Symbol:
Slc9a3
Name:
solute carrier family 9 (sodium/hydrogen exchanger), member 3
RGD ID:
11319
MGI Page
MGI
Description:
Enables PDZ domain binding activity and sodium:proton antiporter activity. Acts upstream of or within regulation of pH and sodium ion transport. Located in apical plasma membrane; brush border membrane; and vesicle. Is expressed in early conceptus; liver; metanephros; and oocyte. Human ortholog(s) of this gene implicated in congenital secretory sodium diarrhea 8. Orthologous to human SLC9A3 (solute carrier family 9 member A3).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
9030624O13Rik; AI930210; NHE; NHE-; NHE-3; NHE3; sodium/hydrogen exchanger 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC9A3 (solute carrier family 9 member A3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Slc9a3 (solute carrier family 9 member A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc9a3 (solute carrier family 9 member A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100988373 (LINE-1 retrotransposable element ORF2 protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC9A3 (solute carrier family 9 member A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc9a3 (solute carrier family 9 member A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC9A3 (solute carrier family 9 member A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103214902 (sodium/hydrogen exchanger 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc9a3 (solute carrier family 9 member A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SLC9A5 (solute carrier family 9 member A5) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Slc9a3 (solute carrier family 9 member A3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SLC9A3 (solute carrier family 9 member A3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc9a3.1 (solute carrier family 9 member A3, tandem duplicate 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
slc9a3.2 (solute carrier family 9 member A3, tandem duplicate 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Nhe2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
nhx-2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
nhx-3
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
nhx-6
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
nhx-9
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
slc9a3
Alliance
DIOPT (OrthoFinder|PANTHER)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 74,234,374 - 74,317,561 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 74,269,576 - 74,317,561 (+) Ensembl GRCm39 Ensembl GRCm38 13 74,086,255 - 74,169,442 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 74,121,457 - 74,169,442 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 74,258,963 - 74,303,512 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 74,587,517 - 74,632,066 (+) NCBI MGSCv36 mm8 Celera 13 76,451,103 - 76,495,653 (+) NCBI Celera Cytogenetic Map 13 C1 NCBI cM Map 13 40.15 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc9a3 Mouse 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane multiple interactions EXP 6480464 [o and p'-DDT co-treated with DDT] results in increased expression of SLC9A3 mRNA CTD PMID:27325568 Slc9a3 Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of SLC9A3 mRNA CTD PMID:26682919 Slc9a3 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SLC9A3 mRNA CTD PMID:22206623 Slc9a3 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SLC9A3 mRNA CTD PMID:26377647 Slc9a3 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO SLC9A3 (Homo sapiens) 6480464 [[Defoliants and Chemical results in increased abundance of Agent Orange] which results in increased abundance of Tetrachlorodibenzodioxin] which results in decreased methylation of SLC9A3 gene CTD PMID:33849548 Slc9a3 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC9A3 mRNA CTD PMID:32109520 Slc9a3 Mouse 2,3,7,8-Tetrachlorodibenzofuran increases expression ISO Slc9a3 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Slc9a3 Mouse 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 [piperine co-treated with Cimetidine co-treated with Pyruvates] inhibits the reaction [Puromycin Aminonucleoside results in