Symbol:
Tgfb2
Name:
transforming growth factor, beta 2
RGD ID:
70491
Description:
Enables identical protein binding activity. Involved in several processes, including negative regulation of release of sequestered calcium ion into cytosol; regulation of apoptotic process; and skeletal system morphogenesis. Located in several cellular components, including cell surface; secretory granule; and trans-Golgi network. Biomarker of diabetic neuropathy; myocardial infarction; and osteochondrodysplasia. Human ortholog(s) of this gene implicated in Loeys-Dietz syndrome 4; colorectal cancer; and pancreatic adenosquamous carcinoma. Orthologous to human TGFB2 (transforming growth factor beta 2); PARTICIPATES IN glypican signaling pathway; Hedgehog signaling pathway; transforming growth factor-beta Smad dependent signaling pathway; INTERACTS WITH (R)-lipoic acid; (R)-noradrenaline; 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
TGF beta 2 protein; TGF-B2; TGF-beta-2; transforming growth factor beta-2; transforming growth factor beta-2 proprotein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TGFB2 (transforming growth factor beta 2)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Tgfb2 (transforming growth factor, beta 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tgfb2 (transforming growth factor beta 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TGFB2 (transforming growth factor beta 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TGFB2 (transforming growth factor beta 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tgfb2 (transforming growth factor beta 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TGFB2 (transforming growth factor beta 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TGFB2 (transforming growth factor beta 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tgfb2 (transforming growth factor beta 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
IFI16 (interferon gamma inducible protein 16)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TGFB2 (transforming growth factor beta 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tgfb2 (transforming growth factor, beta 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tgfb2 (transforming growth factor, beta 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tgfb2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 100,691,540 - 100,793,227 (-) NCBI GRCr8 mRatBN7.2 13 98,160,075 - 98,261,771 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 98,160,087 - 98,261,405 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 100,678,931 - 100,778,632 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 102,066,560 - 102,165,910 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 99,261,239 - 99,360,947 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 105,039,639 - 105,142,010 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 105,039,853 - 105,141,030 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 109,679,866 - 109,792,609 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 102,718,703 - 102,818,768 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 102,907,748 - 103,007,811 (-) NCBI Celera 13 97,669,691 - 97,769,426 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tgfb2 Rat (1->4)-beta-D-glucan multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TGFB2 mRNA CTD PMID:36331819 Tgfb2 Rat (R)-lipoic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide co-treated with Thioctic Acid] affects the expression of TGFB2 mRNA and [Thioctic Acid co-treated with Propylthiouracil] results in increased expression of TGFB2 mRNA CTD PMID:23830814 and PMID:31068541 Tgfb2 Rat (R)-noradrenaline increases expression EXP 6480464 Norepinephrine results in increased expression of TGFB2 mRNA and Norepinephrine results in increased expression of TGFB2 protein CTD PMID:15326086 Tgfb2 Rat (R)-noradrenaline multiple interactions EXP 6480464 Prazosin inhibits the reaction [Norepinephrine results in increased expression of TGFB2 mRNA] CTD PMID:15326086 Tgfb2 Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Tgfb2 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane decreases expression ISO TGFB2 (Homo sapiens) 6480464 o and p'-DDT results in decreased expression of TGFB2 mRNA CTD PMID:19371625 Tgfb2 Rat 1,1-dichloroethene increases expression ISO Tgfb2 (Mus musculus) 6480464 vinylidene chloride results in increased expression of TGFB2 mRNA CTD PMID:26682919 Tgfb2 Rat 1,2-dichloroethane decreases expression ISO Tgfb2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of TGFB2 mRNA CTD PMID:28960355 Tgfb2 Rat 1,2-dimethylhydrazine increases expression ISO Tgfb2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of TGFB2 mRNA CTD PMID:22206623 Tgfb2 Rat 1-naphthyl isothiocyanate multiple interactions ISO Tgfb2 (Mus musculus) 6480464 FGG protein affects the reaction [1-Naphthylisothiocyanate results in increased expression of TGFB2 mRNA] more ... CTD PMID:24633426 more ... Tgfb2 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat 1-naphthyl isothiocyanate increases expression ISO Tgfb2 (Mus musculus) 6480464 1-Naphthylisothiocyanate results in increased expression of TGFB2 mRNA CTD PMID:24633426 more ... Tgfb2 Rat 17alpha-ethynylestradiol affects expression ISO TGFB2 (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of TGFB2 mRNA CTD PMID:20170705 Tgfb2 Rat 17alpha-ethynylestradiol decreases expression ISO TGFB2 (Homo sapiens) 6480464 Ethinyl Estradiol results in decreased expression of TGFB2 mRNA CTD PMID:18936297 Tgfb2 Rat 17beta-estradiol affects expression ISO TGFB2 (Homo sapiens) 6480464 Estradiol affects the expression of TGFB2 mRNA CTD PMID:14699072 Tgfb2 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TGFB2 mRNA CTD PMID:32741896 Tgfb2 Rat 17beta-estradiol increases expression ISO Tgfb2 (Mus musculus) 6480464 Estradiol results in increased expression of TGFB2 mRNA CTD PMID:19484750 and PMID:8390853 Tgfb2 Rat 17beta-estradiol increases expression ISO TGFB2 (Homo sapiens) 6480464 Estradiol results in increased expression of TGFB2 mRNA CTD PMID:11813992 and PMID:19484750 Tgfb2 Rat 17beta-estradiol decreases expression ISO TGFB2 (Homo sapiens) 6480464 Estradiol results in decreased expression of TGFB2 mRNA CTD PMID:16474171 more ... Tgfb2 Rat 17beta-estradiol multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Dronabinol promotes the reaction [Estradiol results in increased expression of TGFB2 mRNA] CTD PMID:8390853 Tgfb2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TGFB2 mRNA CTD PMID:20068009 Tgfb2 Rat 17beta-estradiol multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in decreased expression of TGFB2 mRNA more ... CTD PMID:17404688 more ... Tgfb2 Rat 17beta-estradiol affects expression ISO Tgfb2 (Mus musculus) 6480464 Estradiol affects the expression of TGFB2 mRNA CTD PMID:15598610 Tgfb2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TGFB2 mRNA CTD PMID:32741896 Tgfb2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO TGFB2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of TGFB2 mRNA CTD PMID:29581250 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of TGFB2 mRNA CTD PMID:19619570 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TGFB2 mRNA CTD PMID:33387578 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TGFB2 mRNA CTD PMID:34747641 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TGFB2 mRNA CTD PMID:32109520 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tgfb2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TGFB2 mRNA CTD PMID:14728982 and PMID:27562557 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tgfb2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TGFB2 mRNA CTD PMID:26377647 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TGFB2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TGFB2 protein CTD PMID:9787404 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tgfb2 (Mus musculus) 6480464 AHR protein promotes the reaction [Tetrachlorodibenzodioxin results in decreased expression of TGFB2 mRNA] CTD PMID:15034205 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TGFB2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TGFB2 mRNA CTD PMID:1447203 and PMID:19619570 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases chemical synthesis ISO TGFB2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased chemical synthesis of TGFB2 mRNA CTD PMID:1447203 Tgfb2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tgfb2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TGFB2 mRNA and Tetrachlorodibenzodioxin results in decreased expression of TGFB2 protein CTD PMID:17056225 more ... Tgfb2 Rat 2,4,6-trinitrobenzenesulfonic acid decreases expression ISO Tgfb2 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of TGFB2 mRNA CTD PMID:25307695 Tgfb2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Tgfb2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Tgfb2 Rat 2-nitrotoluene decreases expression EXP 6480464 2-nitrotoluene results in decreased expression of TGFB2 mRNA CTD PMID:16460773 Tgfb2 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Tgfb2 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Tgfb2 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of TGFB2 mRNA CTD PMID:25172293 Tgfb2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Dexamethasone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with 1-Methyl-3-isobutylxanthine] results in decreased expression of TGFB2 mRNA CTD PMID:16997883 Tgfb2 Rat 4,4'-sulfonyldiphenol increases expression ISO Tgfb2 (Mus musculus) 6480464 bisphenol S results in increased expression of TGFB2 mRNA CTD PMID:30951980 Tgfb2 Rat 4-nitrophenol increases expression ISO Tgfb2 (Mus musculus) 6480464 4-nitrophenol results in increased expression of TGFB2 mRNA CTD PMID:34673133 Tgfb2 Rat 4-tert-Octylphenol decreases expression ISO Tgfb2 (Mus musculus) 6480464 4-tert-octylphenol results in decreased expression of TGFB2 protein CTD PMID:18065773 Tgfb2 Rat 5'-S-methyl-5'-thioadenosine decreases expression ISO Tgfb2 (Mus musculus) 153297773 5'-S-methyl-5'-thioadenosine decreases expression of Tgfb2 mRNA in Mdr2-/- mouse liver and myofibroblasts RGD Tgfb2 Rat 5-fluorouracil affects response to substance ISO TGFB2 (Homo sapiens) 6480464 TGFB2 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Tgfb2 Rat 5-fluorouracil decreases response to substance ISO Tgfb2 (Mus musculus) 6480464 TGFB2 gene polymorphism results in decreased susceptibility to Fluorouracil CTD PMID:18941179 Tgfb2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TGFB2 mRNA CTD PMID:24780913 Tgfb2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TGFB2 mRNA CTD PMID:30047161 Tgfb2 Rat 6-propyl-2-thiouracil multiple interactions EXP 6480464 [Thioctic Acid co-treated with Propylthiouracil] results in increased expression of TGFB2 mRNA CTD PMID:31068541 Tgfb2 Rat 8-Br-cAMP multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Dexamethasone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with 1-Methyl-3-isobutylxanthine] results in decreased expression of TGFB2 mRNA CTD PMID:16997883 Tgfb2 Rat acetaldehyde affects expression ISO Tgfb2 (Mus musculus) 6480464 Acetaldehyde affects the expression of TGFB2 mRNA CTD PMID:22634333 Tgfb2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TGFB2 mRNA CTD PMID:31881176 Tgfb2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TGFB2 mRNA CTD PMID:28959563 Tgfb2 Rat actinomycin D multiple interactions ISO TGFB2 (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [TGFB2 protein results in increased expression of COL1A1 mRNA] and Dactinomycin inhibits the reaction [TGFB2 protein results in increased expression of FN1 mRNA] CTD PMID:18253093 Tgfb2 Rat adenosine multiple interactions ISO TGFB2 (Homo sapiens) 6480464 Adenosine results in increased expression of and results in increased secretion of TGFB2 protein CTD PMID:34070360 Tgfb2 Rat adenosine increases expression ISO TGFB2 (Homo sapiens) 6480464 Adenosine results in increased expression of TGFB2 mRNA CTD PMID:34070360 Tgfb2 Rat aflatoxin B1 increases expression ISO TGFB2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of TGFB2 mRNA CTD PMID:27153756 and PMID:32234424 Tgfb2 Rat all-trans-retinoic acid multiple interactions ISO TGFB2 (Homo sapiens) 6480464 IFNG protein inhibits the reaction [Tretinoin results in increased expression of TGFB2 mRNA] CTD PMID:16007204 Tgfb2 Rat all-trans-retinoic acid decreases expression ISO Tgfb2 (Mus musculus) 6480464 Tretinoin results in decreased expression of TGFB2 mRNA and Tretinoin results in decreased expression of TGFB2 protein CTD PMID:37866657 Tgfb2 Rat all-trans-retinoic acid multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of TGFB2 mRNA and [bisphenol F co-treated with Tretinoin] results in decreased expression of TGFB2 mRNA CTD PMID:30951980 Tgfb2 Rat all-trans-retinoic acid affects expression ISO Tgfb2 (Mus musculus) 6480464 Tretinoin affects the expression of TGFB2 mRNA CTD PMID:16235736 Tgfb2 Rat all-trans-retinoic acid increases secretion ISO TGFB2 (Homo sapiens) 6480464 Tretinoin results in increased secretion of TGFB2 protein CTD PMID:15970678 and PMID:16473924 Tgfb2 Rat all-trans-retinoic acid increases expression ISO TGFB2 (Homo sapiens) 6480464 Tretinoin results in increased expression of TGFB2 mRNA and Tretinoin results in increased expression of TGFB2 protein CTD PMID:15955085 more ... Tgfb2 Rat allethrin multiple interactions EXP 6480464 [fenvalerate co-treated with Allethrins co-treated with cypermethrin co-treated with decamethrin co-treated with cyhalothrin] results in decreased expression of TGFB2 mRNA CTD PMID:36053783 Tgfb2 Rat allopurinol increases expression EXP 6480464 Allopurinol results in increased expression of TGFB2 mRNA CTD PMID:37876353 Tgfb2 Rat Allylamine increases expression EXP 6480464 Allylamine results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat AM-251 multiple interactions ISO TGFB2 (Homo sapiens) 6480464 AM 251 inhibits the reaction [TGFB1 protein results in increased expression of TGFB2 mRNA] CTD PMID:27936102 Tgfb2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of TGFB2 mRNA CTD PMID:30047161 