7 mRNA CTD PMID:19244175 Abca7 Rat sodium arsenite decreases expression ISO RGD:1601775 6480464 sodium arsenite results in decreased expression of ABCA7 mRNA CTD PMID:38568856 Abca7 Rat sodium arsenite multiple interactions ISO RGD:1601775 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Abca7 Rat sodium arsenite increases expression ISO RGD:1601775 6480464 sodium arsenite results in increased expression of ABCA7 mRNA CTD PMID:34032870 Abca7 Rat sulforaphane decreases expression ISO RGD:1601775 6480464 sulforaphane results in decreased expression of ABCA7 mRNA CTD PMID:31838189 Abca7 Rat testosterone increases expression ISO RGD:1601775 6480464 Testosterone results in increased expression of ABCA7 mRNA CTD PMID:33359661 Abca7 Rat testosterone enanthate affects expression ISO RGD:1601775 6480464 testosterone enanthate affects the expression of ABCA7 mRNA CTD PMID:17440010 Abca7 Rat tetrachloroethene decreases expression ISO RGD:1552857 6480464 Tetrachloroethylene results in decreased expression of ABCA7 mRNA CTD PMID:28973375 Abca7 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ABCA7 mRNA CTD PMID:34492290 Abca7 Rat thiram decreases expression ISO RGD:1601775 6480464 Thiram results in decreased expression of ABCA7 mRNA CTD PMID:38568856 Abca7 Rat titanium dioxide increases expression ISO RGD:1552857 6480464 titanium dioxide results in increased expression of ABCA7 mRNA CTD PMID:23557971 Abca7 Rat trichostatin A affects expression ISO RGD:1601775 6480464 trichostatin A affects the expression of ABCA7 mRNA CTD PMID:28542535 Abca7 Rat triphenyl phosphate affects expression ISO RGD:1601775 6480464 triphenyl phosphate affects the expression of ABCA7 mRNA CTD PMID:37042841 Abca7 Rat trovafloxacin decreases expression ISO RGD:1552857 6480464 trovafloxacin results in decreased expression of ABCA7 mRNA CTD PMID:35537566 Abca7 Rat tungsten decreases expression ISO RGD:1552857 6480464 Tungsten results in decreased expression of ABCA7 mRNA CTD PMID:30912803 Abca7 Rat valproic acid increases expression ISO RGD:1552857 6480464 Valproic Acid results in increased expression of ABCA7 mRNA CTD PMID:20546886 Abca7 Rat valproic acid increases methylation ISO RGD:1601775 6480464 Valproic Acid results in increased methylation of ABCA7 gene CTD PMID:29154799 Abca7 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ABCA7 mRNA CTD PMID:23034163 Abca7 Rat zidovudine increases expression ISO RGD:1601775 6480464 Zidovudine results in increased expression of ABCA7 mRNA CTD PMID:24292225 Abca7 Rat zidovudine decreases expression ISO RGD:1601775 6480464 Zidovudine results in decreased expression of ABCA7 mRNA CTD PMID:24292225
(1->4)-beta-D-glucan (ISO) (2,4,5-trichlorophenoxy)acetic acid (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) diuron (ISO) doxorubicin (ISO) elemental selenium (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) FR900359 (ISO) maleic acid (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) quercetin (ISO) selenium atom (ISO) sodium arsenite (ISO) sulforaphane (ISO) testosterone (ISO) testosterone enanthate (ISO) tetrachloroethene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) zidovudine (ISO)
Biological Process
amyloid-beta clearance by cellular catabolic process (ISO,ISS) amyloid-beta formation (IEA,ISO,ISS) apolipoprotein A-I-mediated signaling pathway (IEA,ISO,ISS) cholesterol efflux (IBA,IEA,ISO,ISS) high-density lipoprotein particle assembly (IEA,ISO,ISS) lipid transport (IEA) memory (ISO,ISS) negative regulation of amyloid precursor protein biosynthetic process (ISO,ISS) negative regulation of amyloid-beta formation (ISO,ISS) negative regulation of endocytosis (ISO,ISS) negative regulation of MAPK cascade (ISO) negative regulation of PERK-mediated unfolded protein response (ISO) peptide cross-linking (ISO) phagocytosis (IEA) phospholipid efflux (IBA,IEA,ISO,ISS) phospholipid translocation (IEA,ISO) plasma membrane raft organization (ISO,ISS) positive regulation of amyloid-beta clearance (ISO,ISS) positive regulation of cholesterol efflux (ISO,ISS) positive regulation of engulfment of apoptotic cell (ISO,ISS) positive regulation of ERK1 and ERK2 cascade (ISO,ISS) positive regulation of phagocytosis (ISO,ISS) positive regulation of phospholipid efflux (ISO,ISS) positive regulation of protein localization to cell surface (ISO,ISS) protein localization to nucleus (ISO,ISS) regulation of amyloid precursor protein catabolic process (IEA,ISO,ISS) regulation of lipid metabolic process (ISO) transmembrane transport (IEA) visual learning (ISO)