decreased expression of SLC9A3 protein] CTD PMID:12806184 Slc9a3 Mouse 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Puromycin Aminonucleoside results in decreased expression of SLC9A3 protein CTD PMID:15075188 Slc9a3 Mouse 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine affects expression ISO Slc9a3 (Rattus norvegicus) 6480464 Puromycin Aminonucleoside affects the expression of SLC9A3 protein CTD PMID:12191963 Slc9a3 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO SLC9A3 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of SLC9A3 gene CTD PMID:31601247 Slc9a3 Mouse 4,4'-sulfonyldiphenol decreases methylation ISO SLC9A3 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of SLC9A3 gene CTD PMID:31601247 Slc9a3 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of SLC9A3 mRNA CTD PMID:28973697 Slc9a3 Mouse 5-aza-2'-deoxycytidine increases expression ISO SLC9A3 (Homo sapiens) 6480464 Decitabine results in increased expression of SLC9A3 mRNA CTD PMID:21856257 Slc9a3 Mouse 5-fluorouracil decreases expression ISO SLC9A3 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of SLC9A3 mRNA CTD PMID:34151400 Slc9a3 Mouse acrylamide decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of SLC9A3 mRNA CTD PMID:28959563 Slc9a3 Mouse acrylamide decreases expression ISO SLC9A3 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SLC9A3 mRNA CTD PMID:32763439 Slc9a3 Mouse aldosterone multiple interactions EXP 6480464 AGT protein affects the reaction [SLC9A3 gene mutant form results in increased abundance of Aldosterone] CTD PMID:26564064 Slc9a3 Mouse aldosterone increases abundance EXP 6480464 SLC9A3 gene mutant form results in increased abundance of Aldosterone CTD PMID:26564064 Slc9a3 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of SLC9A3 mRNA CTD PMID:36189433 Slc9a3 Mouse ammonium chloride affects expression ISO Slc9a3 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of SLC9A3 mRNA CTD PMID:16483693 Slc9a3 Mouse ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of NHE3 protein CTD PMID:18287403 Slc9a3 Mouse ammonium chloride multiple interactions EXP 6480464 Losartan inhibits the reaction [Ammonium Chloride results in increased expression of NHE3 protein] CTD PMID:18287403 Slc9a3 Mouse arsane affects methylation ISO SLC9A3 (Homo sapiens) 6480464 Arsenic affects the methylation of SLC9A3 gene CTD PMID:25304211 Slc9a3 Mouse arsenic atom affects methylation ISO SLC9A3 (Homo sapiens) 6480464 Arsenic affects the methylation of SLC9A3 gene CTD PMID:25304211 Slc9a3 Mouse Azoxymethane multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC9A3 mRNA CTD PMID:29950665 Slc9a3 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SLC9A3 mRNA CTD PMID:27195522 Slc9a3 Mouse benzo[a]pyrene increases methylation ISO SLC9A3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SLC9A3 5' UTR and Benzo(a)pyrene results in increased methylation of SLC9A3 exon CTD PMID:27901495 Slc9a3 Mouse benzo[a]pyrene affects methylation ISO SLC9A3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SLC9A3 intron and Benzo(a)pyrene affects the methylation of SLC9A3 promoter CTD PMID:27901495 and PMID:30157460 Slc9a3 Mouse benzo[a]pyrene diol epoxide I increases expression ISO SLC9A3 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Slc9a3 Mouse benzo[e]pyrene increases methylation ISO SLC9A3 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of SLC9A3 intron CTD PMID:30157460 Slc9a3 Mouse bisphenol A decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SLC9A3 mRNA CTD PMID:25181051 and PMID:30816183 Slc9a3 Mouse bisphenol A increases methylation ISO SLC9A3 (Homo sapiens) 6480464 bisphenol A results in increased methylation of SLC9A3 gene CTD PMID:31601247 Slc9a3 Mouse bisphenol A multiple interactions ISO SLC9A3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SLC9A3 gene CTD PMID:31601247 Slc9a3 Mouse cadmium dichloride decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of SLC9A3 mRNA and Cadmium Chloride results in decreased expression of SLC9A3 protein CTD PMID:15781297 Slc9a3 Mouse chlorothalonil increases expression EXP 6480464 tetrachloroisophthalonitrile results in increased expression of SLC9A3 mRNA CTD PMID:33246813 Slc9a3 Mouse