Tgfb2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TGFB2 mRNA CTD PMID:16483693 Tgfb2 Rat aristolochic acid A decreases expression ISO TGFB2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TGFB2 mRNA and aristolochic acid I results in decreased expression of TGFB2 protein CTD PMID:33212167 Tgfb2 Rat arsenite(3-) multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of TGFB2 mRNA more ... CTD PMID:15894712 more ... Tgfb2 Rat arsenite(3-) decreases expression ISO TGFB2 (Homo sapiens) 6480464 arsenite results in decreased expression of TGFB2 mRNA CTD PMID:16085347 and PMID:23974009 Tgfb2 Rat arsenite(3-) decreases expression ISO Tgfb2 (Mus musculus) 6480464 arsenite results in decreased expression of TGFB2 mRNA CTD PMID:15894712 Tgfb2 Rat arsenite(3-) multiple interactions ISO TGFB2 (Homo sapiens) 6480464 caffeic acid phenethyl ester inhibits the reaction [arsenite results in decreased expression of TGFB2 mRNA] CTD PMID:16085347 Tgfb2 Rat astemizole increases expression EXP 6480464 Astemizole results in increased expression of TGFB2 mRNA CTD PMID:20221588 Tgfb2 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of TGFB2 mRNA CTD PMID:36841081 Tgfb2 Rat belinostat increases expression ISO TGFB2 (Homo sapiens) 6480464 belinostat results in increased expression of TGFB2 mRNA CTD PMID:23671600 Tgfb2 Rat benzene decreases expression ISO TGFB2 (Homo sapiens) 6480464 Benzene results in decreased expression of TGFB2 mRNA CTD PMID:33064461 Tgfb2 Rat benzo[a]pyrene multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of TGFB2 mRNA and AHR protein promotes the reaction [Benzo(a)pyrene results in decreased expression of TGFB2 mRNA] CTD PMID:15034205 and PMID:15894712 Tgfb2 Rat benzo[a]pyrene decreases expression ISO TGFB2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TGFB2 mRNA CTD PMID:35870112 Tgfb2 Rat benzo[a]pyrene decreases methylation ISO TGFB2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TGFB2 exon and Benzo(a)pyrene results in decreased methylation of TGFB2 promoter CTD PMID:27901495 Tgfb2 Rat benzo[a]pyrene decreases methylation ISO Tgfb2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of TGFB2 exon and Benzo(a)pyrene results in decreased methylation of TGFB2 intron CTD PMID:27901495 Tgfb2 Rat benzo[a]pyrene decreases expression ISO Tgfb2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TGFB2 mRNA CTD PMID:15034205 more ... Tgfb2 Rat benzo[a]pyrene increases expression ISO Tgfb2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TGFB2 mRNA CTD PMID:22228805 Tgfb2 Rat benzo[a]pyrene affects expression ISO Tgfb2 (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of TGFB2 mRNA CTD PMID:15037607 Tgfb2 Rat benzo[a]pyrene increases expression ISO TGFB2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TGFB2 mRNA CTD PMID:19181443 more ... Tgfb2 Rat Benzo[ghi]perylene increases expression ISO Tgfb2 (Mus musculus) 6480464 1 and 12-benzoperylene results in increased expression of TGFB2 mRNA CTD PMID:26377693 Tgfb2 Rat Benzo[k]fluoranthene decreases expression ISO Tgfb2 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of TGFB2 mRNA CTD PMID:26377693 Tgfb2 Rat bis(2-chloroethyl) sulfide decreases expression ISO Tgfb2 (Mus musculus) 6480464 Mustard Gas results in decreased expression of TGFB2 mRNA CTD PMID:18955075 Tgfb2 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of TGFB2 mRNA and Diethylhexyl Phthalate results in decreased expression of TGFB2 protein CTD PMID:20920545 Tgfb2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TGFB2 mRNA CTD PMID:30816183 Tgfb2 Rat bisphenol A decreases expression ISO Tgfb2 (Mus musculus) 6480464 bisphenol A results in decreased expression of TGFB2 mRNA CTD PMID:37105096 Tgfb2 Rat bisphenol A decreases methylation ISO TGFB2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of TGFB2 gene CTD PMID:31601247 Tgfb2 Rat bisphenol A increases expression ISO Tgfb2 (Mus musculus) 6480464 bisphenol A results in increased expression of TGFB2 mRNA CTD PMID:30951980 Tgfb2 Rat bisphenol A multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of TGFB2 mRNA CTD PMID:30951980 Tgfb2 Rat bisphenol A decreases methylation ISO Tgfb2 (Mus musculus) 6480464 bisphenol A results in decreased methylation of TGFB2 promoter CTD PMID:27312807 Tgfb2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TGFB2 mRNA CTD PMID:25181051 Tgfb2 Rat bisphenol A decreases expression ISO TGFB2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TGFB2 mRNA CTD PMID:16029874 more ... Tgfb2 Rat bisphenol A affects expression ISO TGFB2 (Homo sapiens) 6480464 bisphenol A affects the expression of TGFB2 mRNA CTD PMID:20170705 Tgfb2 Rat bisphenol F increases expression ISO Tgfb2 (Mus musculus) 6480464 bisphenol F results in increased expression of TGFB2 mRNA CTD PMID:30951980 Tgfb2 Rat bisphenol F multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of TGFB2 mRNA CTD PMID:30951980 Tgfb2 Rat bleomycin A2 multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [CCL12 protein co-treated with Dinoprostone] affects the reaction [Bleomycin results in increased expression of TGFB2 mRNA] more ... CTD PMID:28434932 Tgfb2 Rat Brevetoxin B increases expression ISO TGFB2 (Homo sapiens) 6480464 brevetoxin 2 results in increased expression of TGFB2 mRNA CTD PMID:20498034 Tgfb2 Rat bromochloroacetic acid decreases expression EXP 6480464 bromochloroacetic acid results in decreased expression of TGFB2 mRNA CTD PMID:16460773 Tgfb2 Rat cadmium atom multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TGFB2 mRNA CTD PMID:37325564 Tgfb2 Rat cadmium dichloride multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of TGFB2 mRNA CTD PMID:12634122 Tgfb2 Rat cadmium dichloride multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TGFB2 mRNA CTD PMID:37325564 Tgfb2 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of TGFB2 mRNA CTD PMID:33453195 Tgfb2 Rat calciol increases expression ISO Tgfb2 (Mus musculus) 6480464 Cholecalciferol results in increased expression of TGFB2 mRNA CTD PMID:17170073 Tgfb2 Rat calcitriol multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of TGFB2 mRNA CTD PMID:21592394 Tgfb2 Rat calcitriol increases expression ISO TGFB2 (Homo sapiens) 6480464 Calcitriol results in increased expression of TGFB2 mRNA CTD PMID:16002434 more ... Tgfb2 Rat cantharidin decreases expression ISO Tgfb2 (Mus musculus) 6480464 Cantharidin results in decreased expression of TGFB2 mRNA CTD PMID:36907384 Tgfb2 Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of TGFB2 protein CTD PMID:22150557 Tgfb2 Rat capsaicin multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of TGFB2 protein] more ... CTD PMID:22150557 Tgfb2 Rat carbamazepine affects expression ISO Tgfb2 (Mus musculus) 6480464 Carbamazepine affects the expression of TGFB2 mRNA CTD PMID:22634333 Tgfb2 Rat carbaryl increases expression ISO TGFB2 (Homo sapiens) 6480464 Carbaryl results in increased expression of TGFB2 mRNA CTD PMID:27829164 Tgfb2 Rat carbofuran increases expression EXP 6480464 Carbofuran results in increased expression of TGFB2 mRNA CTD PMID:20211217 Tgfb2 Rat CGP 52608 multiple interactions ISO TGFB2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TGFB2 gene] CTD PMID:28238834 Tgfb2 Rat chloroform increases expression EXP 6480464 Chloroform results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat chloroprene decreases expression ISO Tgfb2 (Mus musculus) 6480464 Chloroprene results in decreased expression of TGFB2 mRNA CTD PMID:23125180 Tgfb2 Rat chlorpyrifos increases expression ISO Tgfb2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TGFB2 mRNA CTD PMID:20350560 Tgfb2 Rat choline multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency] results in increased expression of TGFB2 mRNA and Quercetin inhibits the reaction [[Methionine deficiency co-treated with Choline deficiency] results in increased expression of TGFB2 mRNA] CTD PMID:22915297 Tgfb2 Rat chromium(6+) multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of TGFB2 mRNA CTD PMID:38479592 Tgfb2 Rat cisplatin increases expression ISO Tgfb2 (Mus musculus) 6480464 Cisplatin results in increased expression of TGFB2 mRNA CTD PMID:21151649 Tgfb2 Rat cisplatin multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of TGFB2 mRNA and [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of TGFB2 mRNA CTD PMID:27392435 and PMID:30871063 Tgfb2 Rat cisplatin decreases expression ISO TGFB2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of TGFB2 mRNA CTD PMID:27392435 Tgfb2 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of TGFB2 mRNA CTD PMID:24386269 Tgfb2 Rat cobalt dichloride decreases expression ISO TGFB2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of TGFB2 mRNA CTD PMID:26314263 Tgfb2 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of TGFB2 mRNA CTD PMID:17898221 Tgfb2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of TGFB2 mRNA CTD PMID:26033743 Tgfb2 Rat copper atom multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of TGFB2 mRNA CTD PMID:30911355 Tgfb2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of TGFB2 mRNA CTD PMID:26033743 Tgfb2 Rat copper(0) multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of TGFB2 mRNA CTD PMID:30911355 Tgfb2 Rat cordycepin increases expression ISO Tgfb2 (Mus musculus) 6480464 cordycepin results in increased expression of TGFB2 protein CTD PMID:26303320 Tgfb2 Rat cordycepin increases secretion ISO TGFB2 (Homo sapiens) 6480464 cordycepin results in increased secretion of TGFB2 protein CTD PMID:34070360 Tgfb2 Rat cordycepin increases expression ISO TGFB2 (Homo sapiens) 6480464 cordycepin results in increased expression of TGFB2 mRNA CTD PMID:34070360 Tgfb2 Rat coumestrol multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Tgfb2 Rat coumestrol decreases expression ISO TGFB2 (Homo sapiens) 6480464 Coumestrol results in decreased expression of TGFB2 mRNA CTD PMID:19167446 Tgfb2 Rat crocidolite asbestos decreases expression ISO Tgfb2 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of TGFB2 mRNA CTD PMID:29279043 Tgfb2 Rat crocidolite asbestos affects expression ISO TGFB2 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of TGFB2 mRNA CTD PMID:28056339 Tgfb2 Rat CU-O LINKAGE decreases expression ISO TGFB2 (Homo sapiens) 6480464 cupric oxide results in decreased expression of TGFB2 mRNA CTD PMID:22077320 Tgfb2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of TGFB2 mRNA CTD PMID:26577399 Tgfb2 Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of TGFB2 mRNA CTD PMID:23558518 and PMID:23926183 Tgfb2 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat cyclosporin A affects expression ISO TGFB2 (Homo sapiens) 6480464 Cyclosporine affects the expression of TGFB2 mRNA CTD PMID:34681664 Tgfb2 Rat cyclosporin A decreases expression ISO TGFB2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TGFB2 mRNA CTD PMID:27989131 Tgfb2 Rat cyhalothrin multiple interactions EXP 6480464 [fenvalerate co-treated with Allethrins co-treated with cypermethrin co-treated with decamethrin co-treated with cyhalothrin] results in decreased expression of TGFB2 mRNA CTD PMID:36053783 Tgfb2 Rat cylindrospermopsin increases expression ISO TGFB2 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of TGFB2 mRNA CTD PMID:23726867 Tgfb2 Rat cypermethrin multiple interactions EXP 6480464 [fenvalerate co-treated with Allethrins co-treated with cypermethrin co-treated with decamethrin co-treated with cyhalothrin] results in decreased expression of TGFB2 mRNA CTD PMID:36053783 Tgfb2 Rat dexamethasone multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Dexamethasone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with 1-Methyl-3-isobutylxanthine] results in decreased expression of TGFB2 mRNA CTD PMID:16997883 Tgfb2 Rat dexamethasone decreases expression ISO TGFB2 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of TGFB2 mRNA CTD PMID:16997883 Tgfb2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of TGFB2 mRNA CTD PMID:21266533 Tgfb2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of TGFB2 mRNA and Dibutyl Phthalate results in decreased expression of TGFB2 protein CTD PMID:35028925 Tgfb2 Rat dichloroacetic acid decreases expression ISO TGFB2 (Homo sapiens) 6480464 Dichloroacetic Acid results in decreased expression of TGFB2 mRNA CTD PMID:33405312 Tgfb2 Rat dichromium trioxide multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of TGFB2 mRNA CTD PMID:12634122 Tgfb2 Rat diclofenac decreases expression ISO TGFB2 (Homo sapiens) 6480464 Diclofenac results in decreased expression of TGFB2 mRNA CTD PMID:17379860 Tgfb2 Rat Didecyldimethylammonium decreases expression ISO Tgfb2 (Mus musculus) 6480464 didecyldimethylammonium results in decreased expression of TGFB2 mRNA CTD PMID:23537712 Tgfb2 Rat diethyl malate affects expression ISO Tgfb2 (Mus musculus) 6480464 diethyl malate affects the expression of TGFB2 mRNA CTD PMID:24814887 Tgfb2 Rat diethyl malate multiple interactions ISO Tgfb2 (Mus musculus) 6480464 S-ethyl glutathione inhibits the reaction [diethyl malate affects the expression of TGFB2 mRNA] CTD PMID:24814887 Tgfb2 Rat dimethylarsinous acid increases expression ISO TGFB2 (Homo sapiens) 6480464 dimethylarsinous acid results in increased expression of TGFB2 mRNA CTD PMID:19945496 and PMID:20886546 Tgfb2 Rat Diosbulbin B increases expression ISO Tgfb2 (Mus musculus) 6480464 diosbulbin B results in increased expression of TGFB2 mRNA CTD PMID:39368342 Tgfb2 Rat dioxygen increases expression ISO Tgfb2 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of TGFB2 mRNA CTD PMID:21531777 Tgfb2 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of TGFB2 mRNA CTD PMID:33729688 Tgfb2 Rat dioxygen multiple interactions ISO Tgfb2 (Mus musculus) 6480464 rosiglitazone inhibits the reaction [Oxygen deficiency results in increased expression of TGFB2 mRNA] CTD PMID:21531777 Tgfb2 Rat divanadium pentaoxide decreases expression ISO TGFB2 (Homo sapiens) 6480464 vanadium pentoxide results in decreased expression of TGFB2 mRNA CTD PMID:17459161 Tgfb2 Rat dobutamine increases expression EXP 6480464 Dobutamine results in increased expression of TGFB2 mRNA CTD PMID:16760913 Tgfb2 Rat