Cellular Component
apical plasma membrane (ISO) cell junction (IEA,ISO) cell projection (IEA) cell surface (ISO,ISS) cytoplasm (IEA,ISO,ISS) early endosome membrane (IEA) endosome (IEA) glial cell projection (ISO,ISS) Golgi apparatus (IEA,ISO) Golgi membrane (IEA) membrane (IEA) phagocytic cup (IEA,ISO,ISS) plasma membrane (IEA,ISO) ruffle membrane (IEA,ISO,ISS)
Abca7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 10,342,092 - 10,362,094 (-) NCBI GRCr8 mRatBN7.2 7 9,691,452 - 9,711,466 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 9,691,449 - 9,711,425 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 12,573,976 - 12,592,469 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 14,449,312 - 14,467,805 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 12,310,438 - 12,328,932 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 12,742,433 - 12,762,423 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 12,742,433 - 12,762,341 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 12,912,155 - 12,932,147 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 11,203,983 - 11,222,960 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 11,203,982 - 11,222,960 (-) NCBI Celera 7 7,867,206 - 7,885,960 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
ABCA7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 1,040,107 - 1,065,572 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 1,039,997 - 1,065,572 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 1,040,106 - 1,065,571 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 991,102 - 1,016,571 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 19 970,935 - 998,554 (+) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 812,691 - 838,952 (+) NCBI HuRef CHM1_1 19 1,038,376 - 1,065,164 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 1,002,776 - 1,030,237 (+) NCBI T2T-CHM13v2.0
Abca7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 79,832,328 - 79,851,406 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 79,832,328 - 79,851,406 (+) Ensembl GRCm39 Ensembl GRCm38 10 79,996,453 - 80,015,572 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 79,996,494 - 80,015,572 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 79,460,360 - 79,478,317 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 79,400,744 - 79,418,701 (+) NCBI MGSCv36 mm8 Celera 10 81,012,422 - 81,030,379 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Abca7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 6,815,562 - 6,836,772 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 6,818,002 - 6,838,177 (-) NCBI ChiLan1.0 ChiLan1.0
ABCA7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 5,374,938 - 5,401,483 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 4,611,225 - 4,637,922 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 62,811 - 77,897 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 1,016,829 - 1,042,251 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 1,018,095 - 1,042,104 (+) Ensembl panpan1.1 panPan2
ABCA7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 57,668,371 - 57,684,111 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 57,667,706 - 57,677,342 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 57,470,691 - 57,486,228 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 58,410,598 - 58,426,136 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 58,410,507 - 58,425,315 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 57,465,893 - 57,481,504 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 57,945,423 - 57,961,034 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 58,148,479 - 58,164,018 (-) NCBI UU_Cfam_GSD_1.0
Abca7
ABCA7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 77,357,218 - 77,375,180 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 77,357,161 - 77,375,349 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 77,621,720 - 77,640,442 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ABCA7
Abca7
.
