Advanced Search (OLGA)

Gene: Nog (noggin) Ictidomys tridecemlineatus

Subscribe to Updates

Analyze

Symbol:

Nog

Name:

noggin

RGD ID:

12531258

Description:

ENCODES a protein that exhibits growth factor binding (ortholog); protein-containing complex binding (ortholog); receptor ligand inhibitor activity (ortholog); INVOLVED IN BMP signaling pathway (ortholog); cellular response to BMP stimulus (ortholog); cellular response to hypoxia (ortholog); PARTICIPATES IN Bone morphogenetic proteins signaling pathway; ASSOCIATED WITH acute kidney tubular necrosis (ortholog); Alzheimer's disease (ortholog); brachydactyly type B2 (ortholog); FOUND IN axon (ortholog); extracellular space (ortholog); protein-containing complex (ortholog)

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NOG (noggin)	NCBI	Ortholog
Mus musculus (house mouse):	Nog (noggin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Nog (noggin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nog (noggin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NOG (noggin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NOG (noggin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NOG (noggin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NOG (noggin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nog (noggin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

SpeTri2.0 - Squirrel SpeTri2.0 Assembly

Position:

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	30,811,040 - 30,812,486 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	6,262,785 - 6,263,483 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	6,262,651 - 6,264,069 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nog	Squirrel	acute kidney tubular necrosis		ISO	Nog (Rattus norvegicus)	9068941	associated with Kidney Reperfusion Injury	RGD	PMID:16284088 and REF_RGD_ID:1601494
Nog	Squirrel	Alzheimer's disease		ISO	Nog (Mus musculus)	9068941		RGD	PMID:19463786 and REF_RGD_ID:10414082
Nog	Squirrel	brachydactyly type B2	no_association	ISO	NOG (Homo sapiens)	9068941	DNA:mutation:cds:p.G92E(human)	RGD	PMID:22529972 and REF_RGD_ID:12801483
Nog	Squirrel	cleft lip	susceptibility	ISO	NOG (Homo sapiens)	9068941	DNA:SNP: : rs227727 (human)	RGD	PMID:25704602 and REF_RGD_ID:11251786
Nog	Squirrel	cleft lip	susceptibility	ISO	NOG (Homo sapiens)	9068941	DNA:SNP: :rs227731(human)	RGD	PMID:25339627 and REF_RGD_ID:12801482
Nog	Squirrel	Conductive Hearing Loss		ISO	Nog (Mus musculus)	9068941		RGD	PMID:18096605 and REF_RGD_ID:12801451
Nog	Squirrel	COVID-19		ISO	NOG (Homo sapiens)	9068941	mRNA:decreased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226 and REF_RGD_ID:28912744
Nog	Squirrel	craniosynostosis	treatment	ISO	NOG (Homo sapiens)	9068941		RGD	PMID:19627528 and REF_RGD_ID:8547554
Nog	Squirrel	esophageal atresia/tracheoesophageal fistula		ISO	Nog (Mus musculus)	9068941		RGD	PMID:17260385 and REF_RGD_ID:12801454
Nog	Squirrel	Huntington's disease	treatment	ISO	NOG (Homo sapiens)	9068941		RGD	PMID:17885687 and REF_RGD_ID:10415531
Nog	Squirrel	hyperopia		ISO	NOG (Homo sapiens)	9068941	associated with Multiple Synostoses Syndrome 1 and DNA:mutation:cds:1426G>C (P.W205C)(Human)	RGD	PMID:16151340 and REF_RGD_ID:12801467
Nog	Squirrel	Micrognathism		ISO	NOG (Homo sapiens)	9068941	DNA:SNP:rs1348322(human)	RGD	PMID:20645637 and REF_RGD_ID:12801465
Nog	Squirrel	osteoporosis		ISO	Nog (Mus musculus)	9068941		RGD	PMID:12975477 and REF_RGD_ID:10414323
Nog	Squirrel	Peripheral Nerve Injuries	treatment	ISO	Nog (Mus musculus)	9068941		RGD	PMID:17258709 and REF_RGD_ID:10428775
Nog	Squirrel	prolactinoma		ISO	Nog (Mus musculus)	9068941	mRNA and protein:decreased expression:pituitary	RGD	PMID:12552124 and REF_RGD_ID:629544
Nog	Squirrel	proximal symphalangism		ISO	NOG (Homo sapiens)	9068941	DNA:missense mutation:cds:c.499C>T(p.R167C)human	RGD	PMID:24326127 and REF_RGD_ID:12801479
Nog	Squirrel	proximal symphalangism		ISO	NOG (Homo sapiens)	9068941		RGD	PMID:10080184 and REF_RGD_ID:1600234
Nog	Squirrel	proximal symphalangism		ISO	NOG (Homo sapiens)	9068941	DNA:mutations:cds:g.551G>A (p.C184Y) more ...	RGD	PMID:11846737 and REF_RGD_ID:12801455
Nog	Squirrel	Pulmonary Hypertension, Hypoxia-Induced		ISO	Nog (Rattus norvegicus)	9068941	mRNA and protein:decreased expression:lung:	RGD	PMID:25740156 and REF_RGD_ID:12801489
Nog	Squirrel	relapsing-remitting multiple sclerosis		ISO	NOG (Homo sapiens)	9068941	mRNA and protein:decreased expression:mononuclear cell"	RGD	PMID:21111488 and REF_RGD_ID:12801480
Nog	Squirrel	Spinal Cord Injuries	treatment	ISO	Nog (Mus musculus)	9068941		RGD	PMID:18221366 and REF_RGD_ID:10429192
Nog	Squirrel	type 1 diabetes mellitus		ISO	Nog (Mus musculus)	9068941	mRNA and protein:increased expression:aorta	RGD	PMID:21193740 and REF_RGD_ID:10430114
Nog	Squirrel	type 2 diabetes mellitus		ISO	Nog (Rattus norvegicus)	9068941	mRNA and protein:increased expression:aorta	RGD	PMID:21193740 and REF_RGD_ID:10430114
Nog	Squirrel	type 2 diabetes mellitus		ISO	Nog (Mus musculus)	9068941	mRNA and protein:increased expression:aorta	RGD	PMID:21193740 and REF_RGD_ID:10430114