donepezil hydrochloride multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Donepezil inhibits the reaction [1-Methyl-4-phenylpyridinium inhibits the reaction [IL4 protein results in increased expression of TGFB2]] CTD PMID:26114860 Tgfb2 Rat dopamine increases expression EXP 6480464 Dopamine results in increased expression of TGFB2 mRNA CTD PMID:16760913 Tgfb2 Rat dorsomorphin multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tgfb2 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of TGFB2 mRNA CTD PMID:20211217 and PMID:23558518 Tgfb2 Rat doxorubicin decreases expression ISO Tgfb2 (Mus musculus) 6480464 Doxorubicin results in decreased expression of TGFB2 protein CTD PMID:36227756 Tgfb2 Rat doxorubicin increases expression ISO Tgfb2 (Mus musculus) 6480464 Doxorubicin results in increased expression of TGFB2 mRNA CTD PMID:36227756 Tgfb2 Rat enalapril decreases expression EXP 6480464 Enalapril results in decreased expression of TGFB2 mRNA CTD PMID:17164399 Tgfb2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of TGFB2 mRNA CTD PMID:29391264 Tgfb2 Rat endosulfan decreases expression ISO TGFB2 (Homo sapiens) 6480464 Endosulfan results in decreased expression of TGFB2 mRNA CTD PMID:30090376 Tgfb2 Rat Enterolactone multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of TGFB2 mRNA CTD PMID:19167446 Tgfb2 Rat escitalopram decreases expression EXP 6480464 Escitalopram results in decreased expression of TGFB2 mRNA CTD PMID:28467792 Tgfb2 Rat ethanol increases expression ISO Tgfb2 (Mus musculus) 6480464 Ethanol results in increased expression of TGFB2 mRNA CTD PMID:30319688 Tgfb2 Rat ethanol decreases expression ISO Tgfb2 (Mus musculus) 6480464 Ethanol results in decreased expression of TGFB2 mRNA CTD PMID:34755883 Tgfb2 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of TGFB2 mRNA CTD PMID:34547370 Tgfb2 Rat fenamic acid increases expression EXP 6480464 fenamic acid results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat fenamidone increases expression ISO Tgfb2 (Mus musculus) 6480464 fenamidone results in increased expression of TGFB2 mRNA CTD PMID:27029645 Tgfb2 Rat fenvalerate multiple interactions EXP 6480464 [fenvalerate co-treated with Allethrins co-treated with cypermethrin co-treated with decamethrin co-treated with cyhalothrin] results in decreased expression of TGFB2 mRNA CTD PMID:36053783 Tgfb2 Rat flusilazole affects expression ISO Tgfb2 (Mus musculus) 6480464 flusilazole affects the expression of TGFB2 mRNA CTD PMID:22634333 Tgfb2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of TGFB2 mRNA and Flutamide results in decreased expression of TGFB2 protein CTD PMID:16166221 Tgfb2 Rat fructose multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [FGF21 gene mutant form results in increased susceptibility to Fructose] which results in increased expression of TGFB2 mRNA CTD PMID:28123933 Tgfb2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of TGFB2 mRNA CTD PMID:26194646 Tgfb2 Rat furosemide increases expression EXP 6480464 Furosemide results in increased expression of TGFB2 mRNA CTD PMID:16526316 Tgfb2 Rat geldanamycin increases expression ISO TGFB2 (Homo sapiens) 6480464 geldanamycin results in increased expression of TGFB2 mRNA CTD PMID:26705709 Tgfb2 Rat gemcitabine increases expression ISO TGFB2 (Homo sapiens) 6480464 Gemcitabine results in increased expression of TGFB2 mRNA CTD PMID:17039268 Tgfb2 Rat genistein decreases expression ISO TGFB2 (Homo sapiens) 6480464 Genistein results in decreased expression of TGFB2 mRNA CTD PMID:16474171 and PMID:22228119 Tgfb2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TGFB2 mRNA CTD PMID:22061828 and PMID:33387578 Tgfb2 Rat Glutathione ethyl ester multiple interactions ISO Tgfb2 (Mus musculus) 6480464 S-ethyl glutathione inhibits the reaction [diethyl malate affects the expression of TGFB2 mRNA] CTD PMID:24814887 Tgfb2 Rat glycine betaine increases expression EXP 6480464 Betaine results in increased expression of TGFB2 mRNA CTD PMID:26391144 Tgfb2 Rat hexadecanoic acid multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of TGFB2 mRNA CTD PMID:30547786 Tgfb2 Rat hyaluronic acid multiple interactions ISO Tgfb2 (Mus musculus) 6480464 MAP3K3 protein promotes the reaction [TGFB2 protein results in increased abundance of Hyaluronic Acid] more ... CTD PMID:20633555 Tgfb2 Rat hyaluronic acid increases abundance ISO Tgfb2 (Mus musculus) 6480464 TGFB2 protein results in increased abundance of Hyaluronic Acid CTD PMID:20633555 Tgfb2 Rat hydrogen cyanide increases expression ISO Tgfb2 (Mus musculus) 6480464 Hydrogen Cyanide results in increased expression of TGFB2 mRNA CTD PMID:33914522 Tgfb2 Rat hydrogen peroxide multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Minocycline co-treated with Hydrogen Peroxide co-treated with TGFB2 protein] results in increased expression of BCL2 mRNA more ... CTD PMID:20606027 and PMID:32980322 Tgfb2 Rat hydrogen peroxide affects response to substance ISO TGFB2 (Homo sapiens) 6480464 TGFB2 protein affects the susceptibility to Hydrogen Peroxide CTD PMID:32980322 Tgfb2 Rat hydrogen peroxide increases expression ISO TGFB2 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of TGFB2 protein CTD PMID:32980322 Tgfb2 Rat indirubin-3'-monoxime increases expression ISO Tgfb2 (Mus musculus) 6480464 indirubin-3'-monoxime results in increased expression of TGFB2 protein CTD PMID:21948866 Tgfb2 Rat indirubin-3'-monoxime multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Lipopolysaccharides affects the susceptibility to [indirubin-3'-monoxime results in increased expression of TGFB2 protein] CTD PMID:21948866 Tgfb2 Rat indole-3-methanol multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Lipopolysaccharides affects the susceptibility to [indole-3-carbinol results in increased expression of TGFB2 mRNA] CTD PMID:21948866 Tgfb2 Rat indole-3-methanol increases expression ISO Tgfb2 (Mus musculus) 6480464 indole-3-carbinol results in increased expression of TGFB2 mRNA CTD PMID:21948866 Tgfb2 Rat iron(III) nitrilotriacetate increases expression EXP 6480464 ferric nitrilotriacetate results in increased expression of TGFB2 mRNA CTD PMID:23208426 Tgfb2 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of TGFB2 mRNA CTD PMID:20211217 and PMID:23558518 Tgfb2 Rat L-ascorbic acid increases expression ISO Tgfb2 (Mus musculus) 6480464 Ascorbic Acid results in increased expression of TGFB2 mRNA CTD PMID:15305145 Tgfb2 Rat L-cysteine multiple interactions EXP 6480464 Cysteine inhibits the reaction [Thioacetamide results in increased expression of TGFB2 mRNA] CTD PMID:15158331 Tgfb2 Rat L-methionine multiple interactions EXP 6480464 Methionine inhibits the reaction [Thioacetamide results in increased expression of TGFB2 mRNA] CTD PMID:15158331 Tgfb2 Rat L-methionine multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency] results in increased expression of TGFB2 mRNA and Quercetin inhibits the reaction [[Methionine deficiency co-treated with Choline deficiency] results in increased expression of TGFB2 mRNA] CTD PMID:22915297 Tgfb2 Rat lead diacetate multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of TGFB2 mRNA CTD PMID:12634122 Tgfb2 Rat lead(0) affects expression ISO TGFB2 (Homo sapiens) 6480464 Lead affects the expression of TGFB2 mRNA CTD PMID:28903495 Tgfb2 Rat leptomycin B multiple interactions ISO Tgfb2 (Mus musculus) 6480464 leptomycin B inhibits the reaction [arsenite inhibits the reaction [TGFB2 protein affects the localization of SMAD2 protein]] more ... CTD PMID:26354774 Tgfb2 Rat Licochalcone B decreases expression ISO TGFB2 (Homo sapiens) 6480464 licochalcone B results in decreased expression of TGFB2 mRNA CTD PMID:33647349 Tgfb2 Rat linuron multiple interactions ISO Tgfb2 (Mus musculus) 6480464 SIGMAR1 gene promotes the reaction [Linuron results in increased expression of TGFB2 mRNA] and XBP1 gene promotes the reaction [Linuron results in increased expression of TGFB2 mRNA] CTD PMID:30661753 Tgfb2 Rat linuron increases expression ISO Tgfb2 (Mus musculus) 6480464 Linuron results in increased expression of TGFB2 mRNA CTD PMID:30661753 Tgfb2 Rat lipoic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide co-treated with Thioctic Acid] affects the expression of TGFB2 mRNA and [Thioctic Acid co-treated with Propylthiouracil] results in increased expression of TGFB2 mRNA CTD PMID:23830814 and PMID:31068541 Tgfb2 Rat lipopolysaccharide multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Lipopolysaccharides affects the susceptibility to [indirubin-3'-monoxime results in increased expression of TGFB2 protein] and Lipopolysaccharides affects the susceptibility to [indole-3-carbinol results in increased expression of TGFB2 mRNA] CTD PMID:21948866 Tgfb2 Rat lipopolysaccharide increases expression ISO Tgfb2 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of TGFB2 mRNA CTD PMID:21131560 Tgfb2 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of TGFB2 mRNA CTD PMID:28801915 Tgfb2 Rat mercury atom increases expression ISO TGFB2 (Homo sapiens) 6480464 Mercury results in increased expression of TGFB2 mRNA CTD PMID:16823088 Tgfb2 Rat mercury(0) increases expression ISO TGFB2 (Homo sapiens) 6480464 Mercury results in increased expression of TGFB2 mRNA CTD PMID:16823088 Tgfb2 Rat metaproterenol increases expression EXP 6480464 Metaproterenol results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of TGFB2 mRNA CTD PMID:36914120 Tgfb2 Rat methamphetamine increases expression ISO Tgfb2 (Mus musculus) 6480464 Methamphetamine results in increased expression of TGFB2 mRNA CTD PMID:36914120 Tgfb2 Rat methamphetamine multiple interactions EXP 6480464 GATA4 protein affects the reaction [Methamphetamine results in increased expression of TGFB2 mRNA] CTD PMID:36914120 Tgfb2 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of TGFB2 mRNA CTD PMID:30047161 Tgfb2 Rat methotrexate multiple interactions EXP 6480464 Methotrexate inhibits the reaction [Freund's Adjuvant results in increased expression of and results in increased secretion of TGFB2 protein] CTD PMID:30025850 Tgfb2 Rat methylmercury chloride increases expression ISO TGFB2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TGFB2 mRNA CTD PMID:28001369 Tgfb2 Rat methylseleninic acid increases expression ISO TGFB2 (Homo sapiens) 6480464 methylselenic acid results in increased expression of TGFB2 mRNA CTD PMID:18548127 Tgfb2 Rat microcystin-LR increases expression ISO Tgfb2 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of TGFB2 mRNA CTD PMID:17654400 and PMID:37342990 Tgfb2 Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of TGFB2 mRNA CTD PMID:25972201 Tgfb2 Rat minocycline multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Minocycline co-treated with Hydrogen Peroxide co-treated with TGFB2 protein] results in increased expression of BCL2 mRNA more ... CTD PMID:20606027 Tgfb2 Rat mitoxantrone increases expression EXP 6480464 Mitoxantrone results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat mono(2-ethylhexyl) phthalate decreases expression ISO TGFB2 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of TGFB2 mRNA CTD PMID:36695872 Tgfb2 Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of TGFB2 mRNA CTD PMID:21515302 Tgfb2 Rat N-methyl-4-phenylpyridinium multiple interactions ISO Tgfb2 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium inhibits the reaction [IL4 protein results in increased expression of TGFB2] and donepezil inhibits the reaction [1-Methyl-4-phenylpyridinium inhibits the reaction [IL4 protein results in increased expression of TGFB2]] CTD PMID:26114860 Tgfb2 Rat N-nitrosodiethylamine multiple interactions ISO Tgfb2 (Mus musculus) 6480464 AHR protein inhibits the reaction [Diethylnitrosamine results in increased expression of TGFB2 mRNA] and TGFB2 gene mutant form results in increased susceptibility to [Diethylnitrosamine co-treated with Phenobarbital] CTD PMID:11526486 and PMID:19996281 Tgfb2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide co-treated with Thioctic Acid] affects the expression of TGFB2 mRNA CTD PMID:23830814 Tgfb2 Rat N-nitrosodiethylamine increases expression ISO Tgfb2 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of TGFB2 mRNA CTD PMID:18282651 more ... Tgfb2 Rat N-nitrosodiethylamine increases response to substance ISO Tgfb2 (Mus musculus) 6480464 TGFB2 gene mutant form results in increased susceptibility to Diethylnitrosamine CTD PMID:11559531 Tgfb2 Rat naproxen multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of TGFB2 protein] and Naproxen inhibits the reaction [Capsaicin results in increased expression of TGFB2 protein] CTD PMID:22150557 Tgfb2 Rat neomycin increases expression ISO Tgfb2 (Mus musculus) 6480464 Neomycin results in increased expression of TGFB2 mRNA CTD PMID:30626089 Tgfb2 Rat neomycin multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Plant Oils inhibits the reaction [Neomycin results in increased expression of TGFB2 mRNA] CTD PMID:30626089 Tgfb2 Rat nickel atom decreases expression ISO TGFB2 (Homo sapiens) 6480464 Nickel results in decreased expression of TGFB2 mRNA CTD PMID:24768652 and PMID:25583101 Tgfb2 Rat nicotinamide multiple interactions ISO TGFB2 (Homo sapiens) 6480464 Niacinamide inhibits the reaction [resveratrol inhibits the reaction [TGFB2 protein results in increased expression of COL1A1 mRNA]] and Niacinamide inhibits the reaction [resveratrol inhibits the reaction [TGFB2 protein results in increased expression of COL1A2 mRNA]] CTD PMID:25707573 Tgfb2 Rat nitrates decreases expression EXP 6480464 Nitrates results in decreased expression of TGFB2 mRNA CTD PMID:30022042 Tgfb2 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of TGFB2 mRNA CTD PMID:33484710 Tgfb2 Rat nitrofurantoin increases expression EXP 6480464 Nitrofurantoin results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat obeticholic acid decreases expression ISO TGFB2 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of TGFB2 mRNA CTD PMID:27939613 Tgfb2 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of TGFB2 mRNA CTD PMID:23208426 and PMID:23358140 Tgfb2 Rat ochratoxin A decreases expression ISO Tgfb2 (Mus musculus) 6480464 