chlorothalonil multiple interactions EXP 6480464 [tetrachloroisophthalonitrile co-treated with procymidone] results in increased expression of SLC9A3 mRNA CTD PMID:33246813 Slc9a3 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of SLC9A3 gene CTD PMID:20938992 Slc9a3 Mouse cimetidine multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 [piperine co-treated with Cimetidine co-treated with Pyruvates] inhibits the reaction [Puromycin Aminonucleoside results in decreased expression of SLC9A3 protein] CTD PMID:12806184 Slc9a3 Mouse cisplatin multiple interactions ISO SLC9A3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of SLC9A3 mRNA CTD PMID:27392435 Slc9a3 Mouse clofibrate multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 Clofibrate inhibits the reaction [Dietary Fats results in increased expression of SLC9A3 protein] CTD PMID:16339392 Slc9a3 Mouse copper atom increases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of SLC9A3 mRNA CTD PMID:26033743 Slc9a3 Mouse copper(0) increases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of SLC9A3 mRNA CTD PMID:26033743 Slc9a3 Mouse Cuprizon decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of SLC9A3 mRNA CTD PMID:27523638 Slc9a3 Mouse DDT multiple interactions EXP 6480464 [o and p'-DDT co-treated with DDT] results in increased expression of SLC9A3 mRNA CTD PMID:27325568 Slc9a3 Mouse dexamethasone increases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Dexamethasone results in increased expression of SLC9A3 protein CTD PMID:18400872 Slc9a3 Mouse dexamethasone increases expression ISO SLC9A3 (Homo sapiens) 6480464 Dexamethasone results in increased expression of SLC9A3 protein CTD PMID:16564041 Slc9a3 Mouse dextran sulfate multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC9A3 mRNA CTD PMID:29950665 Slc9a3 Mouse dimethylarsinic acid multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of SLC9A3 mRNA CTD PMID:34876320 Slc9a3 Mouse enilconazole decreases expression EXP 6480464 enilconazole results in decreased expression of SLC9A3 mRNA CTD PMID:29106682 and PMID:32814239 Slc9a3 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of SLC9A3 gene CTD PMID:20938992 Slc9a3 Mouse folic acid decreases expression ISO SLC9A3 (Homo sapiens) 6480464 Folic Acid results in decreased expression of SLC9A3 mRNA CTD PMID:21867686 Slc9a3 Mouse fulvestrant multiple interactions ISO SLC9A3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SLC9A3 gene and [bisphenol S co-treated with Fulvestrant] results in decreased methylation of SLC9A3 gene CTD PMID:31601247 Slc9a3 Mouse gentamycin affects expression ISO Slc9a3 (Rattus norvegicus) 6480464 Gentamicins affects the expression of SLC9A3 protein CTD PMID:16850027 Slc9a3 Mouse gentamycin decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of SLC9A3 protein CTD PMID:19967075 Slc9a3 Mouse GW 4064 decreases expression EXP 6480464 GW 4064 results in decreased expression of SLC9A3 mRNA CTD PMID:26655953 Slc9a3 Mouse hydrogencarbonate affects uptake ISO Slc9a3 (Rattus norvegicus) 6480464 SLC9A3 protein affects the uptake of Bicarbonates CTD PMID:12427137 Slc9a3 Mouse hydrogencarbonate multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 [3-(2-(3-guanidino-2-methyl-3-oxo-propenyl)-5-methylphenyl)-N-isopropylidene-2-methyl-acrylamide dihydrochloride results in decreased activity of SLC9A3 protein] which results in increased secretion of Bicarbonates and [5-dimethylamiloride results in decreased activity of SLC9A3 protein] which results in increased secretion of Bicarbonates CTD PMID:12881227 Slc9a3 Mouse hydrogencarbonate affects transport ISO Slc9a3 (Rattus norvegicus) 6480464 SLC9A3 protein affects the transport of Bicarbonates CTD PMID:11704563 Slc9a3 Mouse indometacin increases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Indomethacin results in increased expression of SLC9A3 protein CTD PMID:15053815 Slc9a3 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of SLC9A3 gene CTD PMID:20938992 Slc9a3 Mouse lithium atom increases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Lithium results in increased expression of SLC9A3 protein CTD PMID:10966935 Slc9a3 Mouse lithium hydride increases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Lithium