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nog	Squirrel	brachydactyly type B2		ISO	NOG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brachydactyly type B2	ClinVar	PMID:10080184 more ...
Nog	Squirrel	genetic disease		ISO	NOG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:16532400 more ...
Nog	Squirrel	hereditary breast ovarian cancer syndrome		ISO	NOG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Breast-ovarian cancer more ...	ClinVar	PMID:38922859
Nog	Squirrel	Joubert syndrome 1		ISO	NOG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial aplasia of the vermis	ClinVar	PMID:28492532
Nog	Squirrel	multiple synostoses syndrome 1		ISO	NOG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Symphalangism-brachydactyly syndrome	ClinVar	PMID:10080184 more ...
Nog	Squirrel	proximal symphalangism 1		ISO	NOG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Proximal symphalangism 1A	ClinVar	PMID:10080184 more ...
Nog	Squirrel	Stapes Ankylosis with Broad Thumbs and Toes		ISO	NOG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Stapes ankylosis with broad thumbs and toes	ClinVar	PMID:10069712 more ...
Nog	Squirrel	tarsal-carpal coalition syndrome		ISO	NOG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Tarsal-carpal coalition syndrome	ClinVar	PMID:10080184 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nog	Squirrel	proximal symphalangism		ISO	NOG (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nog	Squirrel	esophageal atresia/tracheoesophageal fistula		ISO	Nog (Mus musculus)	9068941	OMIM:189960	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nog	Squirrel	brachydactyly type B2		ISO	NOG (Homo sapiens)	7240710		OMIM
Nog	Squirrel	multiple synostoses syndrome 1		ISO	NOG (Homo sapiens)	7240710		OMIM
Nog	Squirrel	proximal symphalangism 1		ISO	NOG (Homo sapiens)	7240710		OMIM
Nog	Squirrel	Stapes Ankylosis with Broad Thumbs and Toes		ISO	NOG (Homo sapiens)	7240710		OMIM
Nog	Squirrel	tarsal-carpal coalition syndrome		ISO	NOG (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nog	Squirrel	anatomical structure formation involved in morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	atrial cardiac muscle tissue morphogenesis	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	axial mesoderm development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	axon guidance	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	BMP signaling pathway	acts_upstream_of	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	BMP signaling pathway	involved_in	ISO	Nog (Mus musculus)	9068941	PMID:17634368	MGI	PMID:17634368
Nog	Squirrel	BMP signaling pathway	involved_in	ISO	MGI:1313268	9068941	PMID:12397106	MGI	PMID:12397106
Nog	Squirrel	brain development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	cartilage development	involved_in	IEA	UniRule:UR000329325	150520179		UniProt	GO_REF:0000104
Nog	Squirrel	cartilage development	acts_upstream_of	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	cartilage development	involved_in	IEA	UniProtKB-KW:KW-0891	150520179		UniProt	GO_REF:0000043
Nog	Squirrel	cell differentiation	involved_in	IEA	UniProtKB-KW:KW-0221	150520179		UniProt	GO_REF:0000043
Nog	Squirrel	cell differentiation in hindbrain	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	cell population proliferation	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	cellular response to BMP stimulus		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:21238590 and REF_RGD_ID:12801486
Nog	Squirrel	cellular response to BMP stimulus	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	cellular response to hypoxia		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:25740156 and REF_RGD_ID:12801489
Nog	Squirrel	central nervous system development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	cranial skeletal system development	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	dorsal/ventral pattern formation	involved_in	IEA	PANTHER:PTN000051996	150520179		TreeGrafter	GO_REF:0000118
Nog	Squirrel	dorsal/ventral pattern formation	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	embryonic digit morphogenesis	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	embryonic skeletal joint morphogenesis	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	embryonic skeletal system development	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	endocardial cushion formation	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	endoderm development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	endoderm formation	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	epithelial cell proliferation	acts_upstream_of	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	epithelial to mesenchymal transition	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	exploration behavior	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	face morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	fibroblast growth factor receptor signaling pathway	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	forebrain development		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:14643011 and REF_RGD_ID:1358324
Nog	Squirrel	forebrain development	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	heart trabecula morphogenesis	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	hippocampus development		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:15171992 and REF_RGD_ID:10416525
Nog	Squirrel	in utero embryonic development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	limb development	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	long-term synaptic potentiation	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	lung morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	membranous septum morphogenesis	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	memory		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:12740172 and REF_RGD_ID:10423996
Nog	Squirrel	mesenchymal cell differentiation		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:21238590 and REF_RGD_ID:12801486
Nog	Squirrel	mesenchymal cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	mesoderm development	involved_in	ISO	NOG (Homo sapiens)	9068941	PMID:8752214	BHF-UCL	PMID:8752214
Nog	Squirrel	mesoderm formation	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	middle ear morphogenesis	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	motor neuron axon guidance	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of apoptotic signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of astrocyte differentiation		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:14975730 and REF_RGD_ID:1358325