ochratoxin A results in decreased expression of TGFB2 mRNA CTD PMID:28710020 Tgfb2 Rat ochratoxin A multiple interactions ISO Tgfb2 (Mus musculus) 6480464 NFE2L2 protein affects the reaction [ochratoxin A results in decreased expression of TGFB2 mRNA] CTD PMID:28710020 Tgfb2 Rat ochratoxin A increases expression ISO Tgfb2 (Mus musculus) 6480464 ochratoxin A results in increased expression of TGFB2 mRNA CTD PMID:28710020 Tgfb2 Rat ochratoxin A increases expression ISO TGFB2 (Homo sapiens) 6480464 ochratoxin A metabolite results in increased expression of TGFB2 mRNA and ochratoxin A results in increased expression of TGFB2 mRNA CTD PMID:26314263 Tgfb2 Rat oleic acid multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of TGFB2 mRNA CTD PMID:30547786 Tgfb2 Rat orciprenaline increases expression EXP 6480464 Metaproterenol results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat ouabain decreases expression ISO TGFB2 (Homo sapiens) 6480464 Ouabain results in decreased expression of TGFB2 mRNA CTD PMID:28795476 Tgfb2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TGFB2 mRNA CTD PMID:25729387 Tgfb2 Rat ozone increases expression ISO TGFB2 (Homo sapiens) 6480464 Ozone results in increased expression of TGFB2 mRNA CTD PMID:31476115 Tgfb2 Rat ozone decreases expression ISO Tgfb2 (Mus musculus) 6480464 Ozone results in decreased expression of TGFB2 mRNA CTD PMID:33026818 Tgfb2 Rat ozone multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of TGFB2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of TGFB2 protein CTD PMID:23019345 and PMID:27106289 Tgfb2 Rat p-tert-Amylphenol decreases expression ISO Tgfb2 (Mus musculus) 6480464 4-tert-octylphenol results in decreased expression of TGFB2 protein CTD PMID:18065773 Tgfb2 Rat paracetamol increases expression ISO TGFB2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TGFB2 mRNA CTD PMID:29067470 Tgfb2 Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of TGFB2 mRNA CTD PMID:33387578 Tgfb2 Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of TGFB2 mRNA CTD PMID:16854511 Tgfb2 Rat paraquat affects expression ISO TGFB2 (Homo sapiens) 6480464 Paraquat affects the expression of TGFB2 mRNA CTD PMID:34681664 Tgfb2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of TGFB2 mRNA CTD PMID:32680482 Tgfb2 Rat pentane-2,3-dione increases expression EXP 6480464 2 and 3-pentanedione results in increased expression of TGFB2 mRNA CTD PMID:25710175 Tgfb2 Rat Pentoxifylline increases expression EXP 6480464 Pentoxifylline results in increased expression of TGFB2 mRNA CTD PMID:11843059 Tgfb2 Rat perfluorohexanesulfonic acid increases expression ISO Tgfb2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of TGFB2 mRNA CTD PMID:37995155 Tgfb2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TGFB2 mRNA CTD PMID:36331819 Tgfb2 Rat perfluorooctanoic acid decreases expression ISO TGFB2 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of TGFB2 mRNA CTD PMID:37302725 Tgfb2 Rat phenethyl caffeate multiple interactions ISO TGFB2 (Homo sapiens) 6480464 caffeic acid phenethyl ester inhibits the reaction [arsenite results in decreased expression of TGFB2 mRNA] CTD PMID:16085347 Tgfb2 Rat phenobarbital multiple interactions ISO Tgfb2 (Mus musculus) 6480464 TGFB2 gene mutant form results in increased susceptibility to [Diethylnitrosamine co-treated with Phenobarbital] CTD PMID:11526486 Tgfb2 Rat phenylbutazone increases expression EXP 6480464 Phenylbutazone results in increased expression of TGFB2 mRNA CTD PMID:23558518 Tgfb2 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of TGFB2 mRNA CTD PMID:19443575 Tgfb2 Rat phenylmercury acetate multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TGFB2 mRNA CTD PMID:27188386 Tgfb2 Rat phenytoin decreases expression ISO Tgfb2 (Mus musculus) 6480464 Phenytoin results in decreased expression of TGFB2 mRNA CTD PMID:9118846 Tgfb2 Rat phorbol 13-acetate 12-myristate multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of TGFB2 mRNA CTD PMID:16979875 Tgfb2 Rat pirinixic acid multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of TGFB2 mRNA CTD PMID:19710929 Tgfb2 Rat potassium chromate decreases expression ISO TGFB2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of TGFB2 mRNA CTD PMID:22714537 Tgfb2 Rat potassium cyanide increases expression ISO Tgfb2 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of TGFB2 mRNA CTD PMID:33914522 Tgfb2 Rat prazosin multiple interactions EXP 6480464 Prazosin inhibits the reaction [Norepinephrine results in increased expression of TGFB2 mRNA] CTD PMID:15326086 Tgfb2 Rat progesterone multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TGFB2 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of TGFB2 mRNA CTD PMID:17404688 and PMID:20660070 Tgfb2 Rat propanal increases expression ISO TGFB2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of TGFB2 mRNA CTD PMID:26079696 Tgfb2 Rat prostaglandin E2 multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [CCL12 protein co-treated with Dinoprostone] affects the reaction [Bleomycin results in increased expression of TGFB2 mRNA] more ... CTD PMID:28434932 Tgfb2 Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of TGFB2 mRNA CTD PMID:36053783 Tgfb2 Rat quercetin multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Quercetin inhibits the reaction [[Methionine deficiency co-treated with Choline deficiency] results in increased expression of TGFB2 mRNA] CTD PMID:22915297 Tgfb2 Rat raloxifene multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in increased expression of TGFB2 mRNA and [Raloxifene Hydrochloride co-treated with Estradiol] results in increased expression of TGFB2 mRNA CTD PMID:19059307 and PMID:21185374 Tgfb2 Rat raloxifene affects expression ISO TGFB2 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of TGFB2 mRNA CTD PMID:14699072 Tgfb2 Rat resveratrol decreases expression ISO TGFB2 (Homo sapiens) 6480464 resveratrol results in decreased expression of TGFB2 mRNA CTD PMID:19371625 Tgfb2 Rat resveratrol multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of TGFB2 mRNA more ... CTD PMID:19167446 and PMID:25707573 Tgfb2 Rat resveratrol increases expression ISO TGFB2 (Homo sapiens) 6480464 resveratrol results in increased expression of TGFB2 mRNA CTD PMID:12002526 Tgfb2 Rat rotenone increases expression ISO Tgfb2 (Mus musculus) 6480464 Rotenone results in increased expression of TGFB2 mRNA CTD PMID:23186747 and PMID:32937126 Tgfb2 Rat SB 203580 multiple interactions ISO TGFB2 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [TGFB2 protein results in increased expression of COL1A1 mRNA] and SB 203580 inhibits the reaction [TGFB2 protein results in increased phosphorylation of SMAD3 protein] CTD PMID:18253093 Tgfb2 Rat SB 431542 multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tgfb2 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of TGFB2 mRNA CTD PMID:32721576 Tgfb2 Rat silver atom decreases expression ISO Tgfb2 (Mus musculus) 6480464 Silver results in decreased expression of TGFB2 mRNA CTD PMID:27131904 Tgfb2 Rat silver(0) decreases expression ISO Tgfb2 (Mus musculus) 6480464 Silver results in decreased expression of TGFB2 mRNA CTD PMID:27131904 Tgfb2 Rat sodium arsenate decreases expression ISO Tgfb2 (Mus musculus) 6480464 sodium arsenate results in decreased expression of TGFB2 mRNA CTD PMID:21795629 Tgfb2 Rat sodium arsenate increases expression ISO Tgfb2 (Mus musculus) 6480464 sodium arsenate results in increased expression of TGFB2 mRNA CTD PMID:21795629 Tgfb2 Rat sodium arsenite increases expression ISO TGFB2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TGFB2 mRNA CTD PMID:12634122 more ... Tgfb2 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of TGFB2 mRNA CTD PMID:35314868 Tgfb2 Rat sodium arsenite decreases expression ISO Tgfb2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of TGFB2 mRNA CTD PMID:23732083 and PMID:37682722 Tgfb2 Rat sodium arsenite decreases expression ISO TGFB2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TGFB2 mRNA CTD PMID:20886546 more ... Tgfb2 Rat sodium arsenite multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of TGFB2 mRNA CTD PMID:12634122 Tgfb2 Rat sodium arsenite multiple interactions ISO Tgfb2 (Mus musculus) 6480464 sodium arsenite inhibits the reaction [TGFB2 protein results in increased phosphorylation of and affects the localization of SMAD2 protein] and sodium arsenite inhibits the reaction [TGFB2 protein results in increased phosphorylation of and affects the localization of SMAD3 protein] CTD PMID:23732083 Tgfb2 Rat sodium chloride increases expression ISO TGFB2 (Homo sapiens) 6480464 Sodium Chloride results in increased expression of TGFB2 mRNA CTD PMID:26800359 Tgfb2 Rat sodium fluoride increases expression EXP 6480464 Sodium Fluoride results in increased expression of TGFB2 protein CTD PMID:37121298 Tgfb2 Rat sodium tungstate affects expression ISO TGFB2 (Homo sapiens) 6480464 sodium tungstate(VI) affects the expression of TGFB2 mRNA CTD PMID:26164860 Tgfb2 Rat sphingosine 1-phosphate multiple interactions ISO TGFB2 (Homo sapiens) 6480464 TGFB2 protein promotes the reaction [SPNS2 protein results in increased secretion of sphingosine 1-phosphate] CTD PMID:29772789 Tgfb2 Rat styrene affects expression ISO TGFB2 (Homo sapiens) 6480464 Styrene affects the expression of TGFB2 mRNA and Styrene affects the expression of TGFB2 protein CTD PMID:16705669 Tgfb2 Rat styrene oxide affects expression ISO TGFB2 (Homo sapiens) 6480464 styrene oxide affects the expression of TGFB2 mRNA and styrene oxide affects the expression of TGFB2 protein CTD PMID:16705669 Tgfb2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of TGFB2 mRNA CTD PMID:30047161 Tgfb2 Rat sumatriptan multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of TGFB2 protein] and Sumatriptan inhibits the reaction [Capsaicin results in increased expression of TGFB2 protein] CTD PMID:22150557 Tgfb2 Rat sunitinib increases expression ISO TGFB2 (Homo sapiens) 6480464 Sunitinib results in increased expression of TGFB2 mRNA CTD PMID:31533062 Tgfb2 Rat tamibarotene increases secretion ISO TGFB2 (Homo sapiens) 6480464 tamibarotene results in increased secretion of TGFB2 protein CTD PMID:17611697 Tgfb2 Rat tamibarotene increases response to substance ISO TGFB2 (Homo sapiens) 6480464 TGFB2 results in increased susceptibility to tamibarotene CTD PMID:17611697 Tgfb2 Rat tamoxifen affects expression ISO TGFB2 (Homo sapiens) 6480464 Tamoxifen affects the expression of TGFB2 mRNA CTD PMID:14699072 Tgfb2 Rat tamoxifen multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in increased expression of TGFB2 mRNA CTD PMID:19059307 Tgfb2 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of TGFB2 mRNA CTD PMID:21515302 Tgfb2 Rat testosterone multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of TGFB2 mRNA CTD PMID:21592394 Tgfb2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TGFB2 mRNA CTD PMID:32741896 Tgfb2 Rat testosterone increases expression ISO Tgfb2 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of TGFB2 mRNA CTD PMID:33848595 Tgfb2 Rat testosterone multiple interactions ISO Tgfb2 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Tgfb2 Rat testosterone increases expression ISO TGFB2 (Homo sapiens) 6480464 Testosterone results in increased expression of TGFB2 mRNA CTD PMID:21592394 Tgfb2 Rat tetrachloromethane affects expression ISO Tgfb2 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of TGFB2 mRNA CTD PMID:17484886 Tgfb2 Rat tetrachloromethane increases secretion ISO Tgfb2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased secretion of TGFB2 protein CTD PMID:34191077 Tgfb2 Rat tetrachloromethane multiple interactions ISO Tgfb2 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with 1-trifluoromethoxyphenyl-3-(1-propionylpiperidine-4-yl)urea] results in increased expression of TGFB2 mRNA more ... CTD PMID:25827057 more ... Tgfb2 Rat tetrachloromethane increases expression ISO Tgfb2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TGFB2 mRNA CTD PMID:15056808 more ... Tgfb2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TGFB2 mRNA CTD PMID:16644059 and PMID:23558518 Tgfb2 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide co-treated with Thioctic Acid] affects the expression of TGFB2 mRNA more ... CTD PMID:15158331 and PMID:23830814 Tgfb2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TGFB2 mRNA CTD PMID:15158331 more ... Tgfb2 Rat thiram decreases expression ISO TGFB2 (Homo sapiens) 6480464 Thiram results in decreased expression of TGFB2 mRNA CTD PMID:38568856 Tgfb2 Rat titanium dioxide decreases methylation ISO Tgfb2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TGFB2 gene CTD PMID:35295148 Tgfb2 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of TGFB2 mRNA CTD PMID:25729387 Tgfb2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TGFB2 mRNA CTD PMID:25729387 Tgfb2 Rat torcetrapib increases expression ISO TGFB2 (Homo sapiens) 6480464 torcetrapib results in increased expression of TGFB2 mRNA CTD PMID:23228038 Tgfb2 Rat tranexamic acid multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Tranexamic Acid inhibits the reaction [1-Naphthylisothiocyanate results in increased expression of TGFB2 mRNA] CTD PMID:24633426 Tgfb2 Rat triadimefon decreases expression EXP 6480464 triadimefon results in decreased expression of TGFB2 mRNA CTD PMID:18976680 Tgfb2 Rat triadimefon decreases expression ISO TGFB2 (Homo sapiens) 6480464 triadimefon results in decreased expression of TGFB2 mRNA CTD PMID:26705709 Tgfb2 Rat trichloroethene increases expression ISO Tgfb2 (Mus musculus) 6480464 Trichloroethylene results in increased expression of TGFB2 mRNA CTD PMID:15363585 Tgfb2 Rat trichostatin A decreases expression ISO TGFB2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of TGFB2 mRNA CTD PMID:24935251 Tgfb2 Rat trichostatin A increases expression ISO TGFB2 (Homo sapiens) 6480464 trichostatin A results in increased expression of TGFB2 mRNA CTD PMID:24935251 and PMID:26705709 Tgfb2 Rat triclosan affects expression ISO TGFB2 (Homo sapiens) 6480464 Triclosan affects the expression of TGFB2 mRNA CTD PMID:31714634 Tgfb2 Rat