results in increased expression of SLC9A3 protein CTD PMID:10966935 Slc9a3 Mouse losartan multiple interactions EXP 6480464 Losartan inhibits the reaction [Ammonium Chloride results in increased expression of NHE3 protein] CTD PMID:18287403 Slc9a3 Mouse mercury dichloride decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Mercuric Chloride results in decreased expression of SLC9A3 protein CTD PMID:16189294 Slc9a3 Mouse mercury dichloride multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 Mercuric Chloride results in decreased activity of and results in increased phosphorylation of SLC9A3 protein CTD PMID:33476711 Slc9a3 Mouse methapyrilene increases methylation ISO SLC9A3 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of SLC9A3 intron CTD PMID:30157460 Slc9a3 Mouse methylarsonic acid multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of SLC9A3 mRNA CTD PMID:34876320 Slc9a3 Mouse mono(2-ethylhexyl) phthalate decreases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of SLC9A3 mRNA CTD PMID:36189433 Slc9a3 Mouse mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of SLC9A3 mRNA CTD PMID:36189433 Slc9a3 Mouse naphthalene decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 naphthalene analog results in decreased expression of SLC9A3 mRNA CTD PMID:24976557 Slc9a3 Mouse perfluorooctane-1-sulfonic acid decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 perfluorooctane sulfonic acid results in decreased expression of SLC9A3 mRNA CTD PMID:18692542 Slc9a3 Mouse piperine multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 [piperine co-treated with Cimetidine co-treated with Pyruvates] inhibits the reaction [Puromycin Aminonucleoside results in decreased expression of SLC9A3 protein] CTD PMID:12806184 Slc9a3 Mouse procymidone increases expression EXP 6480464 procymidone results in increased expression of SLC9A3 mRNA CTD PMID:33246813 Slc9a3 Mouse procymidone multiple interactions EXP 6480464 [tetrachloroisophthalonitrile co-treated with procymidone] results in increased expression of SLC9A3 mRNA CTD PMID:33246813 Slc9a3 Mouse reactive nitrogen species multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 [manganese tetrakis-(N-methyl-2 pyridyl) porphyrin affects the abundance of [Reactive Oxygen Species co-treated with Reactive Nitrogen Species]] which affects the expression of SLC9A3 CTD PMID:20003708 Slc9a3 Mouse reactive oxygen species multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 [manganese tetrakis-(N-methyl-2 pyridyl) porphyrin affects the abundance of [Reactive Oxygen Species co-treated with Reactive Nitrogen Species]] which affects the expression of SLC9A3 CTD PMID:20003708 Slc9a3 Mouse resveratrol multiple interactions ISO SLC9A3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of SLC9A3 mRNA and [Resveratrol results in increased expression of SLC9A3 protein] which results in increased uptake of Sodium Chloride CTD PMID:21191669 and PMID:23557933 Slc9a3 Mouse resveratrol increases expression ISO SLC9A3 (Homo sapiens) 6480464 resveratrol results in increased expression of SLC9A3 protein CTD PMID:21191669 Slc9a3 Mouse S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 Buthionine Sulfoximine inhibits the reaction [2 more ... CTD PMID:23876469 Slc9a3 Mouse SKF 38393 multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 Buthionine Sulfoximine inhibits the reaction [2 more ... CTD PMID:23876469 Slc9a3 Mouse SKF 38393 decreases activity ISO Slc9a3 (Rattus norvegicus) 6480464 2 more ... CTD PMID:23876469 Slc9a3 Mouse sodium arsenate multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of SLC9A3 mRNA CTD PMID:34876320 Slc9a3 Mouse sodium arsenite multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of SLC9A3 mRNA CTD PMID:34876320 Slc9a3 Mouse sodium atom multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 [3-(2-(3-guanidino-2-methyl-3-oxo-propenyl)-5-methylphenyl)-N-isopropylidene-2-methyl-acrylamide dihydrochloride results in decreased activity of SLC9A3 protein] which results in decreased transport of Sodium CTD PMID:10710541 Slc9a3 Mouse sodium atom increases uptake ISO Slc9a3 (Rattus norvegicus) 6480464 SLC9A3 protein results in increased uptake of