Predicted Target Of
Count of predictions: 135 Count of miRNA genes: 115 Interacting mature miRNAs: 123 Transcripts: ENSRNOT00000064886 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
RH139906
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 10,342,140 - 10,342,477 (+) Marker Load Pipeline mRatBN7.2 7 9,691,500 - 9,691,837 (+) MAPPER mRatBN7.2 Rnor_6.0 7 12,742,482 - 12,742,818 NCBI Rnor6.0 Rnor_5.0 7 12,912,204 - 12,912,540 UniSTS Rnor5.0 RGSC_v3.4 7 11,203,950 - 11,204,286 UniSTS RGSC3.4 Celera 7 7,867,173 - 7,867,509 UniSTS RH 3.4 Map 7 40.7 UniSTS Cytogenetic Map 7 q11 UniSTS
BF390650
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 10,345,671 - 10,346,138 (+) Marker Load Pipeline mRatBN7.2 7 9,695,031 - 9,695,498 (+) MAPPER mRatBN7.2 Rnor_6.0 7 12,746,013 - 12,746,479 NCBI Rnor6.0 Rnor_5.0 7 12,915,735 - 12,916,201 UniSTS Rnor5.0 RGSC_v3.4 7 11,207,481 - 11,207,947 UniSTS RGSC3.4 Celera 7 7,870,704 - 7,871,170 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000064886 ⟹ ENSRNOP00000063805
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 9,691,449 - 9,711,425 (-) Ensembl Rnor_6.0 Ensembl 7 12,742,433 - 12,762,341 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093213
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 12,743,992 - 12,746,090 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093653
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 12,746,039 - 12,746,952 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093721
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 12,742,479 - 12,746,546 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095800 ⟹ ENSRNOP00000095986
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 9,691,449 - 9,711,425 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097711 ⟹ ENSRNOP00000085552
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 9,691,452 - 9,711,425 (-) Ensembl
RefSeq Acc Id:
NM_207598 ⟹ NP_997481
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,342,092 - 10,361,989 (-) NCBI mRatBN7.2 7 9,691,452 - 9,711,353 (-) NCBI Rnor_6.0 7 12,742,515 - 12,761,261 (-) NCBI Rnor_5.0 7 12,912,155 - 12,932,147 (-) NCBI RGSC_v3.4 7 11,203,983 - 11,222,960 (-) RGD Celera 7 7,867,206 - 7,885,960 (-) RGD
Sequence:
ATGGCTTTCTGCACACAGTTGATGCTCCTACTGTGGAAAAATTACACATATCGACGGAGACAACCGATCCAACTAGTAGTGGAGTTACTGTGGCCCCTCTTCCTCTTCTTCATCCTAGTGGCCGTCCG
hide sequence
RefSeq Acc Id:
XM_006240871 ⟹ XP_006240933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,342,092 - 10,362,072 (-) NCBI mRatBN7.2 7 9,691,452 - 9,711,441 (-) NCBI Rnor_6.0 7 12,742,433 - 12,762,423 (-) NCBI Rnor_5.0 7 12,912,155 - 12,932,147 (-) NCBI
Sequence:
GCTGCTTAGGGCTTCAGGTTGCGAAGGGCGTCGTCCGCGGTTGAGCCGGGTTCCTCTTAAAGGGGCCGCGCACCCCCGCCGAGGCCGGGAGGAGCGAAGGTGGATGGAGTTTGGGGGCCTCAGGACGG
hide sequence
RefSeq Acc Id:
XM_006240872 ⟹ XP_006240934
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,342,092 - 10,362,070 (-) NCBI mRatBN7.2 7 9,691,452 - 9,711,457 (-) NCBI Rnor_6.0 7 12,742,433 - 12,762,423 (-) NCBI Rnor_5.0 7 12,912,155 - 12,932,147 (-) NCBI
Sequence:
GCTGCTTAGGGCTTCAGGTTGCGAAGGGCGTCGTCCGCGGTTGAGCCGGGTTCCTCTTAAAGGG
hide sequence
RefSeq Acc Id:
XM_006240874 ⟹ XP_006240936
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,342,092 - 10,362,094 (-) NCBI mRatBN7.2 7 9,691,452 - 9,711,466 (-) NCBI Rnor_6.0 7 12,742,433 - 12,762,423 (-) NCBI Rnor_5.0 7 12,912,155 - 12,932,147 (-) NCBI
Sequence:
GCTGCTTAGGGCTTCAGGTTGCGAAGGGCGTCGTCCGCGGTTGAGCCGGGTTCCTCTTAAAGGGGCCGCGCACCCCCGCCGAGGCCGGGAGGAGCGAAGGTGGATGGAGTTTGGGGGCCTCAGGACGA
hide sequence
RefSeq Acc Id:
XM_017594715 ⟹ XP_017450204
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,342,092 - 10,362,072 (-) NCBI mRatBN7.2 7 9,691,452 - 9,711,441 (-) NCBI Rnor_6.0 7 12,742,433 - 12,762,423 (-) NCBI