triclosan decreases expression ISO TGFB2 (Homo sapiens) 6480464 Triclosan results in decreased expression of TGFB2 mRNA CTD PMID:34681664 Tgfb2 Rat triptonide increases expression ISO Tgfb2 (Mus musculus) 6480464 triptonide results in increased expression of TGFB2 mRNA CTD PMID:33045310 Tgfb2 Rat troglitazone multiple interactions ISO TGFB2 (Homo sapiens) 6480464 Troglitazone inhibits the reaction [TGFB2 protein results in increased expression of COL1A1 mRNA] more ... CTD PMID:18253093 Tgfb2 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of TGFB2 mRNA CTD PMID:21515302 Tgfb2 Rat troglitazone increases expression ISO Tgfb2 (Mus musculus) 6480464 troglitazone results in increased expression of TGFB2 mRNA CTD PMID:17569031 Tgfb2 Rat troglitazone decreases response to substance ISO TGFB2 (Homo sapiens) 6480464 troglitazone results in decreased susceptibility to TGFB2 protein CTD PMID:18253093 Tgfb2 Rat urethane multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Freund's Adjuvant inhibits the reaction [Urethane results in decreased expression of TGFB2 mRNA] and IFNG protein inhibits the reaction [Urethane results in decreased expression of TGFB2 mRNA] CTD PMID:12810352 Tgfb2 Rat urethane decreases expression ISO Tgfb2 (Mus musculus) 6480464 Urethane results in decreased expression of TGFB2 mRNA CTD PMID:12810352 Tgfb2 Rat valproic acid decreases methylation ISO TGFB2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TGFB2 gene CTD PMID:29154799 Tgfb2 Rat valproic acid multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TGFB2 mRNA CTD PMID:27188386 Tgfb2 Rat valproic acid increases expression ISO TGFB2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TGFB2 mRNA CTD PMID:23179753 and PMID:26272509 Tgfb2 Rat valproic acid decreases expression ISO TGFB2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TGFB2 mRNA CTD PMID:24935251 and PMID:29154799 Tgfb2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of TGFB2 mRNA CTD PMID:19015723 Tgfb2 Rat zearalenone decreases expression ISO Tgfb2 (Mus musculus) 6480464 Zearalenone results in decreased expression of TGFB2 mRNA CTD PMID:27862621 and PMID:29758222 Tgfb2 Rat zinc atom multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of TGFB2 mRNA CTD PMID:16979875 Tgfb2 Rat zinc atom multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Zinc inhibits the reaction [arsenite inhibits the reaction [TGFB2 protein affects the localization of SMAD2 protein]] more ... CTD PMID:26354774 Tgfb2 Rat zinc(0) multiple interactions ISO TGFB2 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of TGFB2 mRNA CTD PMID:16979875 Tgfb2 Rat zinc(0) multiple interactions ISO Tgfb2 (Mus musculus) 6480464 Zinc inhibits the reaction [arsenite inhibits the reaction [TGFB2 protein affects the localization of SMAD2 protein]] more ... CTD PMID:26354774 Tgfb2 Rat zoledronic acid increases expression ISO TGFB2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of TGFB2 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (R)-lipoic acid (EXP) (R)-noradrenaline (EXP) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-nitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-nitrophenol (ISO) 4-tert-Octylphenol (ISO) 5'-S-methyl-5'-thioadenosine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acetaldehyde (ISO) acetamide (EXP) acrylamide (EXP) actinomycin D (ISO) adenosine (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) allethrin (EXP) allopurinol (EXP) Allylamine (EXP) AM-251 (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) astemizole (EXP) atrazine (EXP) belinostat (ISO) benzene (ISO) benzo[a]pyrene (ISO) Benzo[ghi]perylene (ISO) Benzo[k]fluoranthene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) Brevetoxin B (ISO) bromochloroacetic acid (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calciol (ISO) calcitriol (ISO) cantharidin (ISO) capsaicin (EXP) carbamazepine (ISO) carbaryl (ISO) carbofuran (EXP) CGP 52608 (ISO) chloroform (EXP) chloroprene (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) cocaine (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) cordycepin (ISO) coumestrol (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) Cuprizon (EXP) cyclophosphamide (EXP) cyclosporin A (EXP,ISO) cyhalothrin (EXP) cylindrospermopsin (ISO) cypermethrin (EXP) dexamethasone (ISO) dibutyl phthalate (EXP) dichloroacetic acid (ISO) dichromium trioxide (ISO) diclofenac (ISO) Didecyldimethylammonium (ISO) diethyl malate (ISO) dimethylarsinous acid (ISO) Diosbulbin B (ISO) dioxygen (EXP,ISO) divanadium pentaoxide (ISO) dobutamine (EXP) donepezil hydrochloride (ISO) dopamine (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) enalapril (EXP) endosulfan (EXP,ISO) Enterolactone (ISO) escitalopram (EXP) ethanol (EXP,ISO) fenamic acid (EXP) fenamidone (ISO) fenvalerate (EXP) flusilazole (ISO) flutamide (EXP) fructose (ISO) furan (EXP) furosemide (EXP) geldanamycin (ISO) gemcitabine (ISO) genistein (ISO) gentamycin (EXP) Glutathione ethyl ester (ISO) glycine betaine (EXP) hexadecanoic acid (ISO) hyaluronic acid (ISO) hydrogen cyanide (ISO) hydrogen peroxide (ISO) indirubin-3'-monoxime (ISO) indole-3-methanol (ISO) iron(III) nitrilotriacetate (EXP) isoprenaline (EXP) L-ascorbic acid (ISO) L-cysteine (EXP) L-methionine (EXP,ISO) lead diacetate (ISO) lead(0) (ISO) leptomycin B (ISO) Licochalcone B (ISO) linuron (ISO) lipoic acid (EXP) lipopolysaccharide (ISO) manganese(II) chloride (EXP) mercury atom (ISO) mercury(0) (ISO) metaproterenol (EXP) methamphetamine (EXP,ISO) methapyrilene (EXP) methimazole (EXP) methotrexate (EXP) methylmercury chloride (ISO) methylseleninic acid (ISO) microcystin-LR (ISO) mifepristone (EXP) minocycline (ISO) mitoxantrone (EXP) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP,ISO) naproxen (EXP) neomycin (ISO) nickel atom (ISO) nicotinamide (ISO) nitrates (EXP) nitrofen (EXP) nitrofurantoin (EXP) obeticholic acid (ISO) ochratoxin A (EXP,ISO) oleic acid (ISO) orciprenaline (EXP) ouabain (ISO) oxaliplatin (EXP) ozone (ISO) p-tert-Amylphenol (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) pentane-2,3-dione (EXP) Pentoxifylline (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenethyl caffeate (ISO) phenobarbital (ISO) phenylbutazone (EXP) phenylephrine (EXP) phenylmercury acetate (ISO) phenytoin (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) potassium chromate (ISO) potassium cyanide (ISO) prazosin (EXP) progesterone (ISO) propanal (ISO) prostaglandin E2 (ISO) pyrethrins (EXP) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (ISO) SB 203580 (ISO) SB 431542 (ISO) silicon dioxide (EXP) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium fluoride (EXP) sodium tungstate (ISO) sphingosine 1-phosphate (ISO) styrene (ISO) styrene oxide (ISO) sulfadimethoxine (EXP) sumatriptan (EXP) sunitinib (ISO) tamibarotene (ISO) tamoxifen (ISO) Tesaglitazar (EXP) testosterone (EXP,ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) torcetrapib (ISO) tranexamic acid (ISO) triadimefon (EXP,ISO) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) troglitazone (EXP,ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) zearalenone (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
activation-induced cell death of T cells (IEA,ISO) animal organ morphogenesis (IEA) ascending aorta morphogenesis (IEA,ISO) atrial septum morphogenesis (IEA,ISO) atrial septum primum morphogenesis (IEA,ISO) atrioventricular valve morphogenesis (IEA,ISO) axon guidance (IEA,ISO) blood vessel development (IEA,ISO) blood vessel remodeling (IEA,ISO) cardiac epithelial to mesenchymal transition (IEA,ISO,ISS) cardiac muscle cell proliferation (IEA,ISO,ISS) cardiac right ventricle morphogenesis (IEA,ISO) cardioblast differentiation (IEA,ISO,ISS) cartilage condensation (IEA,ISO) cell migration (IEA,ISO,ISS) cell morphogenesis (IEA,ISO,ISS) cell-cell junction organization (IEA,ISO,ISS) collagen fibril organization (IEA,ISO,ISS) cranial skeletal system development (IEA,ISO) digestive tract development (IEP) dopamine biosynthetic process (IEA,ISO,ISS) embryonic digestive tract development (IEA,ISO,ISS) embryonic limb morphogenesis (IEA,ISO) embryonic neurocranium morphogenesis (IDA) endocardial cushion fusion (IEA,ISO) endocardial cushion morphogenesis (IEA,ISO) epithelial cell differentiation (IEA,ISO,ISS) epithelial to mesenchymal transition (IEA,ISO,ISS) extracellular matrix organization (IEA,ISO) extrinsic apoptotic signaling pathway (IEA,ISO,ISS) extrinsic apoptotic signaling pathway in absence of ligand (IEA,ISO) eye development (IEA,ISO,ISS) face morphogenesis (IEA,ISO) female pregnancy (IEP) frontal suture morphogenesis (IEP) glial cell migration (IEA,ISO,ISS) hair follicle development (IEA,ISO,ISS) hair follicle morphogenesis (IEA,ISO,ISS) heart development (IEA,ISO,ISS) heart morphogenesis (IEA,ISO,ISS) heart valve morphogenesis (IEA,ISO) hemopoiesis (IEA,ISO,ISS) hindbrain development (IEP) inner ear development (IEA,IEP,ISO) kidney development (IEA,IEP,ISO) lung development (TAS) male gonad development (IEA,ISO) membranous septum morphogenesis (IEA,ISO) negative regulation of angiogenesis (IEA,ISO) negative regulation of apoptotic process (IDA) negative regulation of cartilage development (IEA,ISO) negative regulation of cell growth (IEA,ISO,ISS) negative regulation of cell population proliferation (IEA,IMP,ISO,ISS) negative regulation of epithelial cell proliferation (IEA,ISO,ISS) negative regulation of epithelial to mesenchymal transition involved in endocardial cushion formation (IEA,ISO) negative regulation of gene expression (IEA,ISO) negative regulation of macrophage cytokine production (IEA,ISO,ISS) negative regulation of Ras protein signal transduction (IEA,ISO) negative regulation of release of sequestered calcium ion into cytosol (IDA) neural retina development (IEA,ISO) neural tube closure (IEA,ISO) neuron development (IEA,ISO,ISS) neuron fate commitment (IEA,ISO) neutrophil chemotaxis (ISO,ISS) outflow tract morphogenesis (IEA,ISO) outflow tract septum morphogenesis (IEA,ISO) pancreas development (IEP) pericyte cell differentiation (IEA,ISO) pharyngeal arch artery morphogenesis (IEA,ISO) positive regulation of activation-induced cell death of T cells (IEA,ISO) positive regulation of apoptotic process (IMP) positive regulation of cardiac epithelial to mesenchymal transition (IEA,ISO) positive regulation of cardioblast differentiation (IEA,ISO,ISS) positive regulation of cell adhesion mediated by integrin (IEA,ISO,ISS) positive regulation of cell cycle (IEA,ISO,ISS) positive regulation of cell division (IEA) positive regulation of cell growth (IEA,ISO,ISS) positive regulation of cell migration (IDA) positive regulation of cell population proliferation (IDA,IEA,ISO,ISS) positive regulation of epithelial cell migration (IEA,ISO,ISS) positive regulation of epithelial to mesenchymal transition (IEA,ISO,ISS) positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation (IEA,ISO) positive regulation of extracellular matrix disassembly (IEA,ISO) positive regulation of extrinsic apoptotic signaling pathway in absence of ligand (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of heart contraction (IEA,ISO,ISS) positive regulation of immune response (ISO,ISS) positive regulation of integrin biosynthetic process (IEA,ISO,ISS) positive regulation of miRNA transcription (IEA,ISO) positive regulation of neuron apoptotic process (IEA,ISO,ISS) positive regulation of Notch signaling pathway (IEA,ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO,ISS) positive regulation of protein localization to nucleus (IEA,ISO) positive regulation of protein secretion (IEA,ISO,ISS) positive regulation of SMAD protein signal transduction (IEA,ISO,ISS) positive regulation of stress-activated MAPK cascade (IEA,ISO,ISS) positive regulation of timing of catagen (IEA,ISO,ISS) pulmonary valve morphogenesis (IEA,ISO) regulation of actin cytoskeleton organization (IEA,ISO) regulation of apoptotic process (IEA,ISO) regulation of apoptotic process involved in outflow tract morphogenesis (IEA,ISO) regulation of cell growth (TAS) regulation of cell population proliferation (IBA,IEA,ISO,ISS,TAS) regulation of complement-dependent cytotoxicity (ISO) regulation of extracellular matrix organization (IEA,ISO) regulation of timing of catagen (IEA,ISO,ISS) regulation of transforming growth factor beta2 production (IEA,ISO,ISS) response to cytokine (IEP) response to estradiol (IEP) response to estrogen (IDA) response to hypoxia (IEA,ISO,ISS) response to laminar fluid shear stress (IEP) response to progesterone (IEA,ISO,ISS) response to retinoic acid (IEP) response to vitamin D (IEP) response to wounding (IEA,ISO,ISS) response to xenobiotic stimulus (IEP) salivary gland morphogenesis (IEA,ISO,ISS) secondary palate development (IEA,ISO) signal transduction (ISS) signaling (IEA,ISO,ISS) skeletal muscle tissue development (IEP) skeletal system development (IEA,ISO) somatic stem cell division (IEA,ISO,ISS) substantia propria of cornea development (IEA,ISO) thyroid gland development (IEP) tissue development (IEA) transforming growth factor beta receptor signaling pathway (IBA,IEA,ISO,ISS) tube development (IEA) uterus development (IEA,ISO) ventricular septum morphogenesis (IEA,ISO) ventricular trabecula myocardium morphogenesis (IEA,ISO) wound healing (ISS)
Cellular Component
axon (IEA,ISO,ISS) basement membrane (IDA) cell surface (IDA) collagen-containing extracellular matrix (ISO) endosome (IEA,ISO) extracellular matrix (ISS) extracellular region (IEA,ISO,ISS) extracellular space (IBA,IDA,IEA,ISO,ISS) neuronal cell body (IEA,ISO,ISS) secretory granule (IDA) trans-Golgi network (IDA)
Molecular Function
amyloid-beta binding (IEA,ISO,ISS) cytokine activity (IBA) growth factor activity (IEA) identical protein binding (IPI) protein binding (ISO) protein homodimerization activity (IEA,ISO,ISS) protein-containing complex binding (IDA) signaling receptor binding (IEA,ISO,ISS) transforming growth factor beta receptor binding (IEA,ISO,ISS,TAS) type II transforming growth factor beta receptor binding (IEA,ISO,ISS) type III transforming growth factor beta receptor binding (IEA,ISO,ISS)
1.