Sodium CTD PMID:10710541 Slc9a3 Mouse sodium chloride multiple interactions ISO SLC9A3 (Homo sapiens) 6480464 [resveratrol results in increased expression of SLC9A3 protein] which results in increased uptake of Sodium Chloride CTD PMID:21191669 Slc9a3 Mouse sotorasib multiple interactions ISO SLC9A3 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of SLC9A3 mRNA CTD PMID:36139627 Slc9a3 Mouse tamoxifen multiple interactions EXP 6480464 ESR1 protein mutant form inhibits the reaction [Tamoxifen results in decreased expression of SLC9A3 mRNA] more ... CTD PMID:23213263 Slc9a3 Mouse tamoxifen decreases expression EXP 6480464 Tamoxifen results in decreased expression of SLC9A3 mRNA CTD PMID:23213263 Slc9a3 Mouse tetrachloromethane decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of SLC9A3 protein CTD PMID:15673309 and PMID:16192424 Slc9a3 Mouse tetrachloromethane increases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of SLC9A3 protein CTD PMID:16192424 Slc9a3 Mouse thallium multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 [thallium sulfate results in increased abundance of Thallium] which results in decreased expression of SLC9A3 mRNA CTD PMID:39361050 Slc9a3 Mouse thallium sulfate multiple interactions ISO Slc9a3 (Rattus norvegicus) 6480464 [thallium sulfate results in increased abundance of Thallium] which results in decreased expression of SLC9A3 mRNA CTD PMID:39361050 Slc9a3 Mouse titanium dioxide multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC9A3 mRNA CTD PMID:29950665 Slc9a3 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SLC9A3 enhancer CTD PMID:35295148 Slc9a3 Mouse trametinib multiple interactions ISO SLC9A3 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of SLC9A3 mRNA CTD PMID:36139627 Slc9a3 Mouse tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of SLC9A3 mRNA CTD PMID:17127020 Slc9a3 Mouse valproic acid increases expression ISO SLC9A3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLC9A3 mRNA CTD PMID:19101580 Slc9a3 Mouse valproic acid decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Valproic Acid results in decreased expression of SLC9A3 mRNA CTD PMID:35594946 Slc9a3 Mouse valproic acid increases methylation ISO SLC9A3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SLC9A3 gene CTD PMID:29154799 Slc9a3 Mouse zinc atom decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Zinc deficiency results in decreased expression of SLC9A3 mRNA CTD PMID:11717422 Slc9a3 Mouse zinc(0) decreases expression ISO Slc9a3 (Rattus norvegicus) 6480464 Zinc deficiency results in decreased expression of SLC9A3 mRNA CTD PMID:11717422
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (EXP) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) acrylamide (ISO) aldosterone (EXP) all-trans-retinoic acid (EXP) ammonium chloride (EXP,ISO) arsane (ISO) arsenic atom (ISO) Azoxymethane (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bisphenol A (ISO) cadmium dichloride (ISO) chlorothalonil (EXP) choline (EXP) cimetidine (ISO) cisplatin (ISO) clofibrate (ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (ISO) DDT (EXP) dexamethasone (ISO) dextran sulfate (EXP) dimethylarsinic acid (EXP) enilconazole (EXP) folic acid (EXP,ISO) fulvestrant (ISO) gentamycin (ISO) GW 4064 (EXP) hydrogencarbonate (ISO) indometacin (ISO) L-methionine (EXP) lithium atom (ISO) lithium hydride (ISO) losartan (EXP) mercury dichloride (ISO) methapyrilene (ISO) methylarsonic acid (EXP) mono(2-ethylhexyl) phthalate (EXP) naphthalene (ISO) perfluorooctane-1-sulfonic acid (ISO) piperine (ISO) procymidone (EXP) reactive nitrogen species (ISO) reactive oxygen species (ISO) resveratrol (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) SKF 38393 (ISO) sodium arsenate (EXP) sodium arsenite (EXP) sodium atom (ISO) sodium chloride (ISO) sotorasib (ISO) tamoxifen (EXP) tetrachloromethane (ISO) thallium (ISO) thallium sulfate (ISO) titanium dioxide (EXP) trametinib (ISO) tunicamycin (EXP) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Altered expression of Na(+)/H(+) exchanger isoforms 1 and 3 in clipped and unclipped kidneys of a 2-kidney-1-clip Goldblatt model of hypertension.
Khan I, etal., Nephron 2002 Oct;92(2):346-55.
2.