Nog	Squirrel	negative regulation of astrocyte differentiation	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of BMP signaling pathway	involved_in	IEA	PANTHER:PTN000051996	150520179		TreeGrafter	GO_REF:0000118
Nog	Squirrel	negative regulation of BMP signaling pathway	acts_upstream_of_or_within	ISO	Nog (Mus musculus)	9068941	PMID:15110716 more ...	MGI	PMID:15110716 more ...
Nog	Squirrel	negative regulation of BMP signaling pathway	acts_upstream_of_or_within	ISO	MGI:88177 and MGI:88182	9068941	PMID:19852960	MGI	PMID:19852960
Nog	Squirrel	negative regulation of BMP signaling pathway	acts_upstream_of_or_within	ISO	MGI:1862000	9068941	PMID:16712836	MGI	PMID:16712836
Nog	Squirrel	negative regulation of BMP signaling pathway	involved_in	IEA	InterPro:IPR008717	150520179		InterPro	GO_REF:0000002
Nog	Squirrel	negative regulation of BMP signaling pathway	involved_in	IEA	UniProtKB:P97466 more ...	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of BMP signaling pathway	involved_in	IEA	UniRule:UR000329325	150520179		UniProt	GO_REF:0000104
Nog	Squirrel	negative regulation of canonical Wnt signaling pathway	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of cardiac epithelial to mesenchymal transition	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of cardiac muscle cell proliferation	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of cartilage development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of cell differentiation	involved_in	IEA	InterPro:IPR008717	150520179		InterPro	GO_REF:0000002
Nog	Squirrel	negative regulation of cell migration	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of gene expression	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of osteoblast differentiation	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of SMAD protein signal transduction	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	negative regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	neural plate anterior/posterior regionalization	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	neural plate morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	neural tube closure	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	neural tube development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	nodal signaling pathway	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	notochord morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	ossification		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:24611347 and REF_RGD_ID:10429074
Nog	Squirrel	osteoblast differentiation	involved_in	IEA	PANTHER:PTN000051996	150520179		TreeGrafter	GO_REF:0000118
Nog	Squirrel	osteoblast differentiation	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	outflow tract morphogenesis	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	pattern specification process	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	pharyngeal arch artery morphogenesis	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	pituitary gland development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	positive regulation of branching involved in ureteric bud morphogenesis	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	positive regulation of cell population proliferation		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:15265600 and REF_RGD_ID:10427780
Nog	Squirrel	positive regulation of epithelial cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	positive regulation of gene expression	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	positive regulation of glomerulus development	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	positive regulation of oligodendrocyte progenitor proliferation		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:14975730 and REF_RGD_ID:1358325
Nog	Squirrel	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	presynaptic modulation of chemical synaptic transmission	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	prostatic bud formation	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	regulation of BMP signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	regulation of fibroblast growth factor receptor signaling pathway	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	regulation of neuronal synaptic plasticity	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	short-term synaptic potentiation	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	skeletal system development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	smoothened signaling pathway	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	somatic stem cell population maintenance	involved_in	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	somite development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	spinal cord development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	stem cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	ureteric bud development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	ureteric bud formation	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	urogenital system development	acts_upstream_of_or_within	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	ventricular compact myocardium morphogenesis	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	ventricular septum morphogenesis	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	visual learning		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:12740172 and REF_RGD_ID:10423996
Nog	Squirrel	visual learning	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	wound healing	involved_in	IEA	UniProtKB:P97466 and ensembl:ENSMUSP00000061427	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nog	Squirrel	axon		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:21447372 and REF_RGD_ID:12801487
Nog	Squirrel	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	150520179		UniProt	GO_REF:0000044
Nog	Squirrel	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	150520179		UniProt	GO_REF:0000043
Nog	Squirrel	extracellular space	located_in	IEA	PANTHER:PTN000051996	150520179		TreeGrafter	GO_REF:0000118
Nog	Squirrel	extracellular space	located_in	IEA	UniProtKB:P97466 more ...	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	extracellular space		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:15199066 and REF_RGD_ID:1599074
Nog	Squirrel	presynapse	located_in	IEA	GO:0099171	150520179		GOC	GO_REF:0000108
Nog	Squirrel	protein-containing complex		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:15199066 and REF_RGD_ID:1599074