Tgf-beta1, Tgf-beta2, Tgf-beta3 and Msx2 expression is elevated during frontonasal suture morphogenesis and during active postnatal facial growth.
Adab K, etal., Orthod Craniofac Res. 2002 Nov;5(4):227-37.
2.
TGFbeta2 mediates the effects of hedgehog on hypertrophic differentiation and PTHrP expression.
Alvarez J, etal., Development. 2002 Apr;129(8):1913-24.
3.
Transforming growth factor-beta induces cellular injury in experimental diabetic neuropathy.
Anjaneyulu M, etal., Exp Neurol. 2008 Jun;211(2):469-79. Epub 2008 Mar 2.
4.
The effect of antibodies to TGF-beta1 and TGF-beta2 at a site of sciatic nerve repair.
Atkins S, etal., J Peripher Nerv Syst. 2006 Dec;11(4):286-93.
5.
Novel methylation panel for the early detection of neoplasia in high-risk ulcerative colitis and Crohn's colitis patients.
Azuara D, etal., Inflamm Bowel Dis. 2013 Jan;19(1):165-73. doi: 10.1002/ibd.22994.
6.
Differential expression of transforming growth factors-beta1, -beta2 and -beta3 in human colon carcinoma.
Bellone G, etal., Eur J Cancer. 2001 Jan;37(2):224-33.
7.
TGFbeta Type III and TGFbeta Type II receptors have distinct activities during epithelial-mesenchymal cell transformation in the embryonic heart.
Boyer AS and Runyan RB, Dev Dyn. 2001 Aug;221(4):454-9.
8.
Expression of transforming growth factor beta isoforms and their roles in tendon healing.
Chan KM, etal., Wound Repair Regen. 2008 May-Jun;16(3):399-407.
9.
Retinal neurons regulate proliferation of postnatal progenitors and Muller glia in the rat retina via TGF beta signaling.
Close JL, etal., Development. 2005 Jul;132(13):3015-26.
10.
Effects of high dose retinoic acid on TGF-beta2 expression during pancreatic organogenesis.
Colakoglu N, etal., J Mol Histol. 2005 Sep;36(6-7):413-8. Epub 2006 Feb 15.
11.
Ontogenic expression of TGFbeta 1, 2, and 3 and its receptors in the rat gastric mucosa.
de Andrade Sa ER, etal., Dev Dyn. 2003 Jul;227(3):450-7.
12.
Effect of propranolol on cardiac cytokine expression after myocardial infarction in rats.
Deten A, etal., Mol Cell Biochem. 2003 Sep;251(1-2):127-37.
13.
Astrocyte-derived transforming growth factor-{beta} mediates the neuroprotective effects of 17{beta}-estradiol: involvement of nonclassical genomic signaling pathways.
Dhandapani KM, etal., Endocrinology. 2005 Jun;146(6):2749-59. Epub 2005 Mar 3.
14.
The phosphodiesterase inhibitor, pentoxifylline, alters rat intestinal epithelial cell proliferation via changes in the expression of transforming growth factors.
Diab-Assef M, etal., Scand J Gastroenterol. 2002 Feb;37(2):206-14.
15.
Transforming growth factor beta1 suppresses nonmetastatic colon cancer at an early stage of tumorigenesis.
Engle SJ, etal., Cancer Res. 1999 Jul 15;59(14):3379-86.
16.
Microarray analysis of mechanical shear effects on flexor tendon cells.
Fong KD, etal., Plast Reconstr Surg. 2005 Oct;116(5):1393-404; discussion 1405-6.
17.
Inhibition of ALK5 signaling induces physeal dysplasia in rats.
Frazier K, etal., Toxicol Pathol. 2007;35(2):284-95.
18.
Enhanced expression of transforming growth factor beta isoforms in pancreatic cancer correlates with decreased survival.
Friess H, etal., Gastroenterology. 1993 Dec;105(6):1846-56. doi: 10.1016/0016-5085(93)91084-u.
19.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
20.
Dynamic expression patterns of transforming growth factor-beta(2) and transforming growth factor-beta receptors in experimental glomerulonephritis.
Hartner A, etal., J Mol Med. 2003 Jan;81(1):32-42. Epub 2002 Dec 14.
21.
Transforming growth factor beta2 is a neuronal death-inducing ligand for amyloid-beta precursor protein.
Hashimoto Y, etal., Mol Cell Biol. 2005 Nov;25(21):9304-17.
22.
A signaling pathway involving TGF-beta2 and snail in hair follicle morphogenesis.
Jamora C, etal., PLoS Biol. 2005 Jan;3(1):e11. Epub 2004 Dec 28.
23.
Mammalian transforming growth factor-betas: Smad signaling and physio-pathological roles.
Javelaud D and Mauviel A, Int J Biochem Cell Biol. 2004 Jul;36(7):1161-5.
24.
Transforming growth factor-beta 1, 2, 3 and receptor type I and II in diabetic foot ulcers.
Jude EB, etal., Diabet Med. 2002 Jun;19(6):440-7.
25.
DNA array analysis of the developing rat cerebellum: transforming growth factor-beta2 inhibits constitutively activated NF-kappaB in granule neurons.
Kaltschmidt B and Kaltschmidt C, Mech Dev. 2001 Mar;101(1-2):11-9.
26.
Divergent expression of liver transforming growth factor superfamily cytokines after successful portoenterostomy in biliary atresia.
Kerola A, etal., Surgery. 2019 May;165(5):905-911. doi: 10.1016/j.surg.2018.12.003. Epub 2019 Jan 25.
27.
Expression of TGFbeta family in the developing internal ear of rat embryos.
Kim HJ, etal., J Korean Med Sci. 2006 Feb;21(1):136-42.
28.
Chemoresponsiveness associated with canonical molecular changes in colorectal adenocarcinomas.
Kim JC, etal., Anticancer Res. 2009 Aug;29(8):3115-23.
29.
Expression of mitogen-activated protein kinase pathways during postnatal development of rat heart.
Kim SO, etal., J Cell Biochem 1998 Nov 1;71(2):286-301.
30.
The effects of treatment with antibodies to transforming growth factor beta1 and beta2 following spinal cord damage in the adult rat.
King VR, etal., Neuroscience. 2004;126(1):173-83.
31.
Effects of TGF-betas and a specific antagonist on apoptosis of immature rat male germ cells in vitro.
Konrad L, etal., Apoptosis. 2006 May;11(5):739-48.
32.
Transforming growth factor-beta2 mediates mesenchymal-epithelial interactions of testicular somatic cells.
Konrad L, etal., Endocrinology 2000 Oct;141(10):3679-86.
33.
Chronic hyperglycaemia increases TGFbeta2 signaling and the expression of extracellular matrix proteins in the rat parotid gland.
Lamers ML, etal., Matrix Biol. 2007 Sep;26(7):572-82. Epub 2007 May 16.
34.
Oral methylthioadenosine administration attenuates fibrosis and chronic liver disease progression in Mdr2-/- mice.
Latasa MU, etal., PLoS One. 2010 Dec 29;5(12):e15690. doi: 10.1371/journal.pone.0015690.
35.
Betaglycan can act as a dual modulator of TGF-beta access to signaling receptors: mapping of ligand binding and GAG attachment sites.
Lopez-Casillas F, etal., J Cell Biol. 1994 Feb;124(4):557-68.
36.
Modulation of transforming growth factor beta2 (TGF-beta2) by inositol hexaphosphate in colon carcinogenesis in rats.
Marks G, etal., Acta Cir Bras. 2006;21 Suppl 4:51-6.
37.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
38.
Macrophage migration inhibitory factor suppresses transforming growth factor-beta2 secretion in cultured rat testicular peritubular cells.
Muller R, etal., Reprod Fertil Dev. 2005;17(4):435-8.
39.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
40.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
41.
Transforming growth factor-beta 2 and TGF-beta 3 regulate fetal rat cranial suture morphogenesis by regulating rates of cell proliferation and apoptosis.
Opperman LA, etal., Dev Dyn. 2000 Oct;219(2):237-47.
42.
Cellular and molecular events associated with the bone-protecting activity of the noncalcemic vitamin D analog Ro-26-9228 in osteopenic rats.
Peleg S, etal., Endocrinology. 2002 May;143(5):1625-36.
43.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
44.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
45.
TGF beta 2, LIF and FGF2 cooperate to induce nephrogenesis.
Plisov SY, etal., Development. 2001 Apr;128(7):1045-57.
46.
Steady state levels of transforming growth factor-beta1 and -beta2 mRNA and protein expression are elevated in colonic tumors in vivo irrespective of dietary lipids intervention.
Raju J, etal., Int J Cancer 2002 Aug 20;100(6):635-41.
47.
Transforming growth factor-beta stimulates vascular endothelial growth factor production by folliculostellate pituitary cells.
Renner U, etal., Endocrinology 2002 Oct;143(10):3759-65.
48.
GOA pipeline
RGD automated data pipeline
49.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
50.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
51.
Transforming growth factor-beta 2 gene silencing with trabedersen (AP 12009) in pancreatic cancer.
Schlingensiepen KH, etal., Cancer Sci. 2011 Jun;102(6):1193-200. doi: 10.1111/j.1349-7006.2011.01917.x. Epub 2011 Mar 30.
52.
Transforming growth factor beta1 and beta2 (TGFbeta2 / TGFbeta2) profile changes in previously irradiated free flap beds.
Schultze-Mosgau S, etal., Head Neck. 2002 Jan;24(1):33-41.
53.
Involvement of transforming growth factor-beta in regulation of calcium transients in diabetic vascular smooth muscle cells.
Sharma K, etal., Am J Physiol Renal Physiol 2003 Dec;285(6):F1258-70.
54.
TGF-beta expression during rat pregnancy and activity on decidual cell survival.
Shooner C, etal., Reprod Biol Endocrinol. 2005 May 31;3:20.
55.
Downregulation of transforming growth factor-beta2 facilitates inflammation in the central nervous system by reciprocal astrocyte/microglia interactions.
Siglienti I, etal., J Neuropathol Exp Neurol. 2007 Jan;66(1):47-56.
56.
Immunolocalization of TGF-beta2 in the rat thymus during late stages of prenatal development.
Sonmez MF, etal., Acta Histochem. 2008 Jun 11.
57.
Transforming growth factor beta2 is released from PC12 cells via the regulated pathway of secretion.
Specht H, etal., Mol Cell Neurosci. 2003 Jan;22(1):75-86.
58.
Lesion-associated expression of transforming growth factor-beta-2 in the rat nervous system: evidence for down-regulating the phagocytic activity of microglia and macrophages.
Stoll G, etal., Brain Pathol. 2004 Jan;14(1):51-8.
59.
Expression of the TGF-beta family of ligands is developmentally regulated in skeletal muscle of neonatal rats.
Suryawan A, etal., Pediatr Res. 2006 Feb;59(2):175-9.
60.
The effect of therapeutic hypothermia on the expression of inflammatory response genes following moderate traumatic brain injury in the rat.
Truettner JS, etal., Brain Res Mol Brain Res. 2005 Aug 18;138(2):124-34.
61.
The potential role of TGFbeta1, TGFbeta2 and TGFbeta3 protein expression in colorectal carcinomas. Correlation with classic histopathologic factors and patient survival.
Tsamandas AC, etal., Strahlenther Onkol. 2004 Apr;180(4):201-8.
62.
Differential cytokine activity and morphology during wound healing in the neonatal and adult rat skin.
Wagner W and Wehrmann M, J Cell Mol Med. 2007 Nov-Dec;11(6):1342-51.
63.
Cloning and expression of glucocorticoid-induced genes in fetal rat lung fibroblasts. Transforming growth factor-beta 3.