Acute and Chronic Regulation of the Renal Na/H(+) Exchanger NHE3 in Rats with STZ-Induced Diabetes mellitus.
Klisic J, etal., Nephron Physiol. 2005 Oct 19;102(2):p27-p35.
3.
Angiotensin II clamp prevents the second step in renal apical NHE3 internalization during acute hypertension.
Leong PK, etal., Am J Physiol Renal Physiol 2002 Nov;283(5):F1142-50.
4.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
5.
MGDs mouse GO annotations
MGD data from the GO Consortium
6.
MGD IEA
MGD IEA
7.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Rosiglitazone regulates ENaC and Na-K-2Cl cotransporter (NKCC2) abundance in the obese Zucker rat.
Riazi S, etal., Am J Nephrol. 2006;26(3):245-57. Epub 2006 Jun 2.
14.
Molecular variants of the sodium/hydrogen exchanger type 3 gene and essential hypertension.
Zhu H, etal., J Hypertens. 2004 Jul;22(7):1269-75.
Slc9a3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 74,234,374 - 74,317,561 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 74,269,576 - 74,317,561 (+) Ensembl GRCm39 Ensembl GRCm38 13 74,086,255 - 74,169,442 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 74,121,457 - 74,169,442 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 74,258,963 - 74,303,512 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 74,587,517 - 74,632,066 (+) NCBI MGSCv36 mm8 Celera 13 76,451,103 - 76,495,653 (+) NCBI Celera Cytogenetic Map 13 C1 NCBI cM Map 13 40.15 NCBI
SLC9A3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 470,456 - 524,449 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 470,456 - 524,449 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 470,571 - 524,564 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 526,425 - 577,447 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 526,424 - 577,447 NCBI Celera 5 570,966 - 620,781 (-) NCBI Celera Cytogenetic Map 5 p15.33 NCBI HuRef 5 460,638 - 510,183 (-) NCBI HuRef CHM1_1 5 472,597 - 524,559 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 465,265 - 518,871 (-) NCBI T2T-CHM13v2.0
Slc9a3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 30,953,215 - 30,996,209 (-) NCBI GRCr8 mRatBN7.2 1 29,124,633 - 29,167,912 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 29,124,674 - 29,167,417 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 28,926,541 - 28,969,373 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 34,926,400 - 34,969,224 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 29,127,163 - 29,169,987 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 31,731,652 - 31,777,144 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 31,734,327 - 31,777,070 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 33,159,607 - 33,201,753 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 29,930,908 - 29,973,686 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 29,933,852 - 29,976,631 (-) NCBI Celera 1 27,776,582 - 27,819,219 (-) NCBI Celera Cytogenetic Map 1 p11 NCBI
Slc9a3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955504 228,049 - 260,650 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955504 226,192 - 260,632 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100988373 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 112,257,212 - 112,299,973 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 112,258,794 - 112,305,293 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 444,720 - 500,121 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 597,897 - 646,108 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 597,897 - 647,464 (-) Ensembl panpan1.1 panPan2
SLC9A3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 11,748,556 - 11,785,209 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 34 11,748,175 - 11,785,786 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 16,258,013 - 16,298,999 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 11,649,118 - 11,689,897 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 34 11,649,113 - 11,690,798 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 34 11,699,849 - 11,740,579 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 11,680,359 - 11,721,422 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 11,890,462 - 11,930,512 (+) NCBI UU_Cfam_GSD_1.0
Slc9a3
SLC9A3
LOC103214902
Slc9a3
.