Sequence:
GCTGCTTAGGGCTTCAGGTTGCGAAGGGCGTCGTCCGCGGTTGAGCCGGGTTCCTCTTAAAGGGGCCGCGCACCCCCGCCGAGGCCGGGAGGAGCGAAGGTGGATGGAGTTTGGGGGCCTCAGGACGG
hide sequence
RefSeq Acc Id:
XM_039078645 ⟹ XP_038934573
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,342,092 - 10,362,072 (-) NCBI mRatBN7.2 7 9,691,452 - 9,711,441 (-) NCBI
RefSeq Acc Id:
XM_039078646 ⟹ XP_038934574
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,344,697 - 10,362,077 (-) NCBI mRatBN7.2 7 9,694,082 - 9,711,444 (-) NCBI
RefSeq Acc Id:
XM_063263170 ⟹ XP_063119240
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,344,318 - 10,362,077 (-) NCBI
RefSeq Acc Id:
XR_005486558
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,345,648 - 10,362,078 (-) NCBI mRatBN7.2 7 9,695,008 - 9,711,444 (-) NCBI
RefSeq Acc Id:
XR_010052951
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,343,651 - 10,362,077 (-) NCBI
RefSeq Acc Id:
NP_997481 ⟸ NM_207598
- UniProtKB:
Q7TNJ2 (UniProtKB/Swiss-Prot), F1LR67 (UniProtKB/TrEMBL)
- Sequence:
MAFCTQLMLLLWKNYTYRRRQPIQLVVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADAHTVLGGHSTQDMLAALGKL
hide sequence
RefSeq Acc Id:
XP_006240936 ⟸ XM_006240874
- Peptide Label:
isoform X1
- UniProtKB:
Q7TNJ2 (UniProtKB/Swiss-Prot), F1LR67 (UniProtKB/TrEMBL)
- Sequence:
MAFCTQLMLLLWKNYTYRRRQPIQLVVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADAHTVLGGHSTQDMLAALGKL
hide sequence
RefSeq Acc Id:
XP_006240934 ⟸ XM_006240872
- Peptide Label:
isoform X1
- UniProtKB:
Q7TNJ2 (UniProtKB/Swiss-Prot), F1LR67 (UniProtKB/TrEMBL)
- Sequence:
MAFCTQLMLLLWKNYTYRRRQPIQLVVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADAHTVLGGHSTQDMLAALGKL
hide sequence
RefSeq Acc Id:
XP_006240933 ⟸ XM_006240871
- Peptide Label:
isoform X1
- UniProtKB:
Q7TNJ2 (UniProtKB/Swiss-Prot), F1LR67 (UniProtKB/TrEMBL)
- Sequence:
MAFCTQLMLLLWKNYTYRRRQPIQLVVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADAHTVLGGHSTQDMLAALGKL
hide sequence
RefSeq Acc Id:
XP_017450204 ⟸ XM_017594715
- Peptide Label:
isoform X3
- UniProtKB:
Q7TNJ2 (UniProtKB/Swiss-Prot), A0A8I6A4A6 (UniProtKB/TrEMBL)
- Sequence:
MAFCTQLMLLLWKNYTYRRRQPIQLVVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADAHTVLGGHSTQDMLAALGKL
hide sequence
Ensembl Acc Id:
ENSRNOP00000063805 ⟸ ENSRNOT00000064886
RefSeq Acc Id:
XP_038934573 ⟸ XM_039078645
- Peptide Label:
isoform X2
- UniProtKB:
Q7TNJ2 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038934574 ⟸ XM_039078646
- Peptide Label:
isoform X5
- UniProtKB:
Q7TNJ2 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000095986 ⟸ ENSRNOT00000095800
Ensembl Acc Id:
ENSRNOP00000085552 ⟸ ENSRNOT00000097711
RefSeq Acc Id:
XP_063119240 ⟸ XM_063263170
- Peptide Label:
isoform X4
- UniProtKB:
Q7TNJ2 (UniProtKB/Swiss-Prot)
RGD ID: 13695047 Promoter ID: EPDNEW_R5572 Type: multiple initiation site Name: Abca7_1 Description: ATP binding cassette subfamily A member 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 12,762,365 - 12,762,425 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-19
Abca7
ATP binding cassette subfamily A member 7
Abca7
ATP-binding cassette, subfamily A (ABC1), member 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-11-16
Abca7
ATP-binding cassette, subfamily A (ABC1), member 7
Abca7
ATP-binding cassette, sub-family A (ABC1), member 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Abca7
ATP-binding cassette, sub-family A (ABC1), member 7
ABCA7
ATP-binding cassette, sub-family A, member 7
Name updated
1299863 APPROVED
2005-02-14
ABCA7
ATP-binding cassette, sub-family A, member 7
Symbol and Name status set to provisional
70820 PROVISIONAL