Wang J, etal., J Biol Chem 1995 Feb 10;270(6):2722-8.
64.
Quantitative monitoring of the mRNA expression pattern of the TGF-beta-isoforms (beta 1, beta 2, beta 3) during transdifferentiation of hepatic stellate cells using a newly developed real-time SYBR Green PCR.
Wickert L, etal., Biochem Biophys Res Commun 2002 Jul 12;295(2):330-5.
65.
Cell-type-specific activation of PAK2 by transforming growth factor beta independent of Smad2 and Smad3.
Wilkes MC, etal., Mol Cell Biol. 2003 Dec;23(23):8878-89.
66.
Antigen presentation by vaginal cells: role of TGFbeta as a mediator of estradiol inhibition of antigen presentation.
Wira CR, etal., Endocrinology 2002 Aug;143(8):2872-9.
67.
Effects of aging on growth factors gene and protein expression in the dorsal and ventral lobes of rat prostate.
Zhao H, etal., Biochem Biophys Res Commun 2002 Mar 29;292(2):482-91.
68.
Transforming growth factor-beta(s) and their receptors in aging rat prostate.
Zhao H, etal., Biochem Biophys Res Commun. 2002 Jun 7;294(2):464-9.
Tgfb2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 100,691,540 - 100,793,227 (-) NCBI GRCr8 mRatBN7.2 13 98,160,075 - 98,261,771 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 98,160,087 - 98,261,405 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 100,678,931 - 100,778,632 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 102,066,560 - 102,165,910 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 99,261,239 - 99,360,947 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 105,039,639 - 105,142,010 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 105,039,853 - 105,141,030 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 109,679,866 - 109,792,609 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 102,718,703 - 102,818,768 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 102,907,748 - 103,007,811 (-) NCBI Celera 13 97,669,691 - 97,769,426 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
TGFB2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 218,345,336 - 218,444,619 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 218,345,336 - 218,444,619 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 218,518,678 - 218,617,961 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 216,586,491 - 216,681,596 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 214,908,262 - 215,003,365 NCBI Celera 1 191,735,848 - 191,834,418 (+) NCBI Celera Cytogenetic Map 1 q41 NCBI HuRef 1 189,186,842 - 189,286,057 (+) NCBI HuRef CHM1_1 1 219,791,024 - 219,890,484 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 217,580,100 - 217,679,392 (+) NCBI T2T-CHM13v2.0
Tgfb2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 186,354,984 - 186,441,504 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 186,354,989 - 186,438,186 (-) Ensembl GRCm39 Ensembl GRCm38 1 186,622,787 - 186,709,697 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 186,622,792 - 186,705,989 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 188,447,065 - 188,529,871 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 188,324,430 - 188,406,777 (-) NCBI MGSCv36 mm8 Celera 1 193,563,609 - 193,649,724 (-) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 89.95 NCBI
Tgfb2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 172,814 - 249,248 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 174,949 - 249,248 (-) NCBI ChiLan1.0 ChiLan1.0
TGFB2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 30,962,733 - 31,060,610 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 30,925,280 - 31,023,656 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 193,907,398 - 194,005,800 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 198,758,718 - 198,856,853 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 198,758,751 - 198,859,041 (+) Ensembl panpan1.1 panPan2
TGFB2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 13,430,832 - 13,511,655 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 13,429,148 - 13,510,242 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 13,472,728 - 13,552,654 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 13,464,207 - 13,544,357 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 13,464,807 - 13,545,256 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 13,473,487 - 13,553,481 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 13,819,811 - 13,899,809 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 14,128,921 - 14,209,014 (+) NCBI UU_Cfam_GSD_1.0
Tgfb2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
TGFB2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 8,305,539 - 8,390,341 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 8,306,136 - 8,435,307 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 10,353,794 - 10,476,143 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 10 p16 NCBI
TGFB2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 11,163,651 - 11,259,868 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 11,163,100 - 11,258,470 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 11,574,533 - 11,672,282 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tgfb2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 99 Count of miRNA genes: 89 Interacting mature miRNAs: 93 Transcripts: ENSRNOT00000003313 Prediction methods: Miranda Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
RH135195
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 98,260,777 - 98,260,958 (+) MAPPER mRatBN7.2 Rnor_6.0 13 105,140,324 - 105,140,504 NCBI Rnor6.0 Rnor_5.0 13 109,791,120 - 109,791,300 UniSTS Rnor5.0 RGSC_v3.4 13 102,818,312 - 102,818,492 UniSTS RGSC3.4 Celera 13 97,768,970 - 97,769,150 UniSTS RH 3.4 Map 13 666.0 UniSTS Cytogenetic Map 13 q26 UniSTS
G39607
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 98,231,469 - 98,231,772 (+) MAPPER mRatBN7.2 Rnor_6.0 13 105,111,026 - 105,111,328 NCBI Rnor6.0 Rnor_5.0 13 109,761,807 - 109,762,109 UniSTS Rnor5.0 RGSC_v3.4 13 102,788,984 - 102,789,286 UniSTS RGSC3.4 Celera 13 97,739,652 - 97,739,954 UniSTS Cytogenetic Map 13 q26 UniSTS
UniSTS:224971
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 98,261,133 - 98,261,281 (+) MAPPER mRatBN7.2 Rnor_6.0 13 105,140,680 - 105,140,827 NCBI Rnor6.0 Rnor_5.0 13 109,791,476 - 109,791,623 UniSTS Rnor5.0 RGSC_v3.4 13 102,818,668 - 102,818,815 UniSTS RGSC3.4 Celera 13 97,769,326 - 97,769,473 UniSTS Cytogenetic Map 13 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003313 ⟹ ENSRNOP00000003313
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 98,160,087 - 98,261,191 (-) Ensembl Rnor_6.0 Ensembl 13 105,039,853 - 105,141,030 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000087023 ⟹ ENSRNOP00000074059
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 13 105,042,274 - 105,140,473 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111585 ⟹ ENSRNOP00000086888
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 98,259,354 - 98,261,405 (-) Ensembl
RefSeq Acc Id:
NM_031131 ⟹ NP_112393
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 100,692,953 - 100,792,685 (-) NCBI mRatBN7.2 13 98,161,488 - 98,261,234 (-) NCBI Rnor_6.0 13 105,041,052 - 105,140,780 (-) NCBI Rnor_5.0 13 109,679,866 - 109,792,609 (-) NCBI RGSC_v3.4 13 102,718,703 - 102,818,768 (-) RGD Celera 13 97,669,691 - 97,769,426 (-) RGD
Sequence:
TCAGAGCCCTCACCCTCTCCCTTCCAGGAGAAAAAACAAACCTTTCTTACTCCTTAAAGTGAGAGATCCCCCTCCTGCCTCCCTAGCATCGCATATTAATATCTCCACGTTGGGAACGCGTTGCATTT TCTTTTTTAAAGGAATCCTAGCCAGGGACGTTTTTCTATTGGGCATTGACTTTCAACTGCTTTGCAAAAGTTTCGTATTAAAAACAACTCTACCTGACCCGCTCTGAGAATTACTAGTTTCTTTTTAT ATTTTTTTCTTACTTTAAACAACAACAACAACGTTTCCTCCTTTTAAAAACATGCACTACTGTGTGCTGAGAACCTTTTTGCTCCTGCATCTGGTCCCGGTGGCGCTCAGTCTGTCTACCTGCAGCAC CCTCGACATGGACCAGTTTATGCGCAAGAGGATCGAGGCCATCCGCGGGCAGATCCTGAGCAAGCTGAAGCTCACCAGCCCCCCGGAAGACTATCCGGAGCCGGATGAGGTCCCCCCGGAGGTGATTT CCATCTACAACAGTACCAGGGACTTACTGCAGGAGAAGGCAAGCCGGAGGGCAGCCGCCTGCGAGCGCGAGCGAAGCGACGAGGAGTACTACGCCAAGGAGGTTTATAAAATCGACATGCCGTCCCAC TTCCCCTCCGAAACTGTCTGCCCAGTTGTTACAACATCCTCTGGCTCAGTGGGCAGCTTTTGCTCCATACAGTCCCAGGTGCTCTGTGGGTACCTTGATGCCATCCCGCCCACTTTCTACAGACCCTA CTTCAGAATCGTCCGCTTCGATGTCTCAACAATGGAGAAGAATGCTTCAAATCTGGTGAAGGCAGAGTTCAGGGTCTTTCGCTTGCAGAACCCCAAGGCCAGAGTGGCTGAACAACGGATTGAACTGT ATCAGATCCTTAAATCCAAAGACCTAACATCTCCAACCCAGCGCTACATTGATAGCAAGGTTGTGAAAACCAGAGCCGAGGGGGAATGGCTCTCCTTCGACGTGACAGACGCCGTGCACGAGTGGCTT CACCACAAAGACAGGAACCTGGGATTTAAAATAAGTTTACACTGCCCCTGCTGTACCTTCATACCGTCTAATAATTACATCATCCCAAATAAGAGCCAAGAGCTGGAGGCGAGATTCGCAGGTATCGA TGGCACCTCCACATATGCCAGTGGTGATCAGAAAACTATAAAGTCCACTAGGAAAAAAAGCAGTGGGAAGACCCCGCATCTCCTGCTAATGTTGTTGCCCTCCTACAGACTGGAGTCCCAGCAGTCCA GCCGGCGACGGAAGCGGGCTTTGGATGCCGCCTATTGCTTTAGGAATGTGCAGGATAATTGCTGCCTTCGCCCTCTTTACATTGATTTTAAGAGGGATCTTGGATGGAAATGGATCCATGAACCCAAA GGATACAATGCTAACTTCTGTGCTGGGGCATGCCCTTATCTGTGGAGTTCAGACACACAACACACCAAAGTCCTCAGCCTGTACAACACCATAAACCCCGAAGCTTCTGCTTCCCCTTGCTGTGTGTC CCAGGATCTGGAACCACTGACCATCCTCTACTACATTGGCAATACGCCCAAGATCGAACAGCTTTCCAACATGATCGTCAAGTCTTGTAAATGCAGCTAAAGTCCTCGGGAAAGCCAGGATGAAAATC ACGGTGACAATGACGTATGACGACAATGACGATGATAATGTTCGTGACGTGAGGGAGTTTTGATTCATCAGTGTTGAAAAAAAAATTGGAGGAAAAAAAAATCGGTACTAGTTCAAACACTTTGCAAG CTTGTGTTCTGTTTGTTAAAACTGGCATCTGGGATTACAGCAACAACAGCCACAAAAATGGAAGGCGCTAGTCTGCATCTCACCTACTTCCTGAGAGACACAAAAAGAAAACATCTTTTTTTTTTAAA GGAAAAAATAAACACTGGAAGAATTTGTTAGTGTTAATTATGTGAAAGAAAAAACAAAACAAAACAGGAAAATCCGTTCAGTGGAGTTGTATGTATTGTTTCCACCCCATTCTTCACCCCACGCCTCT CTTGTTTCCTCTGTATTGCTCTGCAATGGGCGCCCTCCCCATCCCTTCCTCTGAGTTAACAGTGGGTTATTTATTGTGTTACTATATAATGAACCTTTCATTGCCCTTGGAAAATAAAACAGGTGTAT AAGTGGAGACCAAATACTTTGCCACAAACTCATGGATGGCTTAAGGAATTTGGACTCAAATAAGCCAGGGGGAAGGAGGTCATACTGGATGACCCCCTGTGAGCCGTTATAGAACTGAGCAAGTCTGA GAAAAAAAAATCAAAGCCCCAGAAAACATGTGCTGTGCACTGCCTGCCGAAGCTTCATGAGCAGCCATCTGTCCAGAAGGCCTGTTAACAAGAAAACTTGGAATCAGTGGGAATCTGGAAGATTGGTT TTTTTTCCTTCTAATTGTAAATGGTTCTTTGCCAGTTTAAGCAAGCCGGTGAAATGGTGACCTGCTTGGATGTGTATTGTCAGACTTTTGACCGTGAAGTGGCTGTTGATCTACAATACAGGTTTTTT TTTTCCCTTTGTCTCGGTATACGGTAATTACATGGATATTATTAAAATAGACGGGTCTAGAAGCCAGCATGATGAAAACACACTGCAAATCTGTTTTACAAACTATTAAATCGAAACAGTAACTACTT TACATGTAATGTGTAGATCTTACCACATTTTTAAATATTCTGTAATAATGATTATGATTTAGATTGAACTTAAATTTGAACTCTCTCTCTTTTTTTAATGATCATTCAGACTGTATGTTTGCCTCCTT TAGCTGGCCAGTACCTTTGAATAAAACCCCTAGATTTTGACTTGCACTACAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_006250448 ⟹ XP_006250510