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nog	Squirrel	cytokine binding	enables	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	growth factor binding	enables	ISO	UniProtKB:P12643 and UniProtKB:P12644	9068941	PMID:8752214	BHF-UCL	PMID:8752214
Nog	Squirrel	protein binding	enables	ISO	UniProtKB:P12643	9068941	PMID:19804412	IntAct	PMID:19804412
Nog	Squirrel	protein binding	enables	ISO	UniProtKB:P43026	9068941	PMID:24098149	UniProt	PMID:24098149
Nog	Squirrel	protein binding	enables	ISO	UniProtKB:P43026 and UniProtKB:Q13873	9068941	PMID:21976273	UniProt	PMID:21976273
Nog	Squirrel	protein binding		ISO	Sost (Rattus norvegicus)	9068941		RGD	PMID:15199066 and REF_RGD_ID:1599074
Nog	Squirrel	protein homodimerization activity	enables	IEA	UniProtKB:Q13253 and ensembl:ENSP00000328181	150520179		Ensembl	GO_REF:0000107
Nog	Squirrel	protein-containing complex binding		ISO	Nog (Rattus norvegicus)	9068941		RGD	PMID:15199066 and REF_RGD_ID:1599074
Nog	Squirrel	receptor ligand inhibitor activity	enables	ISO	NOG (Homo sapiens)	9068941	PMID:8752214	BHF-UCL	PMID:8752214