Predicted Target Of
Count of predictions: 141 Count of miRNA genes: 130 Interacting mature miRNAs: 136 Transcripts: ENSMUST00000036208 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142331 Bxs6_m BXSB/MpJ autoimmune nephritis 6 (mouse) Not determined 45210442 83744746 Mouse 1301593 Heal8_m wound healing/regeneration 8 (mouse) Not determined 13 68053999 102054119 Mouse 1300573 Elsgp2_m elevated serum gp70 2 (mouse) Not determined 13 50616828 84617027 Mouse 10412109 Bxs7_m BXSB/MpJ autoimmune nephritis 7 (mouse) Not determined 13 45210442 83744746 Mouse 10412235 Scgq5_m spontaneous crescentic glomerulonephritis QTL 5 (mouse) Not determined 13 36060908 96239162 Mouse 4142314 Tailaq3_m tail length adjusted QTL 3 (mouse) Not determined 55720354 112431103 Mouse 1558850 Sgp3_m serum gp70 production 3 (mouse) Not determined 13 56470456 76971314 Mouse 1301445 Listr2_m listeriosis resistance 2 (mouse) Not determined 13 66744601 100744746 Mouse 4141992 W6q16_m weight 6 weeks QTL 16 (mouse) Not determined 55720354 112431103 Mouse 4142372 Moo2_m modifier of Odc2 (mouse) Not determined X 50318411 84318559 Mouse 15039353 Nmrs35_m NAFLD-associated magnetic resonance shift 35 (mouse) 13 40588253 74588253 Mouse 10412163 Wra1_m wheel running activity 1 (mouse) Not determined 13 59132600 93132738 Mouse 4142241 Tailq3_m tail length QTL 3 (mouse) Not determined 55720354 112431103 Mouse 1300941 Skl6_m skeletal size (tail length) 6 (mouse) Not determined 13 64250821 98250945 Mouse 14747007 Mancz11_m mandible centroid size 11 (mouse) 13 70111284 104111284 Mouse 4140959 W10q17_m weight 10 weeks QTL 17 (mouse) Not determined 55720354 112431103 Mouse 1357553 Cia28_m collagen induced arthritis 28 (mouse) Not determined 13 56629249 96239162 Mouse 1302073 Pgct1_m primordial germ cell tumor locus 1 (mouse) Not determined 13 53820783 87820897 Mouse 1301949 Skull20_m skull morphology 20 (mouse) Not determined 13 64250821 98250945 Mouse 1300668 Pas10_m pulmonary adenoma susceptibility 10 (mouse) Not determined 13 41489042 75489158 Mouse 1357563 Bmch6_m bone mechanical trait 6 (mouse) Not determined 13 55384980 89385140 Mouse 10402414 Sgp5_m serum gp70 production 5 (mouse) Not determined 13 56470456 105422186 Mouse 1301666 Eae13_m susceptibility to experimental allergic encephalomyelitis 13 (mouse) Not determined 13 50318411 84318559 Mouse 26884393 Humsd7_m humerus midshaft diameter 7, 16 week (mouse) 13 3950000 76048119 Mouse 14696726 Kidrq3_m kidney weight, right QTL 3 (mouse) 13 68217066 102217066 Mouse 4142147 Mvwf4_m modifier of von Willebrand factor 4 (mouse) Not determined 20477612 112898424 Mouse 14746975 Manh74_m mandible shape 74 (mouse) 13 52477269 86477269 Mouse
AI930210
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 13 74,169,322 - 74,169,404 UniSTS GRCm38 MGSCv37 13 74,306,770 - 74,306,852 UniSTS GRCm37 Celera 13 76,498,911 - 76,498,993 UniSTS Cytogenetic Map 13 C1 UniSTS cM Map 13 43.0 UniSTS Whitehead/MRC_RH 13 667.43 UniSTS
Slc9a3
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 13 C1 UniSTS cM Map 13 43.0 UniSTS
Slc9a3
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 13 C1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000036208 ⟹ ENSMUSP00000038142
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 74,269,634 - 74,314,183 (+) Ensembl GRCm38.p6 Ensembl 13 74,121,515 - 74,166,064 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000221410