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 100,691,540 - 100,793,227 (-) NCBI mRatBN7.2 13 98,160,075 - 98,261,771 (-) NCBI Rnor_6.0 13 105,039,639 - 105,142,010 (-) NCBI Rnor_5.0 13 109,679,866 - 109,792,609 (-) NCBI
Sequence:
CTGCACATGCGTGCGCACGTGCTCAATACAGGAGGGACTCAGTCTGGGAAGCTGCGAATGAATG ATCCCCACTGTGTAGAAATGGGATGCTTTTAGCTGCTTGCCCCTCCACAGACAGTCCCTTGGTGATCACAGCGACTACTGCAAATTCCTCATGCCAGTAGCCCTCCCCTTCGGGCCATCCCTTTTCCA CACCCCCTCAATTGTCGAGAGCTCGTGGTCTTAGTAACGGAGAACTTCTGACTGTAACCCTAGCGCGTCACTTTGTTGAAGGCAAACACGTGGTTTGGGGAGCACTTATAAATCTCTGCTCTGGGCAG GACCGTGATGTTATCTGCTGGCAGCCAAAGGTTTGCTTGGAGCGGAGCTGCTGAAGCAGCGGGCGGGAGAGCAAGTGGGAGAGGAAGAGAGAAAAGCCTCAGAGAGCTGAGCTCCAGGGCAGGCGCCA GGGATGGAGAGAAGTATTAGGGTTTAAGGAGACGTTCTGGTGCAGCCCAGCTGCAGAGAGAAGGTATCAGCAGAGGTGTATTTTAGGGTCGCAAGTACCTACTTACCCTAAGCGAGAAAGTGCAAGCT TGGAGGAAAAGCTAGAGAAGGGTGTGAGTCCGGGGACTGCTTGCAGCTAACGCGCCCAGGAGGCGGTGTTGTTCCACTGGGGGTTAAGGAGGTGGCTGATCTCTGTCGCCCTTGGCTGCCTGAAGCAA GAAAAGGAGGATCTGCTGGACCGAGCTGGAGGCTGGCCCTCTTTGCAGGCGGCAGCGGCGGCTGCAACGTGGAGCGACCCAGCCGGGTGTAGGCCACAGCACGGCCCGCAGGAGCGGGGGTCGTGGCT GCCTGCTCAGGCCTTGGCGGATCTCCCGGGCGGACAGTGCCCCACCGAGTCTCCGAGAGTGAGCCGCTCCGGGGCGCATCTGCCTCCCCGCGGCTCGCCAGGCTCGCCCTCGGCGCGCGCACACGCAC GCGCGCACACGCGCACACATCCACACGCACACTCATCCACACACGTGTGGAAGGCAGGGCCCAGCCGCTCGGTCTTTGAACATCTCAGTTAGAGCCCGGCGCAGTCCCGGCCGCCGCTCAGCGCTCCC CGCGGCCCTGCGTGCCTCCTGCCAGCCCCCGGACCTTCTCGTCTCTTCCCTTTTGGCCGGAGGATCGGAGTTCAGATCAGCCACTCCGCACCCGAGCCTGACACACTGAACTCCATTTCTTCCTCTTA AGTTTATTTCTACTTCAGAGCCACTCACCCTCTCCCTTCCAGGAGAAAAAACAAACCTTTCTTACTCCTTAAAGTGAGAGATCCCCCTCCTGCCTCCCTAGCATCGCATATTAATATCTCCACGTTGG GAACGCGTTGCATTTTCTTTTTTAAAGGAATCCTAGCCAGGGACGTTTTTCTATTGGGCATTGACTTTCAACTGCTTTGCAAAAGTTTCGTATTAAAAACAACTCTACCTGACCCGCTCTGAGAATTA CTAGTTTCTTTTTATATTTTTTTCTTACTTTAAACAACAACAACAACGTTTCCTCCTTTTAAAAACATGCACTACTGTGTGCTGAGAACCTTTTTGCTCCTGCATCTGGTCCCGGTGGCGCTCAGTCT GTCTACCTGCAGCACCCTCGACATGGACCAGTTTATGCGCAAGAGGATCGAGGCCATCCGCGGGCAGATCCTGAGCAAGCTGAAGCTCACCAGCCCCCCGGAAGACTATCCGGAGCCGGATGAGGTCC CCCCGGAGGTGATTTCCATCTACAACAGTACCAGGGACTTACTGCAGGAGAAGGCAAGCCGGAGGGCAGCCGCCTGCGAGCGCGAGCGAAGCGACGAGGAGTACTACGCCAAGGAGGTTTATAAAATC GACATGCCGTCCCACTTCCCCTCCGAAAATGCCATCCCGCCCACTTTCTACAGACCCTACTTCAGAATCGTCCGCTTCGATGTCTCAACAATGGAGAAGAATGCTTCAAATCTGGTGAAGGCAGAGTT CAGGGTCTTTCGCTTGCAGAACCCCAAGGCCAGAGTGGCTGAACAACGGATTGAACTGTATCAGATCCTTAAATCCAAAGACCTAACATCTCCAACCCAGCGCTACATTGATAGCAAGGTTGTGAAAA CCAGAGCCGAGGGGGAATGGCTCTCCTTCGACGTGACAGACGCCGTGCACGAGTGGCTTCACCACAAAGACAGGAACCTGGGATTTAAAATAAGTTTACACTGCCCCTGCTGTACCTTCATACCGTCT AATAATTACATCATCCCAAATAAGAGCCAAGAGCTGGAGGCGAGATTCGCAGGTATCGATGGCACCTCCACATATGCCAGTGGTGATCAGAAAACTATAAAGTCCACTAGGAAAAAAAGCAGTGGGAA GACCCCGCATCTCCTGCTAATGTTGTTGCCCTCCTACAGACTGGAGTCCCAGCAGTCCAGCCGGCGACGGAAGCGGGCTTTGGATGCCGCCTATTGCTTTAGGAATGTGCAGGATAATTGCTGCCTTC GCCCTCTTTACATTGATTTTAAGAGGGATCTTGGATGGAAATGGATCCATGAACCCAAAGGATACAATGCTAACTTCTGTGCTGGGGCATGCCCTTATCTGTGGAGTTCAGACACACAACACACCAAA GTCCTCAGCCTGTACAACACCATAAACCCCGAAGCTTCTGCTTCCCCTTGCTGTGTGTCCCAGGATCTGGAACCACTGACCATCCTCTACTACATTGGCAATACGCCCAAGATCGAACAACTTTCCAA CATGATCGTCAAGTCTTGTAAATGCAGCTAAAGTCCTCGGGAAAGCCAGGATGAAAATCACGGTGACAATGACGTATGACGACAATGACGATGATAATGTTCGTGACGTGAGGGAGTTTTGATTCATC AGTGTTGAAAAAAAAATTGGAGGAAAAAAAAATCGGTACTAGTTCAAACACTTTGCAAGCTTGTGTTCTGTTTGTTAAAACTGGCATCTGGGATTACAGCAACAACAGCCACAAAAATGGAAGGCGTT AGTCTGCATCTCACCTACTTCCTGAGAGACACAAAAAGAAAACATCTTTTTTTTTTTAAAGGAAAAAATAAACACTGGAAGAATTTGTTAGTGTTAATTATGTGAAAGAAAAAACAAAACAAAACAGG AAAATCCGTTCAGTGGAGTTGTATGTATTGTTTCCACCCCATTCTTCACCCCACGCCTCTCTTGTTTCCTCTGTATTGCTCTGCAATGGGCGCCCTCCCCATCCCTTCCTCTGAGTTAACAGTGGGTT ATTTATTGTGTTACTATATAATGAACCTTTCATTGCCCTTGGAAAATAAAACAGGTGTATAAGTGGAGACCAAATACTTTGCCACAAACTCATGGATGGCTTAAGGAATTTGGACTCAAATAAGCCAG GGGGAAGGAGGTCATACTGGATGACCCCCTGTGAGCCGTTATAGAACTGAGCAAGTCTGAGAAAAAAAATCAAAGCCCCAGAAAACATGTGCTGTGCACTGCCTGCCGAAGCTTCATGAGCAGCCATC TGTCCAGAAGGCCTGTTAACAAGAAAACTTGGAATCAGTGGGAATCTGGAAGATTGGTTTTTTTTCCTTCTAATTGTAAATGGTTCTTTGCCAGTTTAAGCAAGCCGGTGAAATGGTGACCTGCTTGG ATGTGTATTGTCAGACTTTTGACCGTGAAGTGGCTGTTGATCTACAATACAGGTTTTTTTTTCCCTTTGTCTTGGTATACGTAATTACATGGATATTATTAAAATAGACGGGTCTAGAAGCCAGCATG ATGAAAACACACTGCAAATCTGTTTTACAAACTATTAAATCGAAACAGTAACTACTTTACATGTAATGTGTAGATCTTACCACATTTTTAAATATTCTGTAATAATGATTATGATTTAGATTGAACTT AAATTTGAACTCTCTCTCTTTTTTTAATGATCATTCAGACTGTATGTTTGCCTCCTTTAGCTGGCCAGTACCTTTGAATAAAACCCCTAGATTTTGACTTGCACTACAAATTCAAGTTTTTAATACTG TCTTCTCTGCCTGTATTTTATGTATTGTCCATTTTCCCCATACCCCCAGTTCCTTCTAGTTTCCAAAAGACAAAAAAAAAAGAAAAAAAAAGAAAAAAAGAAAGAAAACAAAAATAAAAAACAAAGCC CAAAAAGATAGGTTTGAGTTCCAGTGTACCCCATCTTTTTTTGCGTCAGTATGAGTCAGGTTGGCTGGTAAGCGGTGCTTCTCCTGGGAAAATGGAGCCTGGTCAACACAGAGGACTGAGCACAAATG TAGTTTTGGAAAGGGTTTCAGAATCTGAACTCAGAGTCTCCGTGACTGGGCTAGGAAAAGTTTCTCTAGGTCATATATTTATAGACCCTTTTTGCTGTTCAAAAGCAAACAGTTCAAAGGAAGCATCT TTTTCTTTAATTGGGCTTTTGGTATTCATAGGGAGTATGAAAAGGTTGAGTTTTTCAAAGGGGGAGAAAAGTCCAGCCAGCATTCATCATTTTGTTTGTAATTTCATTCATTATTTTCGTGATATTAC TGAGGTTCAGGTGTTGAAAGACATTCTTTGCAGGGTGACAAAAAAAAAAAAAAGGCACAAACCAAAATCACCCTTGTCAAACCATTCTTCCAAGCAAGCATGCTCTACCCGAGGTCAGCCTCCATTTG AAGTTGTTGGATCTCTCTGTTGTGGGGCCTGACAGTAGGTTTTACAGGGTGGGTGTCCTTGTCACATAGCTTCAAAATATAAACCGGTCCATGACACGATGGACTATTTGTGGTCTTCCCCCAAAGGG CAGCACAGTGAGGTGTGAATGCAAAGAGAATTTCTTTGATCGTGGACACACTTCTCTGAAGAGCTTTCCTCGGAATTCACTAAGACGGAGAATGGAATTTTCCAGCCAGAAGACAGACAGAGCAAGCA CTGGTGAACGGCCTCCGTGTTGGGTGCAGCACAACCCCAGATCTGCACCTCAGCTCCTATTTCCCCCTTCCATGTTTCTGTTGTTTCTGTATAACTCCTCACCAGCCCTTATTTCTGCAGATACTTTC CTCTCGGATAAAATGACATTTATGTTCTGTATGATTTGTCTCTCCTTCTGAATGCACTGACTGCTAGTTTAAGGGTTCTTGAATCTATTTTACGTTTAAGTCTGTGGGTTCTACAGGTCTTTCTTTCC AGTTAGTAAGTATTGCCACGGGAGGGGTGGTGGTAGGGAGGGGGAGGGAGGTGTTAGCATATGGGTGGGGCAGCGGATTGTATGTGTTAAGCAACAGTACAATTTTATGGTTGGCATGGATTTTAAAG AATGGGTTATAAGAGCAGATGTTACATGTTTTGATGACCAATTGCGCTGTATTTTTAACACGATGCATGTCTGGTTTTGTGGTGCTCTAGTGGTAAATAAATTATTTCAGTTACA
hide sequence
RefSeq Acc Id:
NP_112393 ⟸ NM_031131
- Peptide Label:
precursor
- UniProtKB:
Q9WUQ8 (UniProtKB/Swiss-Prot), Q9R2B8 (UniProtKB/Swiss-Prot), Q9R298 (UniProtKB/Swiss-Prot), Q9R281 (UniProtKB/Swiss-Prot), Q9QW26 (UniProtKB/Swiss-Prot), Q63574 (UniProtKB/Swiss-Prot), Q07257 (UniProtKB/Swiss-Prot), G3V6B1 (UniProtKB/TrEMBL), A6JGS6 (UniProtKB/TrEMBL)
- Sequence:
MHYCVLRTFLLLHLVPVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPDEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHFPSETVCPVVTTSSGSV GSFCSIQSQVLCGYLDAIPPTFYRPYFRIVRFDVSTMEKNASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPC CTFIPSNNYIIPNKSQELEARFAGIDGTSTYASGDQKTIKSTRKKSSGKTPHLLLMLLPSYRLESQQSSRRRKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSS DTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
hide sequence
RefSeq Acc Id:
XP_006250510 ⟸ XM_006250448
- Peptide Label:
isoform X1
- Sequence:
MHYCVLRTFLLLHLVPVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPDEVP PEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHFPSENAIPPTFYRPYFRIVRFDVSTMEKNASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLTSPTQRYIDSKVVKT RAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFIPSNNYIIPNKSQELEARFAGIDGTSTYASGDQKTIKSTRKKSSGKTPHLLLMLLPSYRLESQQSSRRRKRALDAAYCFRNVQDNCCLR PLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
hide sequence
Ensembl Acc Id:
ENSRNOP00000074059 ⟸ ENSRNOT00000087023
Ensembl Acc Id:
ENSRNOP00000003313 ⟸ ENSRNOT00000003313
Ensembl Acc Id:
ENSRNOP00000086888 ⟸ ENSRNOT00000111585
RGD ID: 13699097
Promoter ID: EPDNEW_R9622
Type: multiple initiation site
Name: Tgfb2_1
Description: transforming growth factor, beta 2
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 105,140,964 - 105,141,024 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2003-04-09
Tgfb2
transforming growth factor, beta 2
Symbol and Name status set to approved
629479
APPROVED
2002-06-10
Tgfb2
transforming growth factor, beta 2
Symbol and Name status set to provisional
70585
PROVISIONAL
Note Type
Note
Reference
gene_expression
lacking in young rat prostates but present in both the stroma and epithelium of aging prostates
70812
gene_process
stimulates proliferation of fetal lung epithelial cells
70317
gene_process
stimulates proliferation of fetal lung epithelial cells
70812
gene_process
stimulates cell growth
70317
gene_process
stimulates cell growth
70812
gene_process
stimulates lactotroph cell growth possibly by enhancing prolactin secretion through increased number of lactotroph cells and stimulates vascular endothelial growth factor (Vegf) in pituitary cells
625677
gene_process
may modulate growth and function of endocrine pituitary cells including intrapituitary vascular permeablility, intergrity and angiogenesis
625677
gene_product
member of Tgf beta superfamily
625677