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nog	Squirrel	Bone morphogenetic proteins signaling pathway		ISO	NOG (Homo sapiens)	9068941		PID	PID:200144

PMID:22301074	PMID:30032202

Nog
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	30,811,040 - 30,812,486 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	6,262,785 - 6,263,483 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	6,262,651 - 6,264,069 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NOG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	56,593,699 - 56,595,611 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	56,593,699 - 56,595,611 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	54,671,060 - 54,672,972 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	52,026,274 - 52,027,546 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	52,026,273 - 52,027,542	NCBI
Celera	17	51,132,757 - 51,134,648 (+)	NCBI		Celera
Cytogenetic Map	17	q22	NCBI
HuRef	17	50,031,838 - 50,033,727 (+)	NCBI		HuRef
CHM1_1	17	54,735,932 - 54,737,820 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	57,469,821 - 57,471,732 (+)	NCBI		T2T-CHM13v2.0

Nog
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	89,191,464 - 89,193,385 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	89,191,464 - 89,193,158 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	89,300,638 - 89,302,559 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	89,300,638 - 89,302,332 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	89,161,952 - 89,163,873 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	89,117,412 - 89,118,110 (-)	NCBI		MGSCv36	mm8
Celera	11	98,919,523 - 98,921,373 (-)	NCBI		Celera
Cytogenetic Map	11	C	NCBI
cM Map	11	54.34	NCBI

Nog
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	74,625,874 - 74,627,501 (-)	NCBI		GRCr8
mRatBN7.2	10	74,128,712 - 74,130,339 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	74,128,712 - 74,130,339 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	78,757,906 - 78,759,533 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	78,262,852 - 78,264,479 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	73,730,695 - 73,732,322 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	76,811,759 - 76,813,386 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	76,811,759 - 76,813,386 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	76,677,612 - 76,679,239 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	77,689,244 - 77,690,871 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	77,703,801 - 77,704,728 (-)	NCBI
Celera	10	73,029,127 - 73,030,754 (-)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

Nog
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	6,193,042 - 6,193,740 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	6,192,368 - 6,193,766 (-)	NCBI	ChiLan1.0	ChiLan1.0

NOG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	72,764,735 - 72,767,331 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	77,576,197 - 77,577,597 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	50,669,186 - 50,671,081 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	55,532,208 - 55,533,782 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	55,532,394 - 55,533,092 (+)	Ensembl	panpan1.1		panPan2

NOG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	31,453,604 - 31,456,060 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	30,695,378 - 30,696,228 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	32,262,855 - 32,263,712 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	32,262,940 - 32,263,663 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	31,048,413 - 31,049,269 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	31,332,204 - 31,333,060 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	31,415,982 - 31,416,833 (+)	NCBI		UU_Cfam_GSD_1.0

NOG
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	32,891,321 - 32,892,206 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	32,891,321 - 32,892,206 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

NOG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	36,816,783 - 36,818,693 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	36,817,476 - 36,818,174 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	7,642,384 - 7,644,356 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nog
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	11,696,353 - 11,697,051 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	11,696,102 - 11,697,367 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005321598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAESOR010000662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSSTOT00000029914 ⟹ ENSSTOP00000018887

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
SpeTri2.0 Ensembl	NW_004936490	6,262,785 - 6,263,483 (-)	Ensembl

RefSeq Acc Id:

XM_005321598 ⟹ XP_005321655

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
HiC_Itri_2	NW_024405602	30,811,040 - 30,812,486 (+)	NCBI
SpeTri2.0	NW_004936490	6,262,651 - 6,264,069 (-)	NCBI