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 74,269,576 - 74,279,010 (+) Ensembl GRCm38.p6 Ensembl 13 74,121,457 - 74,130,891 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000221703 ⟹ ENSMUSP00000152682
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 74,269,634 - 74,317,561 (+) Ensembl GRCm38.p6 Ensembl 13 74,121,515 - 74,169,442 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000225423 ⟹ ENSMUSP00000153255
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 74,269,634 - 74,315,282 (+) Ensembl GRCm38.p6 Ensembl 13 74,121,515 - 74,167,163 (+) Ensembl
RefSeq Acc Id:
NM_001081060 ⟹ NP_001074529
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 74,269,532 - 74,317,561 (+) NCBI GRCm38 13 74,121,413 - 74,169,441 (+) NCBI MGSCv37 13 74,258,963 - 74,303,512 (+) RGD Celera 13 76,451,103 - 76,495,653 (+) RGD cM Map 13 ENTREZGENE
Sequence:
CTGACTGCTGCCAGCTCCGGGCTCGCGCAGAGGGCTGCGACGGAGAGCGCAGCAGGTACTCACCAAGGTATGCGTGTTGGCTCCCGGAGCTGAGCAGCAGCGATGTGGCACCGGGCTCTGGGACCAGG
hide sequence
RefSeq Acc Id:
XM_006517021 ⟹ XP_006517084
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 74,234,374 - 74,317,561 (+) NCBI GRCm38 13 74,086,255 - 74,169,442 (+) NCBI
Sequence:
AGTATTGCTTGTTGAGAAGCTCAGGTAGAGACTAAGCCTTGTGGGAGCACACTCCCCAACATGTGGGCATGGGAGTCTGACAGTCTGCGCACCCTTGTTCTCCTGGCCTGGTTGGGGAATACTGCTTA
hide sequence
RefSeq Acc Id:
XM_006517022 ⟹ XP_006517085
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 74,269,484 - 74,317,561 (+) NCBI GRCm38 13 74,121,367 - 74,169,442 (+) NCBI
Sequence:
GCGGGAGGAGGCAGCGGGATTAAAGGCCACCCGGGCGGGCCTGGGGACCTGACTGCTGCCAGCTCCGGGCTCGCGCAGAGGGCTGCGACGGAGAGCGCAGCAGGTACTCACCAAGGTATGCGTGTTGG
hide sequence
RefSeq Acc Id:
NP_001074529 ⟸ NM_001081060
- Peptide Label:
precursor
- UniProtKB:
Q8BZU0 (UniProtKB/Swiss-Prot), G3X939 (UniProtKB/Swiss-Prot), A0A286YD40 (UniProtKB/TrEMBL)
- Sequence:
MWHRALGPGWKLLLALALTSLQGARGAEEEPSSDGSFQVVTFKWHHVQDPYIIALWILVASLAKIVFHLSHKVTSIVPESALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVLDAGYFMPN
hide sequence
RefSeq Acc Id:
XP_006517084 ⟸ XM_006517021
- Peptide Label:
isoform X1
- UniProtKB:
A0A286YD40 (UniProtKB/TrEMBL)
- Sequence:
MWAWESDSLRTLVLLAWLGNTAYPQALSGPGLGPELLHPWNSSGFSVVSLQWLSVRDPFLITAW
hide sequence
RefSeq Acc Id:
XP_006517085 ⟸ XM_006517022
- Peptide Label:
isoform X2
- UniProtKB:
Q8BZU0 (UniProtKB/Swiss-Prot), G3X939 (UniProtKB/Swiss-Prot), A0A286YD40 (UniProtKB/TrEMBL)
- Sequence:
MWHRALGPGWKLLLALALTSLQGARGAEEEPSSDGSFQVVTFKWHHVQDPYIIALWILVASLAK
hide sequence
Ensembl Acc Id:
ENSMUSP00000153255 ⟸ ENSMUST00000225423
Ensembl Acc Id:
ENSMUSP00000038142 ⟸ ENSMUST00000036208
Ensembl Acc Id:
ENSMUSP00000152682 ⟸ ENSMUST00000221703
RGD ID: 8680826 Promoter ID: EPDNEW_M18444 Type: multiple initiation site Name: Slc9a3_1 Description: Mus musculus solute carrier family 9 (sodium/hydrogen exchanger),member 3 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 13 74,121,415 - 74,121,475 EPDNEW
RGD ID: 6824405 Promoter ID: MM_KWN:14682 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: NM_001081060 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 74,258,661 - 74,259,161 (+) MPROMDB
RGD ID: 6824407 Promoter ID: MM_KWN:14684 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Lung Transcripts: UC007RET.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 74,300,811 - 74,302,112 (+) MPROMDB