Sequence:

show sequence

TTCCATGGTGATGGAGCTGAAAGTGCAGGAAATTTAAAGGCTTGGACCCAGCGAGACAGACAAACCGGTGCCAACGTGCGCGGACGCCGCCGCCGCCGCCGCCGCTGGAGTCCGCCGGGCAGAGCCGG
CCGAGGAGCCCGAAGCAGGCGGAGGGAAGTGCCCCAGGACCCGCTCGGCCAGCGGCGCTGCACAGAGCGGCAGGACGAGGAGCAGCGAGAGGAGGAGGAGGGGAGAGCGGCTCGTCCACGCGCCCAGC
GCCGCCGCCGGCCCGGGAAGGCAGCGAGGAGCCGGCGCCCCCAGCGCCCCGCGGTCGCCCTGGAGTAATTTCGGATGCCCCGCCGCGGCCGCCTTTCCGACTAGACCCGAGAGAGGAGTTGCGGCCAA
CTCGTGTGCCTTTTTTCCACCCCAGTGGGAGCCGGCGCTGCGCAAAGGCTCTGCTCGCGGCTCATGCTGCCGGCCCTGCGCCTGCCCAGCCTCGGGTGAGCCGCCTCCGGAGAGACGGAGGAGCGCGG
CGGCGCCGCGGGCTCAGCGTGCTCTCCTCCGGGTACGCCGGACGAAGCTGCAGCCCCGGGCGCGCGCCGGAGGCATGGAGCGCTGCCCCAGCCTGGGGGTCACCCTCTACGCCCTGGTGGTGGTCCTG
GGGCTGCGGGCGGCACCGGCCGGTGGCCAGCACTATCTCCACATCCGCCCAGCTCCCAGCGACAACCTGCCCCTGGTGGACCTCATCGAACACCCGGACCCTATCTTTGACCCCAAGGAAAAGGATCT
GAACGAGACGCTGCTGCGCTCGCTGCTCGGGGGCCACTACGACCCGGGCTTCATGGCCACCTCTCCCCCTGAGGACCGACCCGGAGGGGGCGGGGGAGCGGCTGGAGGAGCCGAGGACCTGGCGGAGC
TGGACCAGCTGCTGCGGCAGCGGCCGTCGGGGGCCATGCCGAGCGAGATCAAAGGGCTGGAGTTCTCCGAGGGCTTGGCCCAGGGCAAGAAGCAGCGCCTGAGCAAGAAGCTGCGGAGGAAGTTACAG
ATGTGGCTGTGGTCGCAGACCTTCTGCCCGGTGCTGTACGCGTGGAACGACCTAGGCAGCCGCTTTTGGCCGCGCTACGTGAAGGTGGGCAGCTGCTTCAGTAAGCGCTCGTGCTCTGTGCCGGAGGG
CATGGTGTGCAAGCCGTCCAAGTCCGTGCACCTCACGGTGCTGCGGTGGCGCTGTCAGCGGCGCGGGGGCCAGCGCTGCGGCTGGATTCCCATCCAGTACCCCATCATTTCCGAGTGCAAGTGCTCAT
GTTAGAACTCGGGGGCCCCCTGCCCGCACCCGGACACTTGATCGATCTCCACTGACGCCACCTACACCGACTCCAACCAGTTCCACCACCCTCTAGCGAGGGTTCTCAATGAACTTTTTTTTTTTTTT
TTTTTTTTTTT

hide sequence


Protein RefSeqs	XP_005321655	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSSTOP00000018887.1
GenBank Protein	KAG3269317	(Get FASTA)	NCBI Sequence Viewer
	KAG3269318	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

XP_005321655 ⟸ XM_005321598

- UniProtKB:

I3N3E1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERCPSLGVTLYALVVVLGLRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEG
LAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

hide sequence

Ensembl Acc Id:

ENSSTOP00000018887 ⟸ ENSSTOT00000029914

Database	Acc Id	Source(s)
Ensembl Genes	ENSSTOG00000024922	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSSTOT00000029914.1	UniProtKB/TrEMBL
Gene3D-CATH	2.10.90.10	UniProtKB/TrEMBL
	Helix hairpin bin	UniProtKB/TrEMBL
InterPro	Cystine-knot_cytokine	UniProtKB/TrEMBL
	Noggin	UniProtKB/TrEMBL
NCBI Gene	Nog	ENTREZGENE
PANTHER	NOGGIN	UniProtKB/TrEMBL
	PTHR10494	UniProtKB/TrEMBL
Pfam	Noggin	UniProtKB/TrEMBL
PIRSF	Noggin	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57501	UniProtKB/TrEMBL
UniProt	I3